Venkata S Mandala1, Shu-Yu Liao1, Martin D Gelenter1, Mei Hong2. 1. Department of Chemistry, Massachusetts Institute of Technology, 170 Albany Street, Cambridge, MA, 02139, USA. 2. Department of Chemistry, Massachusetts Institute of Technology, 170 Albany Street, Cambridge, MA, 02139, USA. meihong@mit.edu.
Abstract
Influenza A and B viruses cause seasonal flu epidemics. The M2 protein of influenza B (BM2) is a membrane-embedded tetrameric proton channel that is essential for the viral lifecycle. BM2 is a functional analog of AM2 but shares only 24% sequence identity for the transmembrane (TM) domain. The structure and function of AM2, which is targeted by two antiviral drugs, have been well characterized. In comparison, much less is known about the structure of BM2 and no drug is so far available to inhibit this protein. Here we use solid-state NMR spectroscopy to investigate the conformation of BM2(1-51) in phospholipid bilayers at high pH, which corresponds to the closed state of the channel. Using 2D and 3D correlation NMR experiments, we resolved and assigned the 13C and 15N chemical shifts of 29 residues of the TM domain, which yielded backbone (φ, ψ) torsion angles. Residues 6-28 form a well-ordered α-helix, whereas residues 1-5 and 29-35 display chemical shifts that are indicative of random coil or β-sheet conformations. The length of the BM2-TM helix resembles that of AM2-TM, despite their markedly different amino acid sequences. In comparison, large 15N chemical shift differences are observed between bilayer-bound BM2 and micelle-bound BM2, indicating that the TM helix conformation and the backbone hydrogen bonding in lipid bilayers differ from the micelle-bound conformation. Moreover, HN chemical shifts of micelle-bound BM2 lack the periodic trend expected for coiled coil helices, which disagree with the presence of a coiled coil structure in micelles. These results establish the basis for determining the full three-dimensional structure of the tetrameric BM2 to elucidate its proton-conduction mechanism.
Influenza A and B viruses cause seasonal flu epidemics. The M2 protein of influenza B (BM2) is a membrane-embedded tetrameric proton channel that is essential for the viral lifecycle. BM2 is a functional analog of AM2 but shares only 24% sequence identity for the transmembrane (TM) domain. The structure and function of AM2, which is targeted by two antiviral drugs, have been well characterized. In comparison, much less is known about the structure of BM2 and no drug is so far available to inhibit this protein. Here we use solid-state NMR spectroscopy to investigate the conformation of BM2(1-51) in phospholipid bilayers at high pH, which corresponds to the closed state of the channel. Using 2D and 3D correlation NMR experiments, we resolved and assigned the 13C and 15N chemical shifts of 29 residues of the TM domain, which yielded backbone (φ, ψ) torsion angles. Residues 6-28 form a well-ordered α-helix, whereas residues 1-5 and 29-35 display chemical shifts that are indicative of random coil or β-sheet conformations. The length of the BM2-TM helix resembles that of AM2-TM, despite their markedly different amino acid sequences. In comparison, large 15N chemical shift differences are observed between bilayer-bound BM2 and micelle-bound BM2, indicating that the TM helix conformation and the backbone hydrogen bonding in lipid bilayers differ from the micelle-bound conformation. Moreover, HN chemical shifts of micelle-bound BM2 lack the periodic trend expected for coiled coil helices, which disagree with the presence of a coiled coil structure in micelles. These results establish the basis for determining the full three-dimensional structure of the tetrameric BM2 to elucidate its proton-conduction mechanism.
Influenza and pneumonia cause 9 to 35 million cases of infection in humans and over 55,000 deaths each year in the US[1]. Flu infection is caused by influenza A and B viruses, with the B strain dominating in the spring months of the flu season. Essential to the lifecycle of both viruses is the integral membrane protein M2, an acid-activated tetrameric proton channel[2-4]. AM2 and BM2 are thus important targets for anti-influenza therapies. The antiviral drugs amantadine and rimantadine inhibit AM2 by blocking its transmembrane (TM) pore[5-8], but so far BM2 is not inhibited by any drug, owing to the very different amino acid sequence of the BM2 TM domain from that of AM2 (Fig. 1). Mutagenesis and proton-current measurements indicated that the AM2-TM domain has predominantly hydrophobic pore-facing residues[9] whereas the BM2-TM pore is lined by three polar serines (Ser9, Ser12, and Ser16) (Fig. 1)[10]. The only conserved sequence element between the two TM domains is a HxxxW motif, in which histidine (His) is the proton-selective residue and tryptophan (Trp) is the gating residue[3,11]. Mutation of BM2His19 abolishes proton conduction[12] whereas mutation of AM2His37 disrupts proton selectivity and acid activation[2,13,14]. Despite the conserved HxxxW element, AM2 and BM2 exhibit various differences in their proton conduction profiles. Liposomal proton-flux measurements indicate BM2 conducts protons twice as fast as AM2[15]. Whole-cell electrophysiology data[16] showed that the two proteins have similar inward proton current at negative voltages, but at positive voltages BM2 conducts protons outward whereas AM2 does not[16]. Consistent with these functional differences, solid-state NMR data indicate that His19 in BM2 protonates with significantly lower proton-dissociation equilibrium constants (pK’s) compared to His37 in AM2[17] and to a peripheral His27 in BM2[18].
Figure 1
Comparison of the amino acid sequences of the transmembrane region and part of the cytoplasmic region of AM2 and BM2 proteins[24]. Residues at heptad positions a and d, which represent pore-lining residues, are bolded, and the functionally crucial HxxxW motif is underlined.
Comparison of the amino acid sequences of the transmembrane region and part of the cytoplasmic region of AM2 and BM2 proteins[24]. Residues at heptad positions a and d, which represent pore-lining residues, are bolded, and the functionally crucial HxxxW motif is underlined.Crucial to understanding the proton-conduction and drug-binding differences between AM2 and BM2 are the three-dimensional structures of the proteins in lipid bilayers. It is important to study M2 in lipid bilayers because the small size and oligomeric nature of these proteins make them susceptible to structural perturbations by the membrane environment[19]. The atomic structure of AM2 has been extensively studied[20], but the structure of BM2 in lipid bilayers is not known. So far the only structure of BM2-TM was solved in DHPC micelles using solution NMR[15] and showed a coiled coil tetramer that is distinct from the straight four-helix bundle of AM2-TM determined by X-ray crystallography[7,21-23], solid-state NMR[8,24] and solution NMR[25]. Even the distinct dimer-of-dimers structure of S31N-AM2, which was solved in DPhPC bilayers, shows straight helices[26]. In principle, the low sequence identity of 24% between BM2 and AM2 TM domains may cause structural differences. However, proteins with low sequence homology but similar functions often adopt similar three-dimensional structures. For example, the G-protein coupled receptors rhodopsin and A2A adenosine receptor[27] have a low sequence identity of 22% but show backbone RMSDs of 0.27 Å for individual helices. The potassium channels KcsA and MthK have 38% sequence identity for the selectivity filter and inner helix region but adopt the same fold[28,29].Site-specific distances measured in bilayer-bound BM2-TMpeptides suggest that the BM2-TM structure in detergent micelles may not apply to lipid bilayers. For example, the micelle-bound BM2(1–33) structure shows a pore-facing Phe5[15] whereas inter-helical distances in lipid bilayers indicate outward-facing phenylene rings[17]. The distance between Trp23 sidechain 5-19F and His19 Cα in the HxxxW motif is ~1.7 Å shorter in lipid bilayers than in micelles[30] whereas the distance between Gly26 C′ and Trp23 5-19F is ~1.5 Å longer in lipid bilayers than in micelles. These differences suggest that the micelle-bound BM2-TM structure may not reflect the protein structure in lipid bilayers, due to either micelle perturbation of the protein structure[31] or uncertainties in the structure determination.Here we report the determination of the backbone conformation of BM2 in phospholipid bilayers using 2D and 3D correlation solid-state NMR (SSNMR) spectroscopy. We have resolved and assigned the 13C and 15N chemical shifts of most of the TM residues, using a construct that contains the full TM domain and part of the cytoplasmic domain. The assigned chemical shifts yielded (ϕ, ψ) torsion angles of the TM segment in lipid bilayers at neutral pH. We find that BM2-TM adopts relatively uniform α-helical torsion angles that are very similar to the AM2 TM conformation, suggesting that the proton-conduction differences between the two channels mainly result from the amino acid sidechains. Interestingly, the bilayer-bound BM2-TM has very different 15N chemical shifts as well as different helical length from micelle-bound BM2, indicating that the membrane environment exerts a significant influence on the conformation of this proton channel.
Results and Discussion
Biophysical characterization and membrane-dependent conformation of BM2(1–51)
We chose BM2(1–51) (Fig. 1) as the construct for conformational analysis because this domain includes the TM domain required for proton conduction as well as the necessary cytoplasmic segment for membrane targeting of the protein. In virus-infected MDCK cells, a BM2 deletion mutant that lacks residues 24–50 remained in the Golgi bodies, whereas a deletion mutant lacking residues 51–80 migrated to the plasma membrane like full-length BM2[4]. The construct excludes the BM1-interacting domain, which resides between residues 84–108, as shown by chemical shift perturbations[15]. We were not able to cleave the N-terminal solubility tag used for protein expression; however, the tag is disordered and highly mobile, as it exhibits narrow signals in the 13C INEPT spectrum (vide infra), thus it does not interact with the TM helix. To simplify the NMR spectra, Ile residues are not labeled.SDS-PAGE gel analysis (Fig. 2a, Supplementary Fig. S1) shows that purified BM2(1–51) runs as a mixture of monomer, dimer, trimer and tetramer under denaturing conditions. This is consistent with fluorescence resonance energy transfer data and chemical crosslinking data that indicate that BM2 is a tetrameric membrane protein[32,33]. Thus, the solubility tag does not perturb the oligomeric assembly of BM2(1–51). Circular dichroism (CD) spectra of BM2(1–51) in DPC micelles and in POPC:POPG (4:1) bilayers (Fig. 2b) show two minima at 209 nm and 222 nm, characteristic of the α-helical conformation[34]. Spectral deconvolution yielded ~30% α-helix, ~15% β-sheet, ~15% turn, and ~40% disordered structure for DPC-bound protein, whereas in lipid bilayers, the fractions are ~20% α-helix, ~30% β-sheet, ~15% turn, and ~35% disordered structure. The 35–40% disordered structure is consistent with the fact that the solubility tag represents ~40% of the whole construct, and that the helical conformation dominates in the native BM2 sequence. Indeed, CD spectra of BM2(1–51) without a solubility tag, produced by native chemical ligation, have recently been reported and indicate a helical content of ~60% in POPC vesicles[35]. These comparisons indicate that the TM conformation of BM2 is unaffected by the solubility tag.
Figure 2
Purification and biophysical characterization of TEV-BM2(1–51). (a) SDS-PAGE gel of purified BM2, which runs as a mixture of monomers to tetramers under denaturing conditions. The molecular weight of the whole construct is 9.8 kDa. (b) CD spectra of BM2 in 0.5% DPC micelles and POPC: POPG bilayers at pH 7.5. Both spectra exhibit two minima at 209 nm and 222 nm that are characteristic of the α-helical conformation.
Purification and biophysical characterization of TEV-BM2(1–51). (a) SDS-PAGE gel of purified BM2, which runs as a mixture of monomers to tetramers under denaturing conditions. The molecular weight of the whole construct is 9.8 kDa. (b) CD spectra of BM2 in 0.5% DPC micelles and POPC: POPG bilayers at pH 7.5. Both spectra exhibit two minima at 209 nm and 222 nm that are characteristic of the α-helical conformation.To investigate residue-specific conformation of BM2(1–51) in phospholipid bilayers, we first measured 1D 13C and 15N spectra of the protein in DLPE and POPC:POPG (4:1) membranes (Fig. 3). DLPE has been shown to support a well ordered conformation of AM2[36] due to the hydrogen-bonding ability of the phosphatidylethanolamine (PE) headgroup and the saturated nature of the two acyl chains (12:0). As a result, DLPE has a high phase-transition temperature of 29 °C compared to the POPC/POPG transition temperature of −2 °C[37]. Indeed, DLPE-bound BM2(1–51) shows strong protein signals in the 13C CP spectrum at 285 K, whereas the POPC/POPG sample shows weak protein signals at a similar temperature. Decreasing the temperature to 260 K increased the sensitivity of the POPC/POPG sample but also broadened the 13C linewidths. Therefore, the DLPE membrane gives higher sensitivity as well as resolution for the protein spectra. The 13C DP spectra (Fig. 3b), which detect both dynamic and rigid residues, show narrow 13C signals superimposed with broader peaks. These narrow signals are preferentially detected in the 13C INEPT spectra (Fig. 3c) and arise from the solubility tag and residues 34–51 in the native BM2, based on amino-acid type assignment and the absence of these signals in dipolar-based spectra. For example, we detected Ala Cβ, which is present in the solubility tag but not BM2(34–51), and Ile Cδ, which is present in BM2(34–51) but not the solubility tag. We also observed Ser Cβ, Thr Cβ, Arg Cδ, and Lys Cε, which are present in both the tag and BM2(34–51). Finally, 15N CP spectra of the two bilayer samples show similar spectral resolution (Fig. 3d): in addition to the main amide15Npeak, a His sidechain peak at ~170 ppm, Argguanidinium 15N signals at ~85 ppm and ~72 ppm, and a Lys NH3peak at ~33 ppm are observed.
Figure 3
1D 13C and 15N NMR spectra of BM2 in DLPE and POPC: POPG (4:1) bilayers at different temperatures. (a) 13C CP spectra, which selectively detect immobilized residues. (b) 13C DP spectra, which detect all residues’ signals. (c) 13C INEPT spectra, which selectively detect the signals of highly dynamic residues. (d) 15N CP spectra of immobilized residues. Top row shows the DLPE spectra measured at 285 K. Middle row shows the POPC: POPG spectra measured at 290 K. Bottom row shows the 260 K spectra of the POPC: POPG sample. Signals from the N-terminal solubility tag are predominantly seen in the INEPT spectra, whereas the TM signals dominate the CP spectra.
1D 13C and 15NNMR spectra of BM2 in DLPE and POPC: POPG (4:1) bilayers at different temperatures. (a) 13C CP spectra, which selectively detect immobilized residues. (b) 13C DP spectra, which detect all residues’ signals. (c) 13C INEPT spectra, which selectively detect the signals of highly dynamic residues. (d) 15N CP spectra of immobilized residues. Top row shows the DLPE spectra measured at 285 K. Middle row shows the POPC: POPG spectra measured at 290 K. Bottom row shows the 260 K spectra of the POPC: POPG sample. Signals from the N-terminal solubility tag are predominantly seen in the INEPT spectra, whereas the TM signals dominate the CP spectra.Taken together, these 1D spectra indicate that DLPE and POPC/POPG bilayers produce similar conformation of BM2 but different dynamics: the DLPE-bound protein is more immobilized than the POPC/POPG-bound protein due to the higher phase-transition temperature of DLPE bilayers. This is confirmed by 2D 13C-13C correlation spectra of the two samples (Supplementary Fig. S2), which show similar chemical shifts for most resonances, but with additional cross peaks in the DLPE spectrum, which can be assigned to Lys32, Arg33, Val35 and inter-residue correlations in the TM domain. Given the similarity of the chemical shifts in the two membranes, we focused on the DLPE sample for resonance assignment.
13C and 15N chemical shift assignment of bilayer-bound BM2
Figure 4a shows the 2D 13C-13C correlation spectrum of DLPE-bound BM2(1–51) measured with a 13Cspin diffusion mixing time of 55 ms. Most cross peaks in this dipolar-based spectrum show α-helical chemical shifts, except for a few resonances that can be assigned to the extra-membrane region. The 13C linewidths are 0.8–1.1 ppm, which are similar to the linewidths of AM2-TM in the absence of amantadine[38,39]. Only a single set of cross peaks is observed, indicating a single conformation. This differs from AM2-TM, which shows multiple peaks for specific residues such as Ser31 and Gly34, indicating local conformational polymorphism[38,39]. With longer mixing times numerous additional cross peaks are observed (Fig. 4b), which allowed sequential assignment of many residues even without 3D 15N-13C correlation experiments. For example, with 100 ms and 300 ms mixing, aromatic-aliphatic cross peaks are observed for His19, Trp23 and His27 (Fig. 4b). At 300 ms, the aliphatic region of the 2D spectrum (Fig. 5) shows well-resolved sequential cross peaks. For example, the characteristic Thr24 Cα and Cβ peaks show correlations with Trp23, Ala22 and Met21, which are assigned based on their aromatic and Cβ chemical shifts. The well-resolved Ala17 and Ala22 Cβ chemical shifts allowed the assignment of their neighboring residues such as the Ser16-Ala17-Leu18 triplet and the Met21-Ala22-Trp23-Thr24 quartet. The parallel homo-tetrameric assembly of M2 limits intramolecular and intermolecular cross peaks to neighboring residues in the protein sequence. Finally, the resolved chemical shifts of Glu3 Cδ in the carbonyl region and Arg33 Cζ at 157.5 ppm allowed the assignment of these spin systems as well as their neighboring residues such as Pro4 and Phe2.
Figure 4
2D 13C-13C correlation spectra of DLPE-bound BM2. (a) Aliphatic and carbonyl regions of the 2D spectrum measured with 55 ms 13C spin diffusion. The 13C linewidth is 0.8–1.1 ppm. (b) Aliphatic-aromatic regions of the 2D spectra measured with 100 ms (left) and 300 ms (right) 13C spin diffusion. The functionally important H19 and W23 in the HxxxW motif and the C-terminal H27 are assigned.
Figure 5
Aliphatic and carbonyl regions of the 300 ms 2D 13C-13C correlation spectrum, showing inter-residue cross peaks (blue) and long-range intra-residue cross peaks (orange). Resolved peaks such as E3 Cδ were used to assign the other 13C signals of the same residue. Residues such as A17, A22 and T24 show cross peaks to multiple neighboring residues, which validate sequential assignments of the 3D NCACX and NCOCX spectra. The 13C slice at the T24 Cα and Cβ position is shown above the 2D spectrum to illustrate cross peaks to neighboring residues.
2D 13C-13C correlation spectra of DLPE-bound BM2. (a) Aliphatic and carbonyl regions of the 2D spectrum measured with 55 ms 13Cspin diffusion. The 13C linewidth is 0.8–1.1 ppm. (b) Aliphatic-aromatic regions of the 2D spectra measured with 100 ms (left) and 300 ms (right) 13Cspin diffusion. The functionally important H19 and W23 in the HxxxW motif and the C-terminal H27 are assigned.Aliphatic and carbonyl regions of the 300 ms 2D 13C-13C correlation spectrum, showing inter-residue cross peaks (blue) and long-range intra-residue cross peaks (orange). Resolved peaks such as E3 Cδ were used to assign the other 13C signals of the same residue. Residues such as A17, A22 and T24 show cross peaks to multiple neighboring residues, which validate sequential assignments of the 3D NCACX and NCOCX spectra. The 13C slice at the T24 Cα and Cβ position is shown above the 2D spectrum to illustrate cross peaks to neighboring residues.To complete the sequential assignment of all labeled residues in BM2(1–51), we measured 2D and 3D 15N-13C correlation spectra. The 2D NCA, N(CΑ)CX and N(CO)CX correlation spectra show 15N linewidths of 2.1–2.6 ppm (Fig. 6a,b), which are similar to the 15N linewidths of AM2-TM without the drug[38,40,41]. 3D NCACX and NCOCX spectra removed the remaining spectral overlap and allowed the majority of the 13C and 15N signals of the TM residues to be resolved and assigned. A representative 3D strip of peak connectivities from Thr24 to Met21 is shown in Fig. 6c. The three serine residues have overlapping Cα and Cβ chemical shifts but different N and C′ chemical shifts, which allowed them to be assigned by their connectivities to neighboring residues such as Ala17 and Cys11. In total we assigned 29 residues out of 43 labeled residues in the protein (Supplementary Table S1). The unassigned residues are clustered to the segment Asn36 to Arg51, indicating that they are too mobile to be detected in the CP-based 2D and 3D spectra.
Figure 6
2D and 3D 15N-13C correlation spectra of DLPE-bound BM2. (a) 2D NCA correlation spectrum measured using 4 ms SPECIFICCP mixing. The 15N linewidths are 2.1–2.6 ppm. (b) 2D 15N-(13CA)-13CX spectrum measured using 1.4 ms TEDOR mixing and 110 ms 13C-13C CORD mixing, and 2D 15N-(13CO)-13CX spectrum measured using 4 ms SPECIFICCP contact and 150 ms 13C-13C DARR mixing. Complete resonance assignment is shown for the N(CΑ)CX. Several peaks overlapped in the 2D spectrum are resolved in the 3D NCACX spectrum. (c) Representative strips from the 3D NCACX (red) and NCOCX (black) spectra, showing sequential assignment of residues T24-F20.
2D and 3D 15N-13C correlation spectra of DLPE-bound BM2. (a) 2D NCA correlation spectrum measured using 4 ms SPECIFICCP mixing. The 15N linewidths are 2.1–2.6 ppm. (b) 2D 15N-(13CA)-13CX spectrum measured using 1.4 ms TEDOR mixing and 110 ms 13C-13C CORD mixing, and 2D 15N-(13CO)-13CX spectrum measured using 4 ms SPECIFICCP contact and 150 ms 13C-13C DARR mixing. Complete resonance assignment is shown for the N(CΑ)CX. Several peaks overlapped in the 2D spectrum are resolved in the 3D NCACX spectrum. (c) Representative strips from the 3D NCACX (red) and NCOCX (black) spectra, showing sequential assignment of residues T24-F20.
Backbone conformation of BM2-TM in lipid bilayers versus detergent micelles
The assigned 13C and 15N chemical shifts are a direct reporter of the backbone (φ, ψ) torsion angles. We computed the secondary chemical shifts of Cα, Cβ, and C′ and N of all assigned residues using the TALOS-N software to define the TM α-helix boundary. Positive secondary shifts for Cα and C′ and negative shifts for Cβ and N indicate α-helical conformation whereas negative Cα and C′ secondary shifts and positive Cβ and N secondary shifts indicate β-sheet conformation[42,43]. Values near zero indicate random coils. Note that Ile residues are not labeled in the protein.Figure 7 shows strongly positive secondary shifts for Cα and C′ and negative secondary shifts for Cβ and N for residues 6–28, thus defining the core of the TM helix. Except for Cys11 and His27, which have small Cα secondary shifts of 0.3 and 0.5 ppm, all other Cα secondary shifts are larger than 2 ppm, with the largest secondary shift observed for Thr24 (5.5 ppm). In comparison, segments Met1-Phe5 and Asn29-Val35 show random coil or β-sheet secondary shifts in the DLPE bilayer. Therefore, the helical core of BM2-TM in lipid bilayers spans residues 6–28, while the other residues are either disordered or adopt minor β-sheet conformations. Although DLPE bilayers are ~4 Å thinner than POPC bilayers[44,45], the membrane thickness generally has little effect on the helix length but mainly influences the helix orientation through hydrophobic matching[46-48], thus we expect the helical conformation to be unchanged in POPC: POPG bilayers. ThisBM2 TM helix length is in good agreement with cysteine scanning mutagenesis data of full-length BM2 in oocytes[10], which indicated an α-helix from residues L8 to H27 with a repeat of 3.4 ± 0.1 residues per turn. In comparison, the BM2-TM helix length in DHPC micelles is noticeably longer, extending from Glu3 to Ile31[15]. Moreover, the 15N chemical shifts of micelle-bound BM2[15] differ significantly from the 15N chemical shifts of bilayer-bound BM2: half of the TM residues (e.g. S9, S12, F20 and T24) exhibit 15N chemical shift differences larger than 1 ppm and residues near the two ends of the TM domain (e.g. Q6 and H27) have even larger 15N shift differences of 3.0–4.6 ppm (Fig. 8c, Supplementary Table S2). The root-mean-square deviation of the 15N chemical shifts is 2.05 ppm. These large 15N chemical shift differences could be due to differences in backbone conformation, amidehydrogen bonding, or a combination thereof. The increased 15N chemical shift differences at the ends of the TM domain, coupled with the random coil or β-sheet 13C chemical shifts of residues 1–5 and 32–33, indicate a significantly different backbone conformation for these residues compared to the extended α-helix seen in micelle-bound BM2. The 13C chemical shifts of micelle-bound BM2 are not available in databases to allow further comparison with the bilayer values[15]; but the significant 15N chemical shift differences already indicate that BM2-TM has a different backbone conformation and perhaps backbone hydrogen bonding in lipid bilayers than in micelles.
Figure 7
Secondary shifts of DLPE-bilayer bound BM2 for (a) Cα, (b) Cβ, (c) C′ and (d) N, calculated using TALOS-N. Positive values for Cα and C′ and negative values for Cβ and N indicate α-helical conformation, whereas the opposite indicates β-sheet conformation. Grey shaded bars at zero secondary shifts indicate the positions of unlabeled Ile residues. The secondary shifts indicate an α-helix between residues 6 and 28. Residues 1–5 and 29–35 are disordered whereas residues 35–51 are not visible in dipolar-based spectra, indicating they are dynamic.
Figure 8
(ϕ, ψ) Torsion angles of BM2. (a) TALOS-N predicted (φ, ψ) angles (red) of BM2 in lipid bilayers, where error bars indicate the precision of the prediction. These are overlaid with the torsion angles of the solution structure of DHPC-bound BM2 (black)[15] and with the torsion angles of the crystal structure of AM2-TM in lipid cubic phase (blue)[22]. All three structures were measured at high pH, corresponding to the closed state of the channel. (b) Ramachandran diagram of BM2-TM and AM2-TM. (c) 15N chemical shift differences between bilayer-bound BM2 and micelle-bound BM2. About half of the residues show chemical shift differences of >1 ppm.
Secondary shifts of DLPE-bilayer bound BM2 for (a) Cα, (b) Cβ, (c) C′ and (d) N, calculated using TALOS-N. Positive values for Cα and C′ and negative values for Cβ and N indicate α-helical conformation, whereas the opposite indicates β-sheet conformation. Grey shaded bars at zero secondary shifts indicate the positions of unlabeled Ile residues. The secondary shifts indicate an α-helix between residues 6 and 28. Residues 1–5 and 29–35 are disordered whereas residues 35–51 are not visible in dipolar-based spectra, indicating they are dynamic.(ϕ, ψ) Torsion angles of BM2. (a) TALOS-N predicted (φ, ψ) angles (red) of BM2 in lipid bilayers, where error bars indicate the precision of the prediction. These are overlaid with the torsion angles of the solution structure of DHPC-bound BM2 (black)[15] and with the torsion angles of the crystal structure of AM2-TM in lipid cubic phase (blue)[22]. All three structures were measured at high pH, corresponding to the closed state of the channel. (b) Ramachandran diagram of BM2-TM and AM2-TM. (c) 15N chemical shift differences between bilayer-bound BM2 and micelle-bound BM2. About half of the residues show chemical shift differences of >1 ppm.We used TALOS-N to predict the (ϕ, ψ) torsion angles of residues 4–27 and 32–33 from the measured chemical shifts (Supplementary Table S3, Fig. 8a). The φ angles range from −58.4° to −70.7°, with an average of −65.9 and a standard deviation of 2.5° for the distribution. The ψ angles range from −32.0° to −44.1°, with an average of −37.0 and a similarly small standard deviation of 2.6° for the distribution. These (ϕ, ψ) angles are in good agreement with the ideal α-helical torsion angles of (−65°, −40°). The precisions of the TALOS-N predictions, defined as one standard deviation for the (φ, ψ) angles among the best-matched peptides for each residue, are shown as error bars in Fig. 8a, and average 6.1° for φ and 6.5° for ψ for all residues. The accuracy of the predictions, defined as the RMSD from the crystallographic torsion angles, is ~12°. Although the uncertainty of TALOS-N precludes a high-resolution definition of the helix conformation without additional distance restraints, these chemical-shift derived (ϕ, ψ) angles in bilayers are in good agreement with the latest 1.1 Å crystal structure of AM2-TM[22], whose (ϕ, ψ) angles are (−62.3 ± 6.1°, −43.8 ± 5.3°). In comparison, the reported BM2-TM structure in DHPC micelles has significantly larger (ϕ, ψ) variations of 8–11°, with values of (−64.8 ± 10.6°, −43.2 ± 8.3°) (Fig. 8b). The (ϕ, ψ) angles of BM2-TM domain in micelles and bilayers are shown in Fig. 9(a,b), where the reported micelle-bound structure has a coiled coil shape.
Figure 9
Comparison of the backbone conformations of the BM2 TM helix in (a) DHPC micelles (PDB code: 2KIX, grey) and (b) DLPE lipid bilayers (red). The latter is a conformational model using chemical-shift derived (ϕ, ψ) torsion angles. (c) HN secondary chemical shifts of GCN4 coiled coil. A periodicity of 3.5 residue/turn is observed. Residues at inward-facing a and d positions (dashed lines) show positive secondary shifts of about +0.5 ppm whereas those at outward-facing positions show negative secondary shifts of about −0.5 ppm. Best-fit oscillations are shown in red and the differences between fit and experimental values are shown in green. (d) HN secondary chemical shifts of micelle-bound BM2. No periodicity of HN secondary shift is present, and pore-facing Ser9, Ser12, and Ser16 (dashed lines) show negative secondary shifts, both contradicting a coiled coil structure. A best fit using 3.53 residues/turn gave a small amplitude and an RMSD of 0.28 ppm between the fit and the experimental chemical shifts. When a larger amplitude is used for the sinusoidal fit, the RMSD does not improve. Therefore, the reported coiled coil structure for micelle-bound BM2 is inconsistent with the HN chemical shifts.
Comparison of the backbone conformations of the BM2 TM helix in (a) DHPC micelles (PDB code: 2KIX, grey) and (b) DLPElipid bilayers (red). The latter is a conformational model using chemical-shift derived (ϕ, ψ) torsion angles. (c) HN secondary chemical shifts of GCN4 coiled coil. A periodicity of 3.5 residue/turn is observed. Residues at inward-facing a and d positions (dashed lines) show positive secondary shifts of about +0.5 ppm whereas those at outward-facing positions show negative secondary shifts of about −0.5 ppm. Best-fit oscillations are shown in red and the differences between fit and experimental values are shown in green. (d) HN secondary chemical shifts of micelle-bound BM2. No periodicity of HN secondary shift is present, and pore-facing Ser9, Ser12, and Ser16 (dashed lines) show negative secondary shifts, both contradicting a coiled coil structure. A best fit using 3.53 residues/turn gave a small amplitude and an RMSD of 0.28 ppm between the fit and the experimental chemical shifts. When a larger amplitude is used for the sinusoidal fit, the RMSD does not improve. Therefore, the reported coiled coil structure for micelle-bound BM2 is inconsistent with the HN chemical shifts.Large torsion-angle variations in a helix can result from a coiled coil or a generally distorted helix. Many high-resolution coiled coil structures are known. For example, the 1.8 Å-resolution structure of the trimeric GCN4 leucine zipper exhibits backbone torsion angles of (ϕ = −64.5 ± 7.2°, ψ = −39.9 ± 8.8°)[49-51]. The fusion peptide of gp41 (residues 282–304)[52] in DHPC micelles, constrained by residual N-H dipolar couplings, exhibits torsion angles of (ϕ = −55 ± 11°, ψ = −43 ± 12°). The coiled coil domain of the mitochondrial division protein 1 has torsion angles of (ϕ = −64.1 ± 12.5°, ψ = −40.0 ± 13.9°)[53]. These significant torsion angle variations (~10°) reflect the systematic shortening of main-chain hydrogen bonds on the inward-facing (‘concave’) side of the coiled coil compared to the outward-facing (‘convex’) side.The most direct NMR structural parameter to distinguish coiled coils from straight helices are residual dipolar couplings, because helix curvature is directly reflected by N-H bond orientations. This approach was demonstrated for the gp41 fusion peptide[52], which forms a curved helix in DHPC micelles but a straight helix in lipid bicelles. Compared to residual dipolar couplings, intramolecular distance restraints are relatively insensitive to helix curvature, whereas intermolecular distance restraints can capture helix curvature, since the two ends of a helix should be adjacent to different faces of the second helix. Compared to these orientational restraints and intermolecular distance restraints, 13C and 15N chemical shifts in general cannot distinguish a straight helix from a coiled coil. In contrast, amide proton (HN) chemical shifts are a direct reporter of coiled coils: the concave side of the curved helix have downfield shifted HN chemical shifts compared to the more weakly hydrogen-bonded amides on the convex side[54-56]. This trend is exemplified by the canonical GCN4, which shows periodic HN secondary chemical shifts[57,58] with a periodicity of 3.53 residues/turn (Fig. 9c). Residues at inward-facing a and d positions of the heptad repeat have positive HN secondary shifts of about +0.5 ppm whereas residues at outward-facing c and f positions show negative secondary shifts of about −0.5 ppm. A secondary shift of 0.5 ppm corresponds to a difference in hydrogen-bond length (RN…O) of ~0.2 Å[59], which is consistent with the variation in RN…O in the GCN4 crystal structure[51]. These periodic HN secondary shifts are also seen in other coiled coil proteins such as the antiparallel bovineIF1[60] and the parallel myosin-binding subunit[61].In summary, a coiled coil helix should manifest periodic HN secondary chemical shifts, and accurate determination of coiled coil structures by NMR requires orientational restraints, followed by intermolecular distance restraints. However, the micelle-bound BM2-TM does not show any periodic HN secondary shifts[15] (Fig. 9d), and the pore-facing Ser9, Ser12, and Ser16 have negative HN secondary shifts, both contradicting the coiled coil structure. The structure was also not restrained by any residual dipolar couplings but only by NOEs; moreover the 11 NOEs that were attributed to be intermolecular did not result from mixed labeled samples but by their exclusion from intramolecular contacts.Given that the amide proton secondary shifts of micelle-bound BM2 are inconsistent with a coiled coil, the non-ideality of the BM2-TM helix in micelles, if true, would likely be caused by the micelle environment. The BM2-TM domain may curve itself to fit within the 35–38 Å diameter of the DHPC micelle[62,63], similar to a number of α-helical membrane proteins whose structures have been solved and compared between micelles and better bilayer mimics. For example, the HIV-1 gp41 fusion peptide (residues 282–304) is coiled in DHPC micelles but straight in DMPC: DHPC bicelles[52]. The TM helices of diacylglycerol kinase (DgkA) have an outward curvature in DPC micelles[64] but are straight in phospholipid bilayers[31,65] and lipid cubic phases[66]. DgkA is also 600 times less active in DPC micelles than in LMPC micelles[67], implicating that structural distortion by micelles adversely impacts function. The TM helix of the Mycobacterium tuberculosis protein Rv1761c shows a ~120° kink in DPC micelles[68], which is absent in lipid bilayers[31]. These examples suggest that micelles have a significant propensity to distort membrane protein structures from those in lipid bilayers.Determination of the three-dimensional structure of the tetrameric BM2-TM assembly in lipid bilayers to high resolution requires intramolecular and intermolecular distance restraints and orientational restraints. Experiments along these lines are currently in progress. An accurate backbone conformation of BM2-TM in lipid bilayers will impact our understanding of the mechanism of proton conduction, since the positions of sidechains relative to the channel pore must be known correctly. For example, Phe5, which lies at the periphery of the α-helical core of bilayer-bound BM2, has a nearest-neighbor inter-helical distance of 11 Å between the para-hydrogen atoms in lipid bilayers[18], which is much longer than the ~5 Å distance reported in the micelle-bound BM2 structure. This large opening indicates an outward-facing phenylene ring conformation, which rules out pore obstruction as the cause for the lack of drug binding to BM2, but points to the polar nature of the BM2 pore as the cause. Similarly, 13C-19F distance measurements in lipid bilayers found that the Gly26 C′ distance to 5-19F-Trp23 is much longer than the 6.8 Å distance reported in the solution structure[30]. A straight helix in lipid bilayers would increase the distance ~8.0 Å for the same t-105° rotamer of Trp23, which would be consistent with the REDOR data.
Conclusions
These SSNMR data indicate that the BM2-TM domain adopts a well-ordered α-helical conformation in lipid bilayers. Residues 6–28 form the helical core, whereas residues 1–5 and 29–35 are unstructured. Based on the assigned 13C and 15N chemical shifts, the average (φ, ψ) torsion angles of the TM residues are (−65.9°, −37.0°). This backbone conformation is similar to the conformation of AM2-TM, despite only 24% sequence identity. BM2 exhibits a single set of chemical shifts and hence a single TM conformation at high pH. This differs from AM2-TM, which shows local conformational polymorphism at several residues. Large 15N chemical shift differences indicate that the α-helical conformation of BM2 in lipid bilayers differs from the micelle-bound conformation. Moreover, the HN secondary shifts of micelle-bound BM2 lack the periodic trend expected for coiled coils, thus disputing the coiled-coil structure in micelles. The bilayer-bound BM2-TM conformation, combined with previously measured distance restraints, indicates that the lack of amantadine binding to BM2 is not due to different three-dimensional structures of the tetrameric channel but is most likely due to the polar nature of the channel pore. Future determination of the complete three-dimensional structure of BM2-TM in lipid bilayers will further elucidate the mechanistic underpinnings for the functional differences between AM2 and BM2 channels, as well as facilitating drug design to inhibit the influenza B virus.
Methods
Construction of the recombinant BM2(1–51) protein
The plasmid encoding BM2(1–51) of Influenza B/Maryland/ 1/2001 (MFEPFQIL-SICSFILSALHFMAWTIGHLNQIKRGVNMKIRIKGPNKETINR) was obtained from Integrated DNA Technologies. The gene includes a His6 segment and a TEV protease cleavage site (HHHHHHSSGVDLGTENLYFQSNA) before the native BM2(1–51) sequence. The gene was PCR amplified and cloned into a pET21a plasmid[40] between an N-terminal BamHI restriction site that follow a T7 epitope and a C-terminal EcoRI restriction site. The expression construct thus contains 88 residues, including 37 residues from the T7-His6-TEV tag and 51 residues for BM2. The plasmid was transformed into E. coliBL21 (DE3) cells for expression, and the DNA sequence of the construct was verified by Sanger sequencing.
Expression and purification of 13C, 15N-labeled BM2(1–51)
The BM2 construct was uniformly 13C, 15N labeled for all residues except for Ile. Thus, 43 out of the 51 native BM2 residues are 13C and 15N-labeled. A glycerol cell swab stored at −70 °C was used to streak an LB-Amp plate and colonies were allowed to grow overnight at 37 °C. A single colony was selected to start a 10 mL LB culture containing 100 μg/mL ampicillin the next night. This starter culture was used to inoculate 1 L of LB media containing 100 μg/mL ampicillin. Cells were grown at 37 °C until an OD600 of 0.6–0.8 and harvested by centrifugation for 10 minutes at 20 °C and 7,000 rpm. These LB cells were resuspended in 0.5 L of M9 minimal media (pH 7.8, 48 mM Na2HPO4, 22 mM KH2PO4, 8.6 mM NaCl, 4 mM MgSO4, 0.2 mM CaCl2, 1 mg ampicillin) containing 1 g/L 15N-NH4Cl, 2 g/L U-13C glucose, and 100 mg/L unlabeled Ile for isotopic labeling of BM2. The cells were incubated in M9 media for 30 minutes at 37 °C, then protein expression was induced by addition of 0.4 mM isopropyl β-D-1-thiogalactopyranoside (IPTG). Protein expression proceeded for 5–6 hours, reaching a typical OD600 of ~1.1, then cells were spun down at 4 °C and 5000 rpm for 10 min, resuspended in 20 mL lysis buffer (pH 8.0, 50 mM Tris-HCl, 50 mM NaCl), and stored overnight at −70 °C.For BM2 purification, cells were thawed at 37 °C and lysed at 4 °C by sonication (5 seconds on and 5 seconds off) for 1 hour. The soluble fraction of the cell lysate was decanted after centrifugation at 10,000 × g for an hour at 4 °C. The insoluble inclusion bodies containing BM2 were resuspended in 15 mL lysis buffer containing 4 M urea and 0.2% (w/w) sodium dodecylsulfate (SDS) and shaken for 2 hr at 4 °C to solubilize the protein. The remaining inclusion bodies and cell debris were spun down by centrifugation for 1 hr at 10,000 × g at 4 °C. The supernatant was filtered through a 0.22 μm filter and loaded onto a gravity-flow chromatography column with ~5 mL nickel affinity resin (Profinity IMAC, BioRad). The solution was bound to the resin overnight by gentle shaking at 4 °C. 100 mL of wash buffer (pH 8.0, 50 mM Tris-HCl, 100 mM NaCl, 4 M urea and 0.1% (w/w) SDS) was used to wash the column, then BM2 was collected with 50 mL elution buffer (pH 8.0, 50 mM Tris-HCl, 50 mM NaCl 0.2 M imidazole, 0.05% (w/w) SDS). The crude protein concentration was determined by the 280 nm absorbance using a molar extinction coefficient of 6970 M−1 cm−1. The typical crude protein yield was 40–50 mg per liter of M9 media.The eluted protein (~20 mL) was concentrated to ~5 mL using a 3 kDa Amicon filter at 4500 × g and 4 °C. To remove SDS and imidazole, we dialyzed BM2(1–51) against 1 L of Milli-Q water at room temperature using 3.5 kDa dialysis tubing (Spectrum Labs) for 4–5 days with 2 water changes per day. The protein precipitated after ~2 days, indicating loss of detergent over time. Subsequently, we used reversed-phase HLPC to further purify the protein, because the N-terminal tag could not be cleaved from BM2(1–51) using TEV protease. We attempted to solubilize the protein in a variety of detergents including DPC, OG, CHAPS, Triton X-100, DDM, LDAO, SDS and DHPC, and with various additives including urea, glycerol, and EDTA. However, we did not find a condition under which both the protein was soluble and the TEV cleavage was effective. Preparative reversed-phase HPLC was carried out on a Varian ProStar 210 System using a Vydac C18 column (10 μm particle size, 22 mm × 250 mm). The protein was dissolved in 30%:70% (v/v) acetonitrile: water containing 0.1% (v/v) trifluoroacetic acid (TFA) and eluted with a linear gradient of 35–99% acetonitrile over 70 minutes at a flow rate of 10 mL/min. The mass (9800.21 Da for unlabeled protein) and purity (>95%) of the protein was verified using MALDI mass spectrometry. The purified protein was lyophilized and stored at −30 °C.
Preparation of proteoliposome samples
Two proteoliposome samples are used in this study. Most experiments used 1,2-dilauroyl-sn-glycero-3-phosphoethanolamine (DLPE) to reconstitute the protein. About 15 mg protein was dissolved in 1.5 mL trifluoroethanol (TFE) and mixed with 15 mg DLPE in 750 μL 90%: 10% (v/v) chloroform: methanol. The organic solvents were removed under a stream of nitrogen gas, and the film was further dried under vacuum at room temperature overnight. The film was resuspended in 4 mL of pH 7.5 buffer (20 mM Tris-HCl, 2 mM ethylenediaminetetraacetic acid (EDTA) and 0.2 mM NaN3) by vortexing and sonicating 2–3 times for 2 min each until a homogeneous suspension was obtained. The sample was then freeze-thawed 7 times between a 39 °C water bath and liquid nitrogen. The proteoliposome sample was centrifuged for 3 hr at 40,000 rpm and 4 °C to obtain a homogeneous membrane pellet. The pellet was allowed to dry overnight in a desiccator to a final hydration level of ~40% by mass and then packed into a 3.2 mm thin-wall rotor for solid-state NMR experiments. To investigate if the protein chemical shifts are sensitive to the membrane environment, we also prepared a second membrane sample, which consisted of 3.2 mg BM2(1–51) mixed with 4.8 mg of 4:1 (w/w) 1-palmitoyl-2-oleoyl-glycero-3-phosphocholine (POPC):1-palmitoyl-2-oleoyl-sn-glycero-3-phospho-(1′-rac-glycerol) (POPG). The sample was prepared in an identical manner, except that the volume of the organic solvent was reduced to keep the protein and lipid concentrations at 10 mg/mL and 20 mg/mL, respectively.
Circular dichroism (CD) experiments
CD spectra were measured at room temperature on an AVIV 202 spectrophotometer using a 1 mm path-length quartz cuvette. Three scans were co-added for each spectrum. For the micelle sample, the protein was dissolved in an n-dodecylphosphocholine (DPC) buffer (pH 7.5, 10 mM NaHPO4, 0.5% w/w DPC) at a protein concentration of 0.15 mg/mL (15 μM). The protein-free buffer spectrum was subtracted from the protein-containing spectrum. For the bilayer sample, POPC:POPG vesicles were dissolved in 3 mL of CD buffer (pH 7.5, 10 mM NaHPO4, 1.5 mg/mL total lipids) and the protein concentration was 1.0 mg/mL. This proteoliposome was freeze-thawed 7 times and bath-sonicated for ~1 hour to increase optical transparency. The solution was diluted to 0.2 mg/mL (20 μM) protein before the measurement. A protein-free control sample was prepared identically, and its spectrum was subtracted from the spectrum of the protein-containing sample. The CD spectral intensities are reported as ellipticity in units of millidegrees. Deconvolution was conducted using the BestSel web server[69]. The spectral deconvolution result is highly sensitive to the protein concentration. To account for potential inaccuracies in the protein concentration determination, we allowed fitting of the spectral amplitude factor in BestSel. This yielded more accurate fits such that the final fitted CD spectra were indistinguishable from the experimental data. The final amplitude factors used were 1 for the DPC micelle data and 2 for the POPC:POPG vesicle data.
Solid-state NMR experiments and data analysis
All solid-state NMR spectra of the BM2/DLPE sample were measured on Bruker Avance II 800 MHz (18.8 T) and 900 MHz (21.1 T) NMR spectrometers using 3.2 mm HCN probes. Magic-angle-spinning (MAS) frequencies were 14 kHz for the 800 MHz experiments and 15.75 kHz for the 900 MHz experiments. Typical radiofrequency (RF) field strengths were 50–71 kHz for 1H, 50 kHz for 13C, and 33–42 kHz for 15N. Reported sample temperatures are direct readings from the probe thermocouple, while the actual sample temperatures are estimated to be 10–15 K higher at the MAS frequencies used. One- and two-dimensional NMR spectra of the POPC: POPG sample were measured on a Bruker Avance III HD 600 MHz (14.1 T) spectrometer using a 1.9 mm MAS probe. The sample was spun at 12 kHz and the sample temperature was either 260 K or 290 K. The RF field strengths were 63–83 kHz for 1H, 63 kHz for 13C, and 42 kHz for 15N. Typical recycle delays for all experiments were 1.5–3.0 s.13C chemical shifts were referenced externally to the adamantane CH2 chemical shift at 38.48 ppm on the tetramethylsilane scale and 15N chemical shifts were referenced to the 15Npeak of N-acetylvaline at 122.00 ppm on the liquid ammonia scale. All spectra were processed using the Bruker TopSpin package and chemical shift assignment was conducted in Sparky[70]. (ϕ, ψ) torsion angles were calculated using the TALOS-N software package[71] after 13C chemical shifts were converted to the DSS scale by adding 2.00 ppm[72].1D 13C and 15N cross polarization (CP), direct polarization (DP) and refocused Insensitive Nuclei Enhanced by Polarization Transfer (INEPT) spectra were measured using recycle delays of 1.5–2 s, 3–5 s, and 2 s, respectively. Acquisition times were 14–18 ms for CP, 25 ms for DP, and 30–37 ms for INEPT. The INEPT delays were chosen to be 1.6 ms and 1.1 ms to keep all 13C signals positive. 2D 13C-13C correlation experiments were conducted using COmbined -Driven (CORD) mixing for 13C-13Cspin diffusion[73]. The 2D 13C-13C correlation spectrum of the POPC: POPG sample was measured using 52 ms CORD at 260 K under 12 kHz MAS on the 600 MHz spectrometer. 2D 15N-13C and 3D 15N-13C-13C correlation spectra for sequential resonance assignment were measured using the out-and-back Transferred-Echo Double Resonance (TEDOR) pulse sequence[74] and the SPECtrally Induced Filtering In Combination with Cross Polarization (SPECIFIC-CP[75]) sequence for 15N-13C polarization transfer[76]. Detailed experimental conditions for the 2D and 3D spectra of the DLPE-bound BM2 sample are given in Supplementary Table S4.Secondary shifts for amide protons were calculated using published random coil chemical shifts[58], but very similar results were also observed using TALOS-N. The periodicity of HN secondary chemical shifts in coiled coils were fit using , where O is the vertical offset, A is the amplitude, x is the residue number, h is the number of residues per turn, and p is the phase of the sinusoidal wave. For GCN4, bovineIF1 and myosin-binding subunit, all four parameters were fit and similar results of O = −0.09–0.07 ppm, A = 0.29–0.55 ppm, h = 3.45–3.53 residues/turn were obtained, while p matched the phase expected from the structures. For BM2, h and p did not fit to ~3.5 residues/turn and the expected phase, so we manually restricted them and only fit A and O. 15N secondary shifts were not periodic in GCN4 (data not shown).Supporting Information
Authors: Maurits R R de Planque; Jan-Willem P Boots; Dirk T S Rijkers; Rob M J Liskamp; Denise V Greathouse; J Antoinette Killian Journal: Biochemistry Date: 2002-07-02 Impact factor: 3.162
Authors: D J Gordon-Smith; R J Carbajo; J C Yang; H Videler; M J Runswick; J E Walker; D Neuhaus Journal: J Mol Biol Date: 2001-04-27 Impact factor: 5.469
Authors: Yanke Chen; Zhengfeng Zhang; Xinqi Tang; Jianping Li; Clemens Glaubitz; Jun Yang Journal: Angew Chem Int Ed Engl Date: 2014-04-02 Impact factor: 15.336
Authors: Julia Koehler; Endah S Sulistijo; Masayoshi Sakakura; Hak Jun Kim; Charles D Ellis; Charles R Sanders Journal: Biochemistry Date: 2010-08-24 Impact factor: 3.162
Authors: Dianfan Li; Joseph A Lyons; Valerie E Pye; Lutz Vogeley; David Aragão; Colin P Kenyon; Syed T A Shah; Christine Doherty; Margaret Aherne; Martin Caffrey Journal: Nature Date: 2013-05-15 Impact factor: 49.962
Authors: João Medeiros-Silva; Noah H Somberg; Harrison K Wang; Matthew J McKay; Venkata S Mandala; Aurelio J Dregni; Mei Hong Journal: J Am Chem Soc Date: 2022-04-05 Impact factor: 16.383
Authors: Venkata S Mandala; Alexander R Loftis; Alexander A Shcherbakov; Bradley L Pentelute; Mei Hong Journal: Nat Struct Mol Biol Date: 2020-02-03 Impact factor: 15.369