Literature DB >> 29450146

Novel proteins from proteomic analysis of the trunk disease fungus Lasiodiplodia theobromae (Botryosphaeriaceae).

Carla C Uranga1, Majid Ghassemian2, Rufina Hernández-Martínez1.   

Abstract

Many basic science questions remain regarding protein functions in the pathogen: host interaction, especially in the trunk disease fungi family, the Botryosphaeriaceae, which are a global problem for economically important plants, especially fruiting trees. Proteomics is a highly useful technology for studying protein expression and for discovering novel proteins in unsequenced and poorly annotated organisms. Current fungal proteomics approaches involve 2D n class="Chemical">SDS-PAGE and extensive, complex, protein extraction methodologies. In this work, a modified Folch extraction was applied to protein extraction to perform both de novo peptide sequencing and peptide fragmentation analysis/protein identification of the plant and human fungal pathogen Lasiodiplodia theobromae. Both bioinformatics approaches yielded novel peptide sequences from proteins produced by L. theobromae in the presence of exogenous triglycerides and glucose. These proteins and the functions they may possess could be targeted for further functional characterization and validation efforts, due to their potential uses in biotechnology and as new paradigms for understanding fungal biochemistry, such as the finding of allergenic enolases, as well as various novel proteases, including zinc metalloproteinases homologous to those found in snake venom. This work contributes to genomic annotation efforts, which, hand in hand with genomic sequencing, will help improve fungal bioinformatics databases for future studies of Botryosphaeriaceae. All data, including raw data, are available via the ProteomeXchange data repository with identifier PXD005283. This is the first study of its kind in Botryosphaeriaceae.

Entities:  

Keywords:  Bioinformatics; Gene ontology; Peptide fragmentation analysis; Trunk-disease fungi; de novo peptide sequencing

Year:  2017        PMID: 29450146      PMCID: PMC5802045          DOI: 10.1016/j.biopen.2017.03.001

Source DB:  PubMed          Journal:  Biochim Open        ISSN: 2214-0085


Introduction

Current work in fungal proteomics and bioinformatics of phytopathogenic filamentous fungi is in a very early stage. There are an estimated 1.5–5 million species of fungi thought to exist on earth [1], and most of them remain unsequenced and uncharacterized. Apart from the importance of efforts to understand fungal pathogenicity and pathogen: host-specific interactions, fungi are excellent model organisms for gaining insight into the evolution of biochemical routes and their conservation across kingdoms and taxa [2]. Proteome analysis is a valuable technique for studying protein expression of organisms in different biological and experimental contexts [3], as well as for finding and annotating novel or unknown genome sequences [4]. Proteins are the final product of gene expression, and essentially the catalytic and metabolic force of an organism. Because of this and the many possible post-translational modifications of proteins [5], [6], proteomics is an essential aspect of systematic gene expression studies for novel gene discovery. Peptide sequencing and protein identification allows for the identification of biomarkers in pathological processes that may serve as indicators for disease and as targets for new treatments [7]. In the absence of genomic sequences for the organism of interest, proteomics is useful for designing biochemical characterization experiments via protein homology searches, which provide clues to enzymatic processes in uncharacterized proteins that may then be verified experimentally [3]. Protein characterization efforts are critical for improving bioinformatics databases available to the scientific community. Many programs exist to analyze peptides from a sample [8] as well as for reverse-translating protein identifications to then search genome sequences for homology, a valid approach for gene annotation and biochemical characterization efforts [9]. One example of an important family of mostly unsequenced fungi is the Botryosphaeriaceae. These are fungi that have been found to affect economically important woody plants around the world [10]. Several members of this family belong to “trunk disease fungi”, because they are able to invade and kill fruiting trees [11], [12]. Emblematic symptoms from Botryosphaeriaceae consist of n class="Disease">necrotic cankers in the trunks of the infected trees, reduced stature, and fruit rot [13]. A member of this family, Lasiodiplodia theobromae (teleomorph Botryosphaeria rhodina) has been found to be the most virulent species among those reported in grapevine [14]. L. theobromae is able to colonize a broad range of plant species, including important plants such as the rubber tree, (Hevea brasiliensis) [15], and the biofuel-producing plant Jatropha curcas [16]. Intriguingly, L. theobromae is also able to invade and colonize humans, and has been reported to cause corneal ulcers, keratitis, onychomycosis, pneumonia in a transplant patient [17], and skin lesions [18]. Only partial sequences are available in the NCBI database, mostly consisting of ITS regions used for species identification purposes. Proteome studies from Botryosphaeriaceae (the proteome from Diplodia seriata is the only Botryosphaeriaceae studied to date reported in the liten class="Species">rature) have involved the use of 1D and 2D SDS-PAGE [19] followed by mass spectrometry; laborious and technically difficult techniques that yield limited protein identification data [20]. Additionally, fungal proteins are notoriously difficult to extract, because fungal cell walls contain chitin, and, in the case of L. theobromae, extensive pigmentation (melanin) that interferes with the protein extraction [21]. Currently, protein extraction methods in fungi involve the use of painstaking, multi-step protein precipitation protocols requiring controlled precipitating reagents like trichloroacetic acid (TCA), or detergent extractions to precipitate proteins from aqueous suspensions, that result in protein and information loss [22]. In this work, lyophilized material was extracted directly using a modified Folch extraction, a method conventionally used to extract lipids from biological material [23]. Previous metabolomic studies of this fungus showed that when cultivated in exogenous triglycerides, a variety of fatty acid esters were produced [24], however, little is known about the proteins expressed by this fungus in this context. L. theobromae is a wound pathogen and is a problem in many vineyards especially because of grafting practices [25], [26], [27]. Lipids being one of the exposed substrates, the objective of this work was to evaluate the proteome of L. theobromae in the presence of exogenous triglycerides, employing a multi-algorithm approach using database-dependent in silico fragmentation analysis in which a variety of databases were used. De novo peptide sequencing was also applied for comparison and for potential novel protein discovery.

Materials and methods

Fungal strains and incubation conditions

L. theobromae UCD256Ma (isolated in Madera County, California, USA) was provided by Dr. Douglas Gubler from the University of California at Davis [13]. The fungus isolate was incubated in triplicate in 50 mL Vogel's salts supplemented with 5% n class="Chemical">glucose and 5% grapeseed oil. All biological replicates were incubated for 20 days at 25 °C in the dark and then lyophilized. A modified Folch extraction consisted in the addition of 75 mL dichloromethane (DCM), 75 mL methanol and 0.01% of the antioxidant butylated hydroxytoluene (BHT) to the lyophilized material in each replicate and allowed to extract overnight at 4 °C. The solvents were removed from the solid material. For mass spectrometry-based peptide fragmentation analysis, a 0.5 g portion of the solid material from each replicate was used to create a pool.

Mass spectrometry methodology

The pooled samples were submitted to the University of California, San Diego proteomics mass spectrometry department to be processed according to standard procedure. Briefly, 0.5 g of the solids from the 50 mL fungal incubations (L. theobromae incubated in 5% glucose and 5% n class="Chemical">grapeseed oil and Vogel's salts for 20 days) remaining from the Folch extraction were dried under a stream of nitrogen and re-suspended in 50 mM Tris buffer, pH 8.00. Acetonitrile was added to the sample to a final concentration of 10%. The samples were then boiled for 5 min and cooled to room temperature. TCEP (Tris (2-carboxyethyl) phosphine) was added to 1 mM (final concentration) and the samples were incubated at 37 °C for 30 min. Subsequently, the samples were carboxymethylated with 0.5 mg/ml of iodoacetamide for 30 min at 37 °C in dark followed by neutralization with 2 mM TCEP (final concentration). Samples were boiled for 10 min followed by protease digestion with a 1:100 ratio of trypsin: protein (Pierce™ Trypsin Protease, MS Grade Catalog number: 90057 with K, R specificity). After an overnight digestion, samples were centrifuged on a desktop microfuge at max speed (15,000 rpm) for 10 min to remove the insoluble fraction. The soluble fraction was adjusted to 0.2% formic acid and 5% acetonitrile and its peptide content isolated using C-18 solid phase extraction (Thermo Scientific, PI-87782) as described by the manufacturer. The nano-spray ionization experiments were performed using a TripleTOF 5600 hybrid mass spectrometer (ABSCIEX) interfaced with a nano-scale reversed-phase UPLC (Waters nano ACQUITY) using a 20 cm-75 μM ID glass capillary packed with 2.5-μM C18 (130) CSH™ beads (Waters). Peptides were eluted from the n class="Gene">C18 column into the mass spectrometer with a linear gradient (5–80%) of acetonitrile (ACN) at a flow rate of 250 μL/min for 90 min. The buffers used to create the ACN gradient were Buffer A (98% H2O, 2% ACN, 0.1% formic acid and 0.005% TFA) and Buffer B (100% ACN, 0.1% formic acid, and 0.005% TFA). MS/MS data were obtained in a data-dependent manner in which the MS1 data was acquired for 250 ms at m/z of 400–1250 Da and the MS/MS data was acquired from m/z of 50 to 2000 Da. An MS1-TOF acquisition time of 250 ms was set, followed by 50 MS2 events of 48 ms acquisition time for each event. The threshold to trigger the MS2 event was set to 150 counts, when the ion had the charge state +2, +3 and +4. The ion exclusion time was set to 4 s.

Protein identification

Peak lists obtained from MS/MS spectra were identified via fragmentation analysis (database dependent identification) using X! Tandem Vengeance (2015.12.15.2) [28], MS-GF+ version Beta (v10282) [29] and either OMSSA version 2.1.9 [30] or, in the case of the all-Uniprot database search only, Comet version 2016.01 rev. 2 [31]. The search was conducted using SearchGUI version 3.1.2 [32]. The data was searched against a whole Uniprot/Swissprot database search (manually annotated and reviewed) [33], as well as a non-redundant Botryosphaeriaceae-only database downloaded from n class="Chemical">NCBI [34]. An all-human database from Uniprot was also used for further assessing protein identifications. Because of the large amount of data collected, all identification data from each database may be found as a Data in Brief article as Supplementary data S2, S3 and S4 [35]. The identification settings were as follows: Trypsin with a maximum of 2 missed cleavages; 60.0 ppm as MS1 and 0.8 Da as n class="Gene">MS2 tolerances; fixed modifications: Carbamidomethylation of C (+57.021464 Da) and Oxidation of M (+15.994915 Da), variable modifications: Acetylation of protein N-term (+42.010565 Da), Pyrrolidone from E (+18.010565 Da), Pyrrolidone from Q (+17.026549 Da) and Pyrrolidone from carbamidomethylated C (+17.026549 Da). All algorithm-specific settings are listed in the Certificate of Analysis available in Supplementary data S1 in the associated data in brief article [35]. Peptides and proteins were inferred from the spectrum identification results using PeptideShaker version 1.13.6 [36]. Peptide Spectrum Matches (PSMs), peptides and proteins were validated at a 1.0% False Discovery Rate (FDR) estimated using a decoy-hit distribution. Because of the large quantity of data, a Data in Brief article is cited when referring to the data [35]. All validation thresholds are listed in the Certificate of Analysis available in Supplementary data S1A, S1B, and S1C for all databases searched in the Data in Brief article [35]. Post-translational modification localizations were scored using the D-score [37] and the A-score [38] with a threshold of 95.0 as implemented in the compomics-utilities package [39]. The mass spectrometry raw data files along with the identification results have been deposited to the ProteomeXchange Consortium [40] via the PRIDE partner repository [41] with the data set identifier PXD005283. Gene ontology (GO) analysis of enriched proteins was done on all those hits obtained from the Uniprot database [33]. The software Cytoscape [42] with the BiNGO plugin [43] was used for GO and enrichment analysis using up-to-date databases, applying a hypergeometric test with a significance level (p-value) < 0.05, as well as a Benjamini and Hochberg false discovery n class="Species">rate (FDR) correction. Interactive Cytoscape BiNGO networks were created with data from the all-Uniprot database search, and annotated with an all-Uniprot ontology database, with an interactive Cytoscape network available in Fig. 1A in the associated Data in Brief article [35]. Venn diagrams were created from the output of the hypergeometric test performed for enriched ontology categories with the Cytoscape BiNGO Plugin, using the “R”-based program VennDiagram [44]. An interactive cytoscape network is available in Fig. 1B in the associated Data in Brief article [35], as well as gene ontology annotations as Supplementary data S6 in the same.
Fig. 1

Venn diagrams of gene ontology data from Cytoscape BiNGO showing enriched biological processes in the proteome from Lasiodiplodia theobromae using an all-Uniprot ontology database, compared to A; An all-Saccharomyces cerevisiae ontology database, and B; an all-Candida albicans ontology database. Also included are enriched molecular functions of the proteome from L. theobromae assessed with an all-Uniprot ontology database compared to molecular functions from C; an all-S. cerevisiae ontology database, as well as compared to molecular functions of D; an all-C. albicans ontology database. Venn diagrams were created with the “R”-based program VennDiagram.

Venn diagrams of gene ontology data from Cytoscape BiNGO showing enriched biological processes in the proteome from n class="Species">Lasiodiplodia theobromae using an all-Uniprot ontology database, compared to A; An all-Saccharomyces cerevisiae ontology database, and B; an all-Candida albicans ontology database. Also included are enriched molecular functions of the proteome from L. theobromae assessed with an all-Uniprot ontology database compared to molecular functions from C; an all-S. cerevisiae ontology database, as well as compared to molecular functions of D; an all-C. albicans ontology database. Venn diagrams were created with the “R”-based program VennDiagram.

De novo peptide sequencing

De novo peptide sequencing was performed in order to compare results and explore peptides via sequence homology with sequenced proteins found in the entire Uniprot database using BLASTp. The program DeNovoGUI version 1.14.5 was used for this purpose [45], and both n class="Chemical">Novor [46] and PepNovo [47] were used for peptide sequencing. The mass allowance parameters were, for precursor mass tolerance: 10 ppm, and a fragment mass tolerance of 0.5 Da. Post-translational modification settings consisted in carbamidomethylation of cysteine (fixed) and oxidation of methionine (variable). All peptides were searched against the entire Uniprot database using a standalone version of NCBI-BLASTp [48], with one peptide match per spectrum (most significant) and one BLASTp match per peptide (most significant, lowest E-value). The BLASTp match data was also analyzed for gene ontology (molecular functions) as described above, and found in Fig. 1B and as Supplementary material S6 in the Data in Brief article [35].

Results and discussion

This is the first LC-nanoESI-MS peptidome fragmentation analysis and de novo peptide sequencing of L. theobromae or any Botryosphaeriaceae. The Folch extraction was utilized because the literature reports protein loss when using other methods, which rely on precipitating proteins from aqueous solutions [20]. In this work, it is argued that using a combination of non-polar and semi-polar solvents (a 1:1 n class="Species">ratio of dichloromethane and methanol + 0.01% of the antioxidant BHT) in the Folch extraction of lyophilized (freeze-dried) material, removes interfering lipids and compounds without having to solubilize the proteins in aqueous solution, thus minimizing protein oxidation and loss. This is the first report of this in the literature, and has not been previously applied to proteomics of fungi. Although an unorthodox method, the quantity and quality of peptide information is unprecedented in proteomics studies of the fungal family Botryosphaeriaceae. Using a conservative approach that adheres to established Paris Guidelines for proteomics [49], for the database-dependent fragmentation analysis, 224 peptide identification hits with 100% confidence were obtained from a Uniprot decoy database search with a 1% FDR (Supplementary data S2 in the Data in Brief article [35]). Of these, 76 protein hits were validated to 100% confidence with 2 unique peptides or high PSM number, and the remaining 148 identified with one unique peptide. A special case is made of the identification of a protein homologous to human n class="Gene">POTE ankyrin. Ankyrins are adaptor proteins that mediate the attachment of integral membrane proteins to the spectrin-actin based membrane cytoskeleton, and are poorly characterized in fungi [50], [51], [52]. One unique peptide was identified and validated to be homologous using an all-Uniprot database. To explore this further, the same data set was searched against a human-only Uniprot database, which yielded three different peptides that all matched POTE ankyrin (Uniprot accession number A5A3EO). In humans, the POTE ankyrins have been more thoroughly studied, are considered primate-specific [53], and are expressed in testes, ovaries and prostate, as well as in embryonic stem cells, possessing both ankyrin and spectrin domains [52]. The presence of the ankyrin-binding protein spectrin has not been well-established in fungi, and little information exists on ankyrin-binding proteins in the fungal cytoskeleton [54], [55], however, this is an example of proteomics serving to provide important clues for identifying novel proteins in poorly annotated organisms such as fungi that merit further research. Seven hundred and forty-seven peptides yielded protein hits with 100% confidence using a Botryosphaeriaceae-only NCBI database for protein identification with the same data set. Of these, 361 proteins were validated to 100% confidence with at least two validated peptides (Supplementary data S3 in Data in Brief article [35]). Three hundred and eighty-six proteins were identified with 100% confidence with one validated peptide. Of those validated with two unique peptides, many proteins with important biotechnological applications were found, such as a variety of different fungal-specific n class="Chemical">alcohol dehydrogenases. For example, aryl alcohol dehydrogenase (NCBI accession 821064119) as well as saccharopine dehydrogenase (NCBI accession 821064554) were identified homologous to D. seriata, the latter possessing a biochemical function specific to fungi (involved in the lysine synthesis pathway) and both potential targets for new antifungal compounds [56]. Aryl-alcohol dehydrogenase is involved in degrading lignin, and of biotechnological interest for the production of flavor compounds [57], [58]. Along the lines of fungal-specific amino acid synthesis pathways that may serve as targets for new antifungals [59], a protein homologous to homocysteine synthase from the de novo methionine synthesis pathway was also identified (Uniprot ID# P50125). Many proteins relevant to canonical metabolic pathways and fermentation (an important part of metabolism in microorganisms) were detected (Supplementary data S2–S5 in data article [35]). However, many enriched molecular functions never before reported in L. theobromae were found. Intriguingly, none of the enriched gene ontology categories yielded lipases as an enriched protein group using a 1% FDR search using fragmentation analysis. Not detecting more lipases was an unexpected result, since it is well known that lipases are induced by n class="Chemical">triglycerides in the medium in many fungi [60] and fatty acid ester analysis indicated a high production of a variety of these lipase/esterase-derived compounds by the fungus under the same cultivation conditions and carbon sources [24]. This is likely due to the fact that the genome from L. theobromae has not been sequenced, and evidently, the lipases detected in this work do not share homology with any lipases from sequenced fungal organisms. Of the confidently identified proteins from the NCBI Botryosphaeriaceae-only database, thirty-one were identified as “hypothetical” proteins, i.e. proteins without known functions. The accession numbers from these were input into n class="Chemical">NCBI BLAST, and the hit with the highest max score was listed as a potential match (Table 1).
Table 1

Proteins identified as “hypothetical” by the MSGF, X! Tandem and OMSSA algorithms, further searched with NCBI BLAST. The top-scoring homologous protein is reported for each search in the last column.

Main accessionDescriptionCoverage [%]Spectrum counting#Validated uniqueConfidence [%]ValidationHomologous protein sequence (BLAST)
407929156Hypothetical protein MPH_00684 [Macrophomina phaseolina MS6]6.030.12100ConfidentNeofusicoccum parvum UCRNP2 putative protein mitochondrial targeting protein XM_007580308.1
407928922Hypothetical protein MPH_00885 [Macrophomina phaseolina MS6]17.1228.83100ConfidentNeofusicoccum parvum UCRNP2 putative phosphotransmitter protein ypd1 protein XM_007584095.1
407927556Hypothetical protein MPH_02256 [Macrophomina phaseolina MS6]9.1124.14100ConfidentNeofusicoccum parvum UCRNP2 putative nuclear and cytoplasmic polyadenylated rna-binding protein pub1 protein mRNA, XM_007585675.1
407923581Hypothetical protein MPH_06104 [Macrophomina phaseolina MS6]11.6108.62100ConfidentSphaerulina musiva SO2202 GTP-binding protein mRNA XM_016910103.1
407922440Hypothetical protein MPH_07279 [Macrophomina phaseolina MS6]9.9242.12100ConfidentNeofusicoccum parvum UCRNP2 putative fk506-binding protein, XM_007581103.1
407921582Hypothetical protein MPH_07998 [Macrophomina phaseolina MS6]4.911.82100ConfidentNeofusicoccum parvum UCRNP2 putative transcription factor (snd1 p100) protein, XM_007582992.1
407921297Hypothetical protein MPH_08297 [Macrophomina phaseolina MS6]12.374.83100ConfidentNeofusicoccum parvum UCRNP2 putative g-protein complex beta subunit protein XM_007582859.1
407920925Hypothetical protein MPH_08717 [Macrophomina phaseolina MS6]23.4128.17100ConfidentNeofusicoccum parvum UCRNP2 putative glycolipid transfer protein het-c2 protein XM_007581974.1
407916430Hypothetical protein MPH_13123 [Macrophomina phaseolina MS6]21.2581.64100ConfidentNeofusicoccum parvum UCRNP2 putative surface protein 1 protein XM_007588394.1
Proteins identified as “hypothetical” by the MSGF, X! Tandem and OMSSA algorithms, further searched with NCBI BLAST. The top-scoring homologous protein is reported for each search in the last column. From the Uniprot database search, an unexpected annotation category found to be enriched is kininogen binding, with enolase (EC 4.2.1.11) (2-phospho-d-glycerate hydro-lyase) (2-phosphoglycen class="Species">rate dehydratase) homologous to Candida albicans identified and validated in this category to be produced by L. theobromae. Although binding targets in plants have not been identified, kininogens are known to possess physiological activity, and in humans are cleaved by proteases into their physiologically active form [61]. Besides having an important role in glycolysis, enolase from Candida spp. is present in biofilms and is known to bind to host cells and induce IgE-mediated allergy responses in humans [62]. In Candida parapsilosis and Candida tropicalis, it was shown that glycolytic enzymes, including enolase, are exposed at the surface of the fungus, and bind human host proteins such as laminin, vitronectin [63] and plasminogen [61]. C. albicans enolase is also involved in human respiratory fungal allergies and required for the colonization of the intestinal epithelium [62]. Although very little is known about enolases from L. theobromae, they are homologous to many allergenic enolases from other filamentous fungi were such as Alternaria alternata (Uniprot ID Q9HDT3), a known human allergen of clinical significance [64], [65]. Although L. theobromae shares many biological processes with Saccharomyces cerevisiae, as well as molecular functions and cellular components, the proteins distinguished to be significantly enriched and involved in fermentation, such as n class="Chemical">alcohol dehydrogenases and pyruvate decarboxylase, were unique to fungal pathogens and clearly distinct to S. cerevisiae fermentation genes. For example, the enriched alcohol fermentation-specific proteins pyruvate decarboxylase and alcohol dehydrogenase from L. theobromae were found to be homologous to Aspergillus spp. and Botryosphaeriaceae spp., respectively. Membrane-related processes such as binding and cell signaling were attributed to the 14-3-3 protein, which is known to act in a variety of important lipid/membrane signaling processes [66], and identified in L. theobromae to be expressed under the described cultivation conditions (See Supplementary data S3 in Data in Brief article [35]). The glycon class="Chemical">lipid transfer protein Het-C2 was identified (only after manually searching the confidently identified hypothetical proteins) (Table 1). Het-C2 is also important in heterokaryon incompatibility signaling and programmed cell death in fungi [67]. The anti-viral lectin-type protein cyanovirin-N was detected as well, which is a carbohydrate-binding protein important in nutrient sensing [68], and of great biotechnological interest for use in anti-viral therapies. As aforementioned, very few of the enriched categories were shared between L. theobromae and S. cerevisiae. Instead, the enriched categories from L. theobromae were more similar to the pathogenic n class="Species">yeast C. albicans (see full S. cerevisiae-specific ontology in Supplementary data 5 in associated Data in Brief article [35] and Fig. 1). The data provides insight into enzymatic differences between L. theobromae and the non-pathogen S. cerevisiae, as well as metabolic similarities between pathogens such as L. theobromae and n class="Species">C. albicans. All ferment glucose, but L. theobromae evidently has fermentation enzymes that have evolved differently than either of these yeasts, and possesses a generally wider metabolic repertoire in comparison, as shown in the identified ontology categories analyzed via Venn Diagrams (Fig. 1). De novo peptide sequencing and a BLASTp search against the entire Uniprot database yielded many novel proteins for L. theobromae. Out of the 5983 peptide hits, many peptides were homologous to lipases and toxins (Table 2 and Supplementary information S6 in Data in Brief article [35]). The most probable homolog is reported, with relatively high E-values that are reflective of potentially uncharacterized, novel sequences in this fungus, and a lack of genomic sequences for Botryosphaeriaceae and filamentous fungi in general. De novo sequencing supported some findings from the database-dependent fragmentation analysis-based protein identifications, especially the finding of novel ankyrins, including the n class="Gene">POTE ankyrin. Many peptides homologous to an assortment of proteases were detected, including some found in venom from a variety of insects and snakes, representing an area of new research possibilities in the host: pathogen interaction. The finding of a zinc metalloproteinase-disintegrin-like daborhagin-K (EC 3.4.24.-) is highly significant and novel because of the function of this type of protease in causing dermal hemorrhage in mice [69]. The role of this protein in L. theobromae remains to be studied.
Table 2

Novel de novo peptide sequences from the Novor and PepNovo algorithms and BLASTp search results using an all-Uniprot database of the peptidome from Lasiodiplodia theobromae incubated in 5% grapeseed oil + 5% glucose for 20 days, showing the most probable homolog.

Query sequencePeptide Scorem/zChargeE-valueUniprot IDOrganismProtein name
ELGFLASLGWNAPPAFPGPELTALDKLSAALSNR28.71175.23+2Q8T9W1Dictyostelium discoideum (Slime mold)Serine protease/ABC transporter B family protein tagD (EC 3.4.21.-) (Serine protease/ABC transporter tagD)
DDGSMDTCEDDGAGR43.1808.82+8.6Q7RTY9Homo sapiens (Human)Serine protease 41 (EC 3.4.21.-) (Testis serine protease 1) (TESSP-1)
QETSVPGDSQATLDALNEWR66.5739.73+1.6Q10749Naja mossambica (Mozambique spitting cobra)Snake venom metalloproteinase-disintegrin-like mocarhagin (MOC) (Mocarhagin-1) (SVMP) (EC 3.4.24.-) (Zinc metalloproteinase)
LLGTAMHVAGHLCAMMGWYRLTPSLHK17.01033.83+4.6J3RY93Crotalus adamanteusSnake venom serine proteinase 12 (SVSP) (EC 3.4.21.-)
WLSAKGWAQGVAEGPGDPR35.9991.52+7.7P0DL42Daboia siamensis (Eastern Russel's viper)Snake venom vascular endothelial growth factor toxin VR-1' (svVEGF) (VEGF-F)
DYPPVLEHLLAWEEEQR19.0708.73+7B2MVK7Rhynchium brunneum (Potter wasp)Venom allergen 5 (Antigen 5) (Cysteine-rich venom protein) (CRVP)
VLTVKGSCNLTMLVSFWTFSGNLTNGASTGSHK37.41172.33+5.7C0ITL3Pachycondyla chinensis (Asian needle ant)Venom allergen 5 (Antigen 5) (Cysteine-rich venom protein) (CRVP) (allergen Pac c 3) (Fragment)
MLPAFLVDVHHSKKVGVPPNYYYQHSK15.10793.44+7.1P83370Hoplocephalus stephensii (Stephens' banded snake)Venom prothrombin activator hopsarin-D (vPA) (EC 3.4.21.6) (Venom coagulation factor Xa-like protease) [Cleaved into: Hopsarin-D light chain; Hopsarin-D heavy chain]
APTPALDGGKLMFVSAK38.6568.33+0.63Q5WFT5Bacillus clausii (strain KSM-K16)Zinc metalloprotease RasP (EC 3.4.24.-) (Regulating alternative sigma factor protease) (Regulating anti-sigma-W factor activity protease)
LASHKPNCFLAPPLGTHDVVPK34.5800.13+6B8K1W0Daboia russelii (Russel's viper) (Vipera russelii)Zinc metalloproteinase-disintegrin-like daborhagin-K (EC 3.4.24.-) (Haemorrhagic metalloproteinase russelysin) (Snake venom metalloproteinase) (SVMP)
VDSDFTVGLAAQWAETDLYK49.3743.73+7C5H5D6Lachesis muta rhombeata (Bushmaster)Zinc metalloproteinase-disintegrin-like lachestatin-2 (EC 3.4.24.-) (Snake venom metalloprotease) (SVMP) (Vascular apoptosis-inducing protein-like) (VAP-like)
YGMKWSLLMLAAGGGR54.8863.92+5.4Q5XJ13Danio rerio (Zebrafish) (Brachydanio rerio)Ankyrin repeat and SAM domain-containing protein 6 (Ankyrin repeat domain-containing protein 14) (SamCystin)
LMAAWGQNPGQAALYVEWNPEVMSAVWK37.101054.83+1.2Q68DC2Homo sapiens (Human)Ankyrin repeat and SAM domain-containing protein 6 (Ankyrin repeat domain-containing protein 14) (SamCystin)
LGAKWCHHCFAVPMK19.9929.42+0.95Q6S8J3Homo sapiens (Human)POTE ankyrin domain family member E (ANKRD26-like family C member 1A) (Prostate, ovary, testis-expressed protein on chromosome 2) (POTE-2)
ALKGFYLMNPPAPVWWTR49.6716.43+5.6B8I4B9Clostridium cellulolyticumATP-dependent zinc metalloprotease FtsH (EC 3.4.24.-)
LAAPNPYLWWHDLVPR40.5974.52+6.7Q2EEX7Helicosporidium sp. subsp. Simulium jonesiiATP-dependent zinc metalloprotease FtsH homolog
ELKAKKVGAMDVASSEFYK52.7701.043+1.5P30575Candida albicansEnolase 1 (EC 4.2.1.11) (2-phospho-d-glycerate hydro-lyase) (2-phosphoglycerate dehydratase)
TLVAGFFFLAASLTCLLVPSEAPTFSETTR45.0812.44+1.8Q9HDT3Alternaria alternataEnolase (EC 4.2.1.11) (2-phospho-d-glycerate hydro-lyase) (2-phosphoglycerate dehydratase) (Allergen Alt a 11) (Allergen Alt a 5) (Allergen Alt a XI)
ELGAHTLGFLESNPKFDPGSYEQLADLYK53.21080.53+1.7Q96X30Neosartorya fumigata (Aspergillus fumigatus)Enolase (EC 4.2.1.11) (2-phospho-d-glycerate hydro-lyase) (2-phosphoglycerate dehydratase) (allergen Asp f 22)
HCLAAVPCMGQSPAAAALLNSSEVQNMAMGFK40.41025.52+, 3+, 4+1.6Q59121Arcanobacterium haemolyticumPhospholipase D (EC 3.1.4.4) (Choline phosphatase) (PLD-A)
VFRLKDSGNSKPDKAAPPPGPLPR29.2848.83+8.3O14939Homo sapiens (Human)Phospholipase D2 (PLD 2) (hPLD2) (EC 3.1.4.4) (Choline phosphatase 2) (PLD1C) (Phosphatidylcholine-hydrolyzing phospholipase D2)
LHMGTDCAELDCVRSAPK33.2687.33+4.5Q9LI83Arabidopsis thaliana (Mouse-ear cress)Phospholipid-transporting ATPase 10 (AtALA10) (EC 3.6.3.1) (Aminophospholipid flippase 10)
DLADALKAAMGAPKHAVDHVAEPMDVAQLAPGNK36.9867.74+4.2P06681Homo sapiens (Human)Complement C2 (EC 3.4.21.43) (C3/C5 convertase) [Cleaved into: Complement C2b fragment; Complement C2a fragment]
NTLHAPEGTVVHLNAHK54.2919.52+8.7P98094Eptatretus burgeri (Inshore hagfish)Complement C3 [Cleaved into: Complement C3 beta chain; Complement C3 alpha chain; C3a anaphylatoxin; Complement C3 gamma chain] (Fragment)
HNDRCPCMCNCQNDDCRCDTSNVPAK16.2825.84+6.3Q00685Lethenteron camtschaticum (Japanese lamprey) (Lampetra japonica)Complement C3 [Cleaved into: Complement C3 beta chain; Complement C3 alpha chain; C3a anaphylatoxin; Complement C3 gamma chain] (Fragment)
SWFVNVPNCDGALAGMTASFVR30.9800.43+9.7P01031Homo sapiens (Human)Complement C5 (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4) [Cleaved into: Complement C5 beta chain; Complement C5 alpha chain; C5a anaphylatoxin; Complement C5 alpha chain]
KDLKYLDVYYWRYFWKWRQVDYLVAPAK22.6928.94+4.1P15304Rattus norvegicus (Rat)Hormone-sensitive lipase (HSL) (EC 3.1.1.79)
DPGFLGTLATASGKFGEGDPHAKTSGLNRK40.01010.53+0.21A7L035Chironex fleckeri (Box jellyfish)Toxin CfTX-1 (Toxin 1)
TLMGYLLAVDGCALGCFFVMPGLGLVAALSK28.3815.94+3.2P60262Tityus discrepans (Venezuelan scorpion)Toxin TdII-3 (Fragment)
SAPDPGTGDEVVMGQMDPR37.1658.93+4.8P42211Oryza sativa subsp. japonica (Rice)Aspartic proteinase (EC 3.4.23.-)
PAYHDLGVVPMADTR41.7821.42+9.2Q8VYV9Arabidopsis thaliana (Mouse-ear cress)Aspartyl protease family protein 1 (EC 3.4.23.-)
Novel de novo peptide sequences from the n class="Chemical">Novor and PepNovo algorithms and BLASTp search results using an all-Uniprot database of the peptidome from Lasiodiplodia theobromae incubated in 5% grapeseed oil + 5% glucose for 20 days, showing the most probable homolog. An allergenic enolase was found with homology to the same in A. alternata, further evidence of immune system modulation by L. theobromae in an IgE-dependent manner (Table 2). More tellingly, a significant de novo peptide was found homologous to enolase from n class="Species">C. albicans, supporting and confirming the results from the database-dependent fragmentation analysis, with many potential novel functions in plants and humans, and ruling out database bias in the identification of this enolase via a Uniprot database-dependent fragmentation analysis. The fact that the proteome and related molecular functions from L. theobromae more closely resembled C. albicans instead of n class="Species">Saccharomyces cerevisiae is of interest because L. theobromae, along with Macrophomina phaseolina, also a member of the Botryosphaeriaceae, is reported to be able to infect both plants and humans [18], making this an avenue for further research for understanding host-specific pathogenicity. It is proposed that finding common proteins or physiological functions between known human pathogens such as Candida spp. and plant pathogens that are also able to infect humans, may be the key to understand cross-domain colonization. For example, the enolase in L. theobromae may be a part of L. theobromae's pathogenicity in both plants and humans in a manner similar to C. albicans, potentially causing IgE-based allergic reactions in humans, or binding compounds in plants critical to normal physiological functioning. Many other peptides sequenced in this work were found to be involved in immune system regulation (such as peptides homologous to complement C3). This indicates an ancient conserved proteolytic system and the ability of this fungus to manipulate the host's immune system as an exciting avenue of research in cross-domain colonization by pathogenic fungi. The finding of this type of protein is of interest in this case especially because in n class="Species">humans, it is known to contribute to inflammation and lipid metabolism [70]. The complement C3 version detected here includes the type cleaved into the anaphylatoxin version of this protein, which is also involved in causing histamine release from mast cells and enhanced vascular permeability and various other processes in the innate immune response [71]. In humans, C3 production is also activated by chylomicrons [72], also involved in lipid metabolism. The function of this protein in L. theobromae remains to be elucidated, although its role in lipid metabolism may be especially relevant in exogenous lipid digestion by L. theobromae, an important substrate for fungi and one of the substrates used for this experiment. Gene ontology of the de novo sequencing results revealed binding and catalytic activities to be enriched, as found in the database-dependent protein identification results (Fig. 1A and B and Supplementary information S6 in Data in Brief article [35]). Both peptide identification methods demonstrated peptides that were homologous to a variety of taxonomic orders (Fig. 2).
Fig. 2

Taxonomic order distribution of peptide hits using the entire Uniprot database from both peptidome analysis approaches, showing the top ten most represented orders in each peptide identification approach with most homology to the peptidome from Lasiodiplodia theobromae.

Taxonomic order distribution of peptide hits using the entire Uniprot database from both peptidome analysis approaches, showing the top ten most represented orders in each peptide identification approach with most homology to the peptidome from Lasiodiplodia theobromae. Uniprot database-dependent fragmentation analysis showed homology mostly to Saccharomycetales (budding yeasts), followed by homology to Eurotiales (green and blue molds), and Sordariales, whereas de novo peptide sequencing genen class="Species">rated peptides with homology to mostly Primates, followed by Rodentia, Brassicales (flowering plants) and Saccharomycetales (budding yeasts). These differences are thought to arise from a lack of sequence information in the Uniprot database for filamentous fungi (Ascomycetes) from different taxonomic orders. Additionally, the differences are likely due to uncharacterized and unannotated sequences in L. theobromae. These dissimilarities are expected to be resolved as the genome sequence from L. theobromae and other Botryosphaeriaceae are sequenced and annotated. It brings to attention the fact that genomic sequencing and detailed, functional characterization efforts are crucial for effectively strengthening bioinformatics databases and for implementing powerful technological platforms such as proteomics, especially because protein expression studies are critical for pursuing promising new avenues of research in fungal biochemistry. These efforts will lead to the characterization and annotation of new genes, and ontological categories attributed to each gene, which will allow for more thorough protein expression studies in any experimental context. Apart from genomic sequencing, characterization efforts in the form of cloning and purification, or GFP-tagging and cellular localization efforts would be the next step forward from this work. A comprehensive bioinformatics study such as this (the first of its kind for Botryosphaeriaceae), is highly useful, and in this case has allowed the targeting of many new proteins for further research, such as zinc metalloproteinases and lipases. The data is freely available to the scientific community interested in this area of fungal biochemistry and cellular biology, and will be re-visited once the genome from L. theobromae becomes available.

Conclusions

This proteomic exploration has led to the identification of host binding as a critically important aspect in fungal pathogenicity. Protein targets for developing stn class="Species">rategies to control L. theobromae have also been identified. Novel proteins have been detected that merit further research as unexplored paradigms in fungal biochemistry, such as peptides with homology to ankyrins, and particularly the POTE ankyrin from humans. Novel zinc metalloproteinases homologous to those from snake venom were found, among many other interesting proteins such as lipases, peptides homologous to complement from the human immune system, and allergenic enolases that await further functional description.

Funding sources

This research did not receive any specific grant from funding agencies in the public, commercial, or not-for-profit sectors.

Conflict of interest

The authors state that there are no conflicts of interest in this work.
  60 in total

1.  Open mass spectrometry search algorithm.

Authors:  Lewis Y Geer; Sanford P Markey; Jeffrey A Kowalak; Lukas Wagner; Ming Xu; Dawn M Maynard; Xiaoyu Yang; Wenyao Shi; Stephen H Bryant
Journal:  J Proteome Res       Date:  2004 Sep-Oct       Impact factor: 4.466

2.  PepNovo: de novo peptide sequencing via probabilistic network modeling.

Authors:  Ari Frank; Pavel Pevzner
Journal:  Anal Chem       Date:  2005-02-15       Impact factor: 6.986

3.  Reporting protein identification data: the next generation of guidelines.

Authors:  Ralph A Bradshaw; Alma L Burlingame; Steven Carr; Ruedi Aebersold
Journal:  Mol Cell Proteomics       Date:  2006-05       Impact factor: 5.911

4.  Chylomicron accelerates C3 tick-over by regulating the role of factor H, leading to overproduction of acylation stimulating protein.

Authors:  Takayuki Fujita; Takayuki Fujioka; Tetsuo Murakami; Atsushi Satomura; Yoshinobu Fuke; Koichi Matsumoto
Journal:  J Clin Lab Anal       Date:  2007       Impact factor: 2.352

Review 5.  Complement and its role in innate and adaptive immune responses.

Authors:  Jason R Dunkelberger; Wen-Chao Song
Journal:  Cell Res       Date:  2009-12-15       Impact factor: 25.617

6.  Candida albicans binds human plasminogen: identification of eight plasminogen-binding proteins.

Authors:  Jonathan D Crowe; Isla K Sievwright; Gillian C Auld; Norma R Moore; Neil A R Gow; Nuala A Booth
Journal:  Mol Microbiol       Date:  2003-03       Impact factor: 3.501

Review 7.  Pathways for degradation of lignin in bacteria and fungi.

Authors:  Timothy D H Bugg; Mark Ahmad; Elizabeth M Hardiman; Rahman Rahmanpour
Journal:  Nat Prod Rep       Date:  2011-09-15       Impact factor: 13.423

Review 8.  Alternaria alternata and its allergens: a comprehensive review.

Authors:  Irena Kustrzeba-Wójcicka; Emilia Siwak; Grzegorz Terlecki; Anna Wolańczyk-Mędrala; Wojciech Mędrala
Journal:  Clin Rev Allergy Immunol       Date:  2014-12       Impact factor: 8.667

9.  MS-GF+ makes progress towards a universal database search tool for proteomics.

Authors:  Sangtae Kim; Pavel A Pevzner
Journal:  Nat Commun       Date:  2014-10-31       Impact factor: 14.919

10.  Extracellular enolase of Candida albicans is involved in colonization of mammalian intestinal epithelium.

Authors:  Richard C Silva; Ana Carolina B Padovan; Daniel C Pimenta; Renata C Ferreira; Claudio V da Silva; Marcelo R S Briones
Journal:  Front Cell Infect Microbiol       Date:  2014-06-03       Impact factor: 5.293

View more
  2 in total

1.  Data from proteome analysis of Lasiodiplodia theobromae (Botryosphaeriaceae).

Authors:  Carla C Uranga; Majid Ghassemian; Rufina Hernández-Martínez
Journal:  Data Brief       Date:  2017-05-17

2.  Unveiling the Secretome of the Fungal Plant Pathogen Neofusicoccum parvum Induced by In Vitro Host Mimicry.

Authors:  Forough Nazar Pour; Bruna Pedrosa; Micaela Oliveira; Cátia Fidalgo; Bart Devreese; Gonzalez Van Driessche; Carina Félix; Nuno Rosa; Artur Alves; Ana Sofia Duarte; Ana Cristina Esteves
Journal:  J Fungi (Basel)       Date:  2022-09-17
  2 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.