Literature DB >> 23451152

Heat shock-induced accumulation of translation elongation and termination factors precedes assembly of stress granules in S. cerevisiae.

Tomas Grousl1, Pavel Ivanov, Ivana Malcova, Petr Pompach, Ivana Frydlova, Renata Slaba, Lenka Senohrabkova, Lenka Novakova, Jiri Hasek.   

Abstract

In response to severe environmental stresses eukaryotic cells shut down translation and accumulate components of the translational machinery in stress granules (SGs). Since they contain mainly mRNA, translation initiation factors and 40S ribosomal subunits, they have been referred to as dominant accumulations of stalled translation preinitiation complexes. Here we present evidence that the robust heat shock-induced SGs of S. cerevisiae also contain translation elongation factors eEF3 (Yef3p) and eEF1Bγ2 (Tef4p) as well as translation termination factors eRF1 (Sup45p) and eRF3 (Sup35p). Despite the presence of the yeast prion protein Sup35 in heat shock-induced SGs, we found out that its prion-like domain is not involved in the SGs assembly. Factors eEF3, eEF1Bγ2 and eRF1 were accumulated and co-localized with Dcp2 foci even upon a milder heat shock at 42°C independently of P-bodies scaffolding proteins. We also show that eEF3 accumulations at 42°C determine sites of the genuine SGs assembly at 46°C. We suggest that identification of translation elongation and termination factors in SGs might help to understand the mechanism of the eIF2α factor phosphorylation-independent repression of translation and SGs assembly.

Entities:  

Mesh:

Substances:

Year:  2013        PMID: 23451152      PMCID: PMC3581570          DOI: 10.1371/journal.pone.0057083

Source DB:  PubMed          Journal:  PLoS One        ISSN: 1932-6203            Impact factor:   3.240


Introduction

Reactivity to environmental changes is a key property of all living organisms that enables them to survive and develop. Cells undergo adaptation to stress conditions via various mechanisms. To save energy, general translation is reduced and the expression of stress response-specific genes is triggered. New ribonucleoprotein (RNP) complexes are formed, through which the fate of mRNA molecules and translation machinery components is regulated. Major accumulations of cytoplasmic RNP complexes that have been recognized in higher eukaryotes - processing bodies (P-bodies) and stress granules (SGs) have also been found in yeasts [1], [2], [3], [4], [5], [6]. Whilst P-bodies are present even in unstressed cells and they become dominant upon stress, SGs are formed only in stressed cells. Besides translationally repressed mRNA molecules, P-bodies also contain proteins involved in mRNA degradation, translation repression, mRNA quality control and other functions (for a review, see [7], [8]). However, nowadays it is evident that the function of P-bodies is far more complex than merely mRNA degradation [9], [10], [11], [12] and is still not well understood (for a review, see [13]). The composition of SGs is influenced by the particular stress conditions and depends on the organism being subjected to the stress. It is generally accepted that major SGs components are stalled translation preinitiation complexes (48S), which contain molecules of mRNA, small ribosomal subunits and several translation initiation factors. Besides these, they may contain a few other factors, which could be found either in SGs or P-bodies [2], [14]. Thus, P-bodies and SGs represent two distinct types of RNP assemblies, which can share some components and can be in spatial contact, but differ in their role in cell adaptation to environmental changes, which is realized via translation regulation and mRNA metabolism. Analogous to mammalian cells, it is thought that yeast SGs take part in regulation of translation, sorting and storage of mRNA molecules, and the preservation of selected translation factors and mRNA molecules against an influence of a stress [10], [14], [15]. Recently, they have been shown to control TORC1 signaling [16]. Typical examples of yeast SGs are those containing eIF3 components. They are induced by robust heat shock [2], high concentrations of ethanol [3] or NaN3 [17]. However, only the robust heat shock-induced SGs accumulate 40S ribosomal subunits. Based on the analyses of the strains from the GFP collection [18], none of the tested 60S markers formed foci upon robust heat shock indicating that 60S ribosomal subunits were not accumulated in these SGs [2]. Interestingly, these typical SGs containing 40S and eIF3 translation initiation factor have also been observed in fission yeast S. pombe affected by heat shock or glucose deprivation [4], [19]. Other examples of RNP accumulations, which are thought to be functionally analogous to SGs, are yeast EGP bodies [20], stress granules of glucose-deprived [1] or cold-stressed [6] S. cerevisiae cells. Heat stress is an example of stress conditions resulting in the formation of either P-bodies or stress granules (SGs). In S. cerevisiae cells, whose temperature optimum for growth is between 25°C and 30°C, cultivation at 39°C triggers the assembly of P-bodies [21] and robust heat shock at 46°C leads to the formation of SGs [2]. Here we report on the identification of novel components of heat-induced SGs in yeast, translation elongation factors eEF3 (Yef3p) and eEF1Bγ2 (Tef4p) and translation termination factors eRF1 (Sup45p) and eRF3 (Sup35p). Despite the presence of the yeast prion protein Sup35, we proved that its prion-like domain is necessary neither for SGs assembly nor for its localization into SGs. Moreover, we showed that eEF3, eEF1Bγ2 and eRF1 factors accumulate even upon a milder heat shock at 42°C, possibly preparing a platform for assembly of genuine SGs at 46°C. Although RNP accumulations induced at 42°C contain some components of P-bodies, they depend neither on P-bodies scaffolding proteins nor on the Gcn2 kinase activity. The Gcn2 kinase is so far the only known yeast kinase of α subunit of translation initiation factor 2 (eIF2α) [22]. This factor plays an essential role in translation initiation and its regulation. The eIF2 factor is a component of the “ternary complex”, which brings the initiator tRNA to 40S ribosomal subunits. The GTP-bound to eIF2 is then hydrolyzed to GDP and the factor leaves the ribosome. The active, GTP-bound, form of eIF2 is recovered by its guanine nucleotide exchange factor eIF2B [23]. Under stress conditions, stress responsive kinases, e.g. Gcn2, phosphorylate α subunit of eIF2 factor [22]. Since the phosphorylated eIF2 factor has higher affinity for eIF2B [24], it leads to reduction of availability of eIF2B factor, eIF2-GTP and the “ternary complex”. Thus, it results in inhibition of translation initiation, which is commonly link to an accumulation of stalled translation preinitiation complexes and stress granules assembly. Taken together, the phosphorylation of eIF2α factor is sufficient, but not necessary for SGs formation (for a review, see [14]). The eIF2α-phosphorylation independent mechanisms of SGs assembly have also been described from yeast to mammalian cells [2], [25], [26], [27], [28], [29], [30]. These mechanisms are mainly concerned with translation initiation factors, or are yet unknown [31]. Although, we found that assembly of heat-induced SGs at 46°C and RNP accumulations formed at 42°C are not driven by eIF2α phosphorylations, we also observed that the translation initiation factor eIF2α (Sui2p), which is not a component of the heat-induced SGs in S. cerevisiae, accumulates when SGs dissolve during the cell recovery from the stress. Altogether, our data might help to understand the eIF2α factor phosphorylation-independent signaling pathway of the SGs assembly and to reinforce the hypothesis that SGs are the sites where translation initiates after stress relief.

Materials and Methods

Yeast Strains and Growth Conditions

The Saccharomyces cerevisiae strains used in this study were derived either from the BY [32], S288C [18] or SEY6210 [33] backgrounds and are listed in Table 1. Yeast cultures were grown in YPD medium (1% yeast extract, 2% peptone, 2% glucose) or SC medium (0.17% YNB without amino acids and ammonium sulfate, 0.5% ammonium sulfate, 2% glucose, supplemented with a complete or appropriate mixture of amino acids) at 30°C. The corresponding solid media contained 2% agar. To select for auxotrophies, the respective amino acid was omitted from the dropout mix. To select for resistance to antibiotics, the appropriate antibiotic was added to the media. Standard methods were used for all DNA manipulations [34]. Strains and mutants expressing particular combinations of various GFP/RFP/mCherry fusion proteins from the sites on the chromosomes were generated by mating, sporulation on solid Fowell medium and subsequent spore dissection by Singer™ micromanipulator. To perform the heat shock, cells were re-suspended in YPD medium preheated to 42°C or 46°C and incubated under shaking at the given temperature for additional 10 minutes. Cycloheximide (Sigma-Aldrich, USA) was added to the final concentration of 50 µg/ml when appropriate.
Table 1

Yeast strains.

StrainGenotypeSource
BY4741 MATa his3Δ1 leu2Δ0 met15Δ0 ura3Δ0 [32]
BY4742 MATα his3Δ1 leu2Δ0 lys2Δ0 ura3Δ0 [32]
BY4743 MAT a/α his3Δ1/his3Δ1 leu2Δ0/leu2Δ0 lys2Δ0/LYS2 MET15/met15Δ0 ura3Δ0/ura3Δ0 [32]
S288C MATα SUC2 gal2 mal mel flo1 flo8-1 hap1 ho bio1 bio6 [56]
Sey6210 MATα leu2-3, 112 ura3-52 his3-Δ200 trp1-Δ901 lys2-801 suc2-Δ9 [33]
Sey6210.1 MATa leu2-3,112 ura3-52 his3-Δ200 trp1-Δ901 lys2-801 suc2-Δ9 [33]
CRY255Sey6210; MATα RPG1-RFP::kanMX4 [2]
CRY309BY4741; MATa gcn2::kanMX4EUROSCARF
CRY412S288C; MATa SUP35-GFP::HIS3MX6 [18]
CRY423S288C; MATa PAB1-GFP::HIS3MX6 [18]
CRY437S288C; MATa SUI2-GFP::HIS3MX6 [18]
CRY462S288C; MATa NGR1-GFP::HIS3MX6 [18]
CRY510S288C; MATa YEF3-GFP::HIS3MX6 [18]
CRY521S288C; MATa TIF11-GFP::HIS3MX6 [18]
CRY528Sey6210 × S288C; MATα RPG1-RFP::kanMX4 PAB1-GFP::HIS3MX6This study
CRY552S288C; MATa EFT1-GFP::HIS3MX6 [18]
CRY554S288C; MATa TEF4-GFP::HIS3MX6 [18]
CRY564Sey6210 × S288C; MATa RPG1-RFP::kanMX4 DCP2-GFP::HIS3MX6 [2]
CRY582S288C × BY4742; MATα gcn2::kanMX4This study
CRY649Sey6210 × S288C; MATa RPG1RFP::kanMX4 YEF3-GFP::HIS3MX6This study
CRY977Sey6210 × S288C; MATa RPG1-RFP::kanMX4 DCP2-GFP::HIS3MX6 edc3::URA3 lsm4ΔC::LEU2 [2]
CRY993BY4743; MATa/α sup35::kanMX4/SUP35 EUROSCARF
CRY998BY4741 × BY4742; MATα sup35::kanMX4+ pLewi0564 (Ura+)This study
CRY1001BY4741 × BY4742; MATα sup35::kanMX4+ pLewi0512 (Ura+)This study
CRY1007BY4741 × BY4742 × S288C; MATα sup35::kanMX4 RPG1-GFP::HIS3MX6+ pLewi0512 (Ura+)This study
CRY1011BY4741 × BY4742 × S288C; MATa sup35::kanMX4 RPG1-GFP::HIS3MX6+ pLewi0564 (Ura+)This study
CRY1035Sey6210 × S288C; MATa RPG1-RFP::kanMX4 PUB1-GFP::HIS3MX6 edc3::URA3 lsm4ΔC::LEU2 This study
CRY1041Sey6210 × S288C; MATα RPG1-RFP::kanMX4 NGR1-GFP::HIS3MX6 edc3::URA3 lsm4ΔC::LEU2 This study
CRY1043BY4742; MATα edc3::URA3 lsm4ΔC::LEU2 This study
CRY1146S288C × BY4742; MATα YEF3-GFP::HIS3MX6 edc3::URA3 lsm4ΔC::LEU2 This study
CRY1287S288C; MATa YEF3-mCherry::natNT2 NGR1-GFP::HIS3MX6This study
CRY1288BY4742; MATα DCP2-mCherry:: natNT2This study
CRY1289BY4742; MATα NGR1-mCherry:: natNT2This study
CRY1292S288C × BY4742; MATa gcn2::kanMX YEF3-GFP::HIS3MX6This study
CRY1315BY4742 × S288C; MATa YEF3-mCherry:: natNT2 TEF4-GFP::HIS3MX6This study
CRY1332Sey6210 × S288C; MATa RPG1-RFP::KanMX4 SUI2-GFP::HIS3MX6This study
CRY1336S288C × BY4742; MATα YEF3-GFP::HIS3MX6 gcn2::kanMX4This study
CRY1339BY4742; MATα YEF3-mCherry:: natNT2This study
CRY1364Sey6210 × S288C; MATa RPG1-RFP::kanMX4 SUP35-GFP::HIS3MX6This study
CRY1516S288C; MATa STM1-GFP::HIS3MX6 [18]
CRY1552S288C; MATa SUP45-GFP::HIS3MX6 [18]
CRY1559BY4742 × S288C; MATα YEF3-mCherry:: natNT2 DCP2-GFP::HIS3MX6This study
CRY1618BY4742 × Sey6210.1; MATα YEF3-mCherry:: natNT2+ pRP1187 (Trp+)+pPS2037 (Ura+)This study
CRY1627Sey6210 × S288C; MATa/α RPG1-RFP::kanMX4 SUP45-GFP::HIS3MX6This study
CRY1636BY4742 × S288C; MATα DCP2-mCherry:: natNT2 SUP45-GFP::HIS3MX6This study
CRY1638BY4742 × S288C; MATα NGR1-mCherry:: natNT2 SUP45-GFP::HIS3MX6This study
CRY1691Sey6210 × S288C × BY4742; MATa RPG1-RFP::kanMX4 SUI2-GFP::HIS3MX6 gcn2::kanMX4This study
CRY1704BY4741; MATa gcn2::kanMX4EUROSCARF
CRY1760Sey6210 × S288C × BY4741; MATa RPG1-RFP::kanMX4 PAB1-GFP::HIS3MX6 stm1::kanMX4This study
CRY1764S288C; MATa TEF1-GFP::HIS3MX6 [18]

Plasmids

Plasmids pRP2037 and pRP1187 for PGK1 mRNA localization by U1A-GFP fusion protein [5], [9] were kindly provided by R. Parker (University of Arizona, USA). For generation of strains expressing only a C-terminal part of Sup35 protein and wild-type form of Sup35 protein as a control, plasmids pLewi0512 and pLewi0564 were used (a kind gift from E.I. Lewitin, Institute of Industrial Genetics, Russia). Escherichia coli strain DH5α [F- rec A1 supE44 endA1 hsdR17 (rk-, mk+) gyrA96 relA1 thi-1 Δ(lacIZYA-argF)U169 deoR (Φ80dΔ(lacZ) M15] [35] was cultivated in LB medium (1% trypton, 0.5% yeast extract and 1% NaCl) and used for plasmids propagation.

Construction of Strains with Chromosome-derived Expression of mCherry Fusions

To create C-terminal genomic fusions of genes of interest, the mCherry integrative cassette containing mCherry fluorescent protein and the selection marker natNT2 (nourseothricin) was used. The cassette was amplified using ORF-specific primers by PCR on the template plasmid pFM699 (kindly provided by M. Farkasovsky, Slovak Academy of Sciences, Slovakia). Purified PCR products were transformed into the appropriate cells and transformants were selected on YPD plates containing 100 µg/ml of nourseothricin (WERNER BioAgents, Germany). Correct integration of the cassette was confirmed by PCR, fluorescence microscopy and Western blotting.

Construction of edc3Δlsm4ΔC Mutant Strain

The mutant strain edc3Δlsm4ΔC was constructed by a repeated one-step gene disruption technique [36]. The deletion cassettes loxP-URA3-loxP and loxP-LEU2-loxP were amplified from pUG72 and pUG73 respectively [37], using the ORF-specific primers. The mutant lsm4ΔC denotes a partial deletion of 97 C-terminal amino acids of Lsm4 protein [8].

Polysome Profile Analyses

Cells were grown to an OD600 ∼1 and cycloheximide (CYH; Sigma-Aldrich, USA) was added to the culture to a final concentration of 50 µg/ml 5 min before harvesting. Chilled cells were washed in the GA buffer (20 mM Tris-HCl pH 7.5, 50 mM KCl, 10 mM MgCl2, 1 mM DTT, and 5 mM NaF) containing 50 µg/ml CYH. Lysates were prepared in the GA buffer (supplemented with 1 tablet of Complete Mini EDTA-free Protease Inhibitor Mix (Roche, Switzerland)/10 ml of the buffer and 50 µg/ml of cycloheximide) using glass beads in Fastprep Bio101 (Savant Instruments, USA) at speed 5 for 20 s. Lysates were precleared by centrifugation at 826 × g for 5 min and at 13,224 × g for 10 min, and loaded on a 5–45% sucrose gradient. Gradients were ultracentrifuged at 260,500 × g at 4°C for 2.5 h. Fractions were collected from the top and A254 was recorded.

Analyses of Protein Accumulations

Exponentially growing cells were heat-shocked at 46°C for 10 min and harvested. Cells were washed and resuspended in the lysis buffer [9] containing 50 mM Tris-HCl (pH 7.6), 50 mM NaCl, 5 mM MgCl2, 0.1% NP-40, 1 mM β-mercaptoethanol and 1 tablet of Complete Mini EDTA-free Protease Inhibitor Mix (Roche, Switzerland)/10 ml of the buffer. The disruption of cells was carried out twice in a Fastprep Bio101 (Savant Instruments, USA) at speed 4 for 20 s. Cell debris were pelleted at 2,296 × g at 4°C for 10 minutes. The supernatant was centrifuged at 18,000 × g at 4°C for 10 minutes. Resulting pellets and supernatants were analyzed by SDS-PAGE and Western blotting for the presence of GFP-tagged fusion proteins.

Western Blot Analyses

Proteins resolved by SDS-PAGE were transferred to a Protran nitrocellulose membrane (Sigma-Aldrich, USA). The membrane blots were blocked with 3% non-fat milk in TBS-T buffer and incubated overnight with appropriate antibodies. Mouse monoclonal anti-GFP HRP-conjugated antibody (Santa Cruz Biotechnology, USA) was used at 1∶2000. Rabbit polyclonal anti-Sup35 antibody was used at 1∶2000. Donkey anti-rabbit IgG antibody conjugated with a horseradish peroxidase (GE Healthcare; England) was used as a secondary antibody.

Microscopy

The cells were inspected after washing with SC medium, mounting on coverslips and coating with a slice of 1.5% agarose in an appropriate medium. The distribution of various fusion proteins (fused to GFP or RFP or mCherry) was analyzed with a 100x PlanApochromat objective (NA = 1.4) using an Olympus IX-81 inverted microscope equipped with a Hammamatsu Orca/ER digital camera and an Olympus CellR™ detection and analyzing system (GFP filter block U-MGFPHQ, exc. max. 488, em. max. 507; RFP filter block U-MWIY2, exc. max. 545–580, em. max. 610). Images were processed and merged using Olympus CellR™ and Adobe CS5 software. The quantitative co-localization analyses were performed using NIH ImageJ software with the Co-localization Finder plugin, available at http://rsb.info.nih.gov/ij/plugins/. This software was used to determine the Pearson’s correlation coefficient (Rr), which describes the extent of overlap between image pairs. It is a value between −1 and +1, with −1 being no overlap and +1 being perfect overlap of the two images. The time-lapse experiments were done using an ONIX microfluidic perfusion system (Cell Asic Corp., USA; http://www.cellasic.com).

In-gel Digestion and MALDI-TOF Mass Spectrometry

The spots of interest were cut from the CBB-stained SDS–PAGE gels, destained by a mixture of 100 mM ethylmorpholine acetate buffer and acetonitrile (1∶1), and reduced with Tris(2-carboxyethyl)phosphine hydrochloride. Reduced cysteines were then alkylated with 50 mM iodoacetic acid. Gel pieces were washed three times with acetonitrile and water. Trypsin protease was added to the gel in the digestion buffer (50 mM ethylmorpholine acetate buffer, 10% acetonitrile, pH 8.3). After an overnight incubation, tryptic peptides were extracted from the gel by the addition of 80% acetonitrile, 0.1% trifluoroacetic acid. Extracted peptides were desalted using a Peptide Microtrap in the off-line holder (MichromBioresources, USA). Each sample was spotted in one position of the 384-position ground steel MALDI plate (Bruker Daltonics, USA). α-Cyano-4-hydroxycinnamic acid was used as a matrix (Bruker Daltonics). Samples were ionized by matrix-assisted laser desorption ionization (MALDI) using a Dual II ion source (Bruker Daltonics). Mass spectra were acquired in an APEX-Qe Fourier transformation mass spectrometry instrument equipped with a 9.4 T superconducting magnet (Bruker Daltonics). The cell was opened for 4 ms; accumulation time was set to 0.2 s, and one experiment consisted of the average of four spectra. The acquisition data set size was set to 512,000 points, with the mass range starting at m/z 600 atomic mass units. The instrument was externally calibrated using Bruker Daltonics calibration standard II. The spectra were processed by Data Analysis 4.0 software (Bruker Daltonics) and searched with the Mascot search engine (http://www.matrixscience.com) against the data base (UniProt Knowledgebase; http://www.ebi.ac.uk/uniprot) created from all known S. cerevisiae proteins.

Results

Translation Elongation Factor eEF3 (Yef3p) is a Novel Component of Heat-induced SGs of S. cerevisiae

In our previous work, we described that formation of the robust heat shock-induced stress granules (SGs) is promoted by P-bodies in S. cerevisiae [2]. In addition, we also described that these SGs are formed even in the edc3Δlsm4ΔC mutant, which is unable to form visible P-bodies under glucose deprivation [8]. Therefore, we used the edc3Δlsm4ΔC mutant in our recent experiments to identify additional components of SGs in heat-shocked cells. We applied a biochemical approach combined with mass spectrometry analyses. We stressed the exponentially growing edc3Δlsm4ΔC mutant cells either at 42°C or at 46°C for 10 minutes. The protein samples from the heat-shocked cells were prepared by differential centrifugation according to the protocol we used previously [2] and proteins in the pellet were separated by SDS-PAGE. A 116-kD protein appeared to accumulate predominantly in the pellet of the mutant cells heat-shocked at 46°C (Fig. 1A). The protein band was cut out of the gel and subjected to enzymatic digestion in suspension followed by the mass spectrometry analysis, which identified only peptides of the translation elongation factor eEF3 (Yef3p) (Table 2). This result was further confirmed by the Western blot analysis of pelleted proteins prepared by differential centrifugation of the lysate from the wild-type cells expressing Yef3-GFP (Fig. 1B). To perform microscopic analyses of heat-shocked cells, we used either the Yef3-GFP strain from the GFP collection [18] or a newly prepared Yef3-mCherry expressing strain. The distribution of both fusion proteins in wild-type cells was uniformly cytosolic at 30°C (Fig. 1C). They both were accumulated in cytoplasmic foci after heat-shock at 46°C for 10 minutes. In heat-shocked cells harboring the edc3Δlsm4ΔC deletion and the Yef3-GFP fusion, we observed a similar pattern of the fluorescent foci-containing Yef3-GFP as found in wild-type cells (Fig. 1C).
Figure 1

Translation elongation factor eEF3 (Yef3p) accumulates in foci upon robust heat shock.

(A) Pellet fractions from the edc3Δlsm4ΔC cell (CRY1043 strain) lysates taken upon control (30°C) and heat shock (42°C and 46°C) conditions were separated by SDS-PAGE and stained with Coomassie Brilliant Blue. Yef3 protein, identified by MS analysis, is enriched in the pellet fraction from the cells heat-shocked at 46°C for 10 minutes. (B) Pellet and supernatant fractions from the lysates of cells expressing Yef3-GFP (CRY510 strain) were analyzed by SDS-PAGE and Western blotting. Samples were prepared as described elsewhere [2]. The Yef3-GFP fusion protein was accumulated in the pellet fraction of heat-shocked cells. (C) The Yef3 fusions were accumulated at cytoplasmic foci in wild-type cells (CRY510 and CRY1339 strains) as well as in the edc3Δlsm4ΔC mutant cells (CRY1146 strain) heat-shocked at 46°C for 10 minutes. Scale bar 4 µm.

Table 2

MS identification of Yef3 (eEF3) protein.

Identified peptides: sequencestart – end
K.ALLPHLTNAIVETNK.W128–142
R.MPELIPVLSETMWDTKK.E168–184
K.ATETVDNKDIER.F197–208
K.LVEDPQVIAPFLGK.L276–289
K.SNFATIADPEAR.E296–307
K.IVVEYIAAIGADLIDER.I360–376
K.AKDILDEFR.K400–408
K.DILDEFR.K402–408
K.DILDEFRK.R402–409
R.YGICGPNGCGKSTLMR.A459–474
R.YGICGPNGCGKSTLMR.A459–474
R.TVYVEHDIDGTHSDTSVLDFVFESGVGTK.E492–520
K.AYEELSNTDLEFKFPEPGYLEGVK.T637–660
K.FPEPGYLEGVK.T650–660
K.QHAFAHIESHLDK.T738–750
K.TPSEYIQWR.F751–759
R.FQTGEDRETMDR.A760–771
R.IAGIHSR.R797–803
R.IAGIHSRR.K797–804
K.MVAEVDMKEALASGQFRPLTR.K852–872
K.EALASGQFRPLTR.K860–872
K.ALKEFEGGVIIITHSAEFTK.N938–957
K.EFEGGVIIITHSAEFTK.N941–957
K.LSSAELRK.K1014–1021
ORF translation sequence of Yef3 protein:
(matched peptides shown in bold)
MSDSQQSIKVLEELFQKLSVATADNRHEIASEVASFLNGNIIEHDVPEHF
FGELAKGIKDKKTAANAMQAVAHIANQSNLSPSVEPYIVQLVPAICTNAG
NKDKEIQSVASETLISIVNAVNPVAIKALL PHLTNAIVET NKWQEKIAIL
AAISAMVDAAKDQVALRMPE LIPVLSETMW DTKKEVKAAATAAMTKATET
VDNKDIERFIPSLIQCIADPTEVPETVHLLGATTFVAEVTPATLSIMVPL
LSRGLNERETGIKRKSAVIIDNMCKLVEDP QVIAPFLGKLLPGLKSNFAT
IADPEAREVTLRALKTLRRVGNVGEDDAIPEVSHAGDVSTTLQVVNELLK
DETVAPRFKI VVEYIAAIGA DLIDERIIDQQAWFTHITPYMTIFLHEKKA
KDILDEFRKRAVDNIPVGPNFDDEEDEGEDLCNCEFSLAYGAKILLNKTQ
LRLKRARRYG ICGPNGCGKS TLMRAIANGQVDGFPTQEECRTVYVEHDID
GTHSDTSVLD FVFESGVGTK EAIKDKLIEFGFTDEMIAMPISALSGGWKM
KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTCGITSITISHDS
VFLDNVCEYIINYEGLKLRKYKGNFTEFVKKCPAAKAYEE LSNTDLEFKF
PEPGYLEGVK TKQKAIVKVTNMEFQYPGTSKPQITDINFQCSLSSRIAVI
GPNGAGKSTLINVLTGELLPTSGEVYTHENCRIAYIKQHA FAHIESHLDK
TPSEYIQWRF QTGEDRETMD RANRQINENDAEAMNKIFKIEGTPRRIAGI
HSRRKFKNTYEYECSFLLGENIGMKSERWVPMMSVDNAWIPRGELVESHS
KMVAEVDMKE ALASGQFRPL TRKEIEEHCSMLGLDPEIVSHSRIRGLSGG
QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALK EFEGGVIIIT
HSAEFTKNLTEEVWAVKDGRMTPSGHNWVSGQGAGPRIEKKEDEEDKFDA
MGNKIAGGKKKKKLSSAELR KKKKERMKKKKELGDAYVSSDEEF

Translation elongation factor eEF3 (Yef3p) accumulates in foci upon robust heat shock.

(A) Pellet fractions from the edc3Δlsm4ΔC cell (CRY1043 strain) lysates taken upon control (30°C) and heat shock (42°C and 46°C) conditions were separated by SDS-PAGE and stained with Coomassie Brilliant Blue. Yef3 protein, identified by MS analysis, is enriched in the pellet fraction from the cells heat-shocked at 46°C for 10 minutes. (B) Pellet and supernatant fractions from the lysates of cells expressing Yef3-GFP (CRY510 strain) were analyzed by SDS-PAGE and Western blotting. Samples were prepared as described elsewhere [2]. The Yef3-GFP fusion protein was accumulated in the pellet fraction of heat-shocked cells. (C) The Yef3 fusions were accumulated at cytoplasmic foci in wild-type cells (CRY510 and CRY1339 strains) as well as in the edc3Δlsm4ΔC mutant cells (CRY1146 strain) heat-shocked at 46°C for 10 minutes. Scale bar 4 µm. To investigate whether these Yef3-containing foci were identical to previously identified heat-induced SGs, we prepared a new strain co-expressing Yef3-GFP together with the stress granule marker Rpg1-RFP. We observed that both proteins co-localized in SGs of heat-shocked cells (Fig. 2A). Very high values of the Pearsońs correlation coefficient (Rr), over 0.9, confirmed the high degree of this co-localization. Similar results were obtained in experiments with the strains co-expressing Yef3-mCherry and other constituents of heat-induced SGs, Ngr1-GFP or Dcp2-GFP proteins (Fig. 2B). The presence of the Yef3 protein accumulations in heat-shocked cells of the gcn2Δ mutant indicated that their assembly is also independent of the eIF2α factor phosphorylation, as we reported previously for accumulations of eIF3a (Rpg1p/Tif32p) [2] (Fig. 2C). We conclude that the translation elongation factor eEF3 (Yef3p) is a novel component of the heat-induced SGs in S. cerevisiae.
Figure 2

Heat shock-induced stress granules contain translation elongation factor eEF3 (Yef3p).

(A) The distribution of fusion proteins Yef3-GFP and Rpg1-RFP (CRY649 strain) was uniformly cytosolic at 30°C. Accumulations of Yef3-GFP fusion protein completely co-localized with accumulations of the stress granule marker protein Rpg1-GFP in cells heat-shocked at 46°C for 10 minutes. The Scatter plot produced by colocalization analysis software shows colocalized pixels along the diagonal. Very high values of the Pearsońs correlation coefficient (Rr), over 0.9, confirmed the high degree of this co-localization. (B) Localization of theYef3-mCherry fusion protein with Ngr1-GFP (CRY1287 strain) and Dcp2-GFP (CRY1559 strain) fusion proteins under control conditions (30°C) and in heat-shocked cells at 46°C for 10 minutes. Yef3-mCherry protein co-localized with heat-induced accumulations of stress granules marker proteins Dcp2-GFP and Ngr1-GFP. (C) Yef3-GFP accumulates in cytoplasmic foci in both, wild-type (CRY510 strain) and gcn2Δ (CRY1292 strain), cells heat-shocked at 46°C. Scale bar 4 µm.

Heat shock-induced stress granules contain translation elongation factor eEF3 (Yef3p).

(A) The distribution of fusion proteins Yef3-GFP and Rpg1-RFP (CRY649 strain) was uniformly cytosolic at 30°C. Accumulations of Yef3-GFP fusion protein completely co-localized with accumulations of the stress granule marker protein Rpg1-GFP in cells heat-shocked at 46°C for 10 minutes. The Scatter plot produced by colocalization analysis software shows colocalized pixels along the diagonal. Very high values of the Pearsońs correlation coefficient (Rr), over 0.9, confirmed the high degree of this co-localization. (B) Localization of theYef3-mCherry fusion protein with Ngr1-GFP (CRY1287 strain) and Dcp2-GFP (CRY1559 strain) fusion proteins under control conditions (30°C) and in heat-shocked cells at 46°C for 10 minutes. Yef3-mCherry protein co-localized with heat-induced accumulations of stress granules marker proteins Dcp2-GFP and Ngr1-GFP. (C) Yef3-GFP accumulates in cytoplasmic foci in both, wild-type (CRY510 strain) and gcn2Δ (CRY1292 strain), cells heat-shocked at 46°C. Scale bar 4 µm.

SGs also Contain Translation Factors eEF1Bγ2 (Tef4p), eRF1 (Sup45p) and eRF3 (Sup35p)

Since we found that heat-induced SGs contain the translation elongation factor eEF3, we wanted to know whether other translation factors are also present. Using the strains from the GFP collection [18], we analyzed the distribution of some other translation factors and found that the elongation factor eEF1Bγ2 (Tef4p) together with the termination factors eRF3 (Sup35p) and eRF1 (Sup45p) also accumulate in distinct cytoplasmic foci under heat shock at 46°C (Fig. 3A). Other microscopic analyses using the particular strains from the GFP collection [18] revealed that other translation factors, elongation factor eEF1A (Tef1p), elongation factor eEF2 (Eft1p) and initiation factor eIF1A (Tif11p), remained uniformly cytosolic when the robust heat shock was applied (Fig. 3B).
Figure 3

Factors eEF1Bγ2 (Tef4p), eRF1 (Sup45p) and eRF3 (Sup35p) are novel components of stress granules.

(A) The distribution of Tef4-GFP (CRY554 strain), Sup35-GFP (CRY412 strain) and Sup45-GFP (CRY1552 strain) proteins was analyzed in control (30°C) and heat-shocked (46°C) cells. All of these fusion proteins accumulated in discrete cytoplasmic foci in heat-shocked cells. (B) Subcellular localization of Eft1-GFP (eEF2) (CRY552 strain), Tif11-GFP (eIF1A) (CRY521 strain) and Tef1-GFP (eEF1A) (CRY1764 strain) fusion proteins upon control and heat shock conditions. The distribution of Eft1-GFP, Tif11-GFP and Tef1-GFP remained diffusely cytosolic even upon the stress condition. (C) Tef4-GFP fusion protein co-localized with accumulations of the Yef3-mCherry fusion protein (CRY1315 strain). Similarly, Sup35-GFP and Sup45-GFP co-localized with the stress granule marker protein Rpg1-RFP in cells heat-shocked at 46°C for 10 minutes (strains CRY1364; CRY1627 strains). High values of the Pearsońs correlation coefficient (Rr) confirmed the high degree of this co-localization. Scale bar 4 µm. (D) Pellet and supernatant fractions from the appropriate cell lysates (strains CRY554; CRY412; CRY1552 strains) were analyzed by SDS-PAGE and Western blotting. Samples were prepared as described elsewhere [2]. All tested fusion proteins were clearly accumulated in the pellet fraction of cells heat-shocked at 46°C for 10 minutes.

Factors eEF1Bγ2 (Tef4p), eRF1 (Sup45p) and eRF3 (Sup35p) are novel components of stress granules.

(A) The distribution of Tef4-GFP (CRY554 strain), Sup35-GFP (CRY412 strain) and Sup45-GFP (CRY1552 strain) proteins was analyzed in control (30°C) and heat-shocked (46°C) cells. All of these fusion proteins accumulated in discrete cytoplasmic foci in heat-shocked cells. (B) Subcellular localization of Eft1-GFP (eEF2) (CRY552 strain), Tif11-GFP (eIF1A) (CRY521 strain) and Tef1-GFP (eEF1A) (CRY1764 strain) fusion proteins upon control and heat shock conditions. The distribution of Eft1-GFP, Tif11-GFP and Tef1-GFP remained diffusely cytosolic even upon the stress condition. (C) Tef4-GFP fusion protein co-localized with accumulations of the Yef3-mCherry fusion protein (CRY1315 strain). Similarly, Sup35-GFP and Sup45-GFP co-localized with the stress granule marker protein Rpg1-RFP in cells heat-shocked at 46°C for 10 minutes (strains CRY1364; CRY1627 strains). High values of the Pearsońs correlation coefficient (Rr) confirmed the high degree of this co-localization. Scale bar 4 µm. (D) Pellet and supernatant fractions from the appropriate cell lysates (strains CRY554; CRY412; CRY1552 strains) were analyzed by SDS-PAGE and Western blotting. Samples were prepared as described elsewhere [2]. All tested fusion proteins were clearly accumulated in the pellet fraction of cells heat-shocked at 46°C for 10 minutes. To co-localize Tef4, Sup45 and Sup35 heat-induced foci with SGs, we prepared a strain co-expressing Tef4-GFP and Yef3-mCherry fusion proteins and strains co-expressing Sup45-GFP or Sup35-GFP fusion proteins together with the stress granule marker Rpg1-RFP. As shown in Fig. 3C, there is a near-perfect overlap of accumulated Tef4-GFP and Yef3-mCherry fusion proteins upon robust heat shock. Similarly, Sup35-GFP or Sup45-GFP significantly overlapped with the accumulated Rpg1-RFP in heat-shocked cells (Fig. 3C). In addition, similar results were obtained in the strains co-expressing either Sup45-GFP and Dcp2-mCherry or Sup45-GFP and Ngr1-mCherry fusions (Fig. S1). Changes in the subcellular distribution of Tef4-GFP, Sup35-GFP and Sup45-GFP fusion proteins upon robust heat shock were confirmed by SDS-PAGE and the Western blot analysis of samples prepared by differential centrifugation (Fig. 3D). In agreement with the results of microscopic analyses, the tested proteins were found to be enriched in the pellet fraction of heat-shocked cells. We thus established eEF1γ2 (Tef4p), eRF1 (Sup45p) and eRF3 (Sup35p) factors to be novel constituents of SGs induced by robust heat shock in S. cerevisiae.

The N-terminal Prion-like Domain of Sup35 Protein is not Involved in SGs Assembly

As described above, we identified the translation termination factor eRF3 (Sup35p) as a constituent of SGs induced by robust heat shock at 46°C. Interestingly, this protein belongs to known yeast prion proteins and its N-terminal part is indispensable for [PSI+] prion formation and maintenance [38], [39]. Since some proteins with prion-like domains have been referred to as affecting development of SGs in mammalian cells [40], we wanted to understand whether the prion-induction domain of Sup35 protein affects accumulation of Rpg1/eIF3a, the SGs marker protein. We constructed the strain expressing only the essential C-terminal part of Sup35 protein together with Rpg1-GFP. As a control, we used the strain of the same genetic background co-expressing the wild-type form of Sup35p and the Rpg1-GFP fusion protein. We observed Rgp1-GFP accumulated in SGs of both, wild-type and the mutant cells heat-shocked at 46°C for 10 minutes (Fig. 4A) suggesting that assembly of heat-induced SGs does not require the N-terminal part of Sup35 protein. In addition, using differential centrifugation followed by SDS-PAGE and Western blotting we observed that even in the absence of the Sup35 N-terminal domain the truncated protein was still accumulated in SGs of the cells heat-shocked at 46°C (Fig. 4B). This indicates that the full length Sup35 protein can be accumulated in SGs in a non-prion form. We conclude that the prion-induction domain of Sup35 protein is not necessary for SG assembly and the C-terminal part of this protein is sufficient to recruit the whole Sup35 protein to SGs.
Figure 4

Full length Sup35 protein is not necessary for SGs assembly and its localization into SGs.

(A) The distribution of Rpg1-GFP fusion protein under control (30°C) and heat shock (46°C) conditions in either the wild-type strain (Sup35p; CRY1011 strain) or the strain expressing only the N-terminal truncated form of Sup35 protein (Sup35ΔN; CRY1007 strain). SGs (Rpg1-GFP) were formed even in the mutant strain suggesting that the N-terminal part of Sup35 protein is dispensable for the SGs formation. Scale bar 4 µm. (B) Pellet and supernatant fractions from the wild-type (CRY998 strain) and the Sup35 N-terminal truncated mutant strains (CRY1001 strain) were analyzed by SDS-PAGE and Western blotting using the anti-Sup35 antibody. Samples were prepared as described elsewhere [2]. The N-terminal truncated form of Sup35 protein was enriched in the pellet fraction of heat-shocked cells, as well as the wild-type form of Sup35 protein, suggesting that only Sup35 C-terminal part is sufficient to localize this protein to the heat-induced stress granules.

Full length Sup35 protein is not necessary for SGs assembly and its localization into SGs.

(A) The distribution of Rpg1-GFP fusion protein under control (30°C) and heat shock (46°C) conditions in either the wild-type strain (Sup35p; CRY1011 strain) or the strain expressing only the N-terminal truncated form of Sup35 protein (Sup35ΔN; CRY1007 strain). SGs (Rpg1-GFP) were formed even in the mutant strain suggesting that the N-terminal part of Sup35 protein is dispensable for the SGs formation. Scale bar 4 µm. (B) Pellet and supernatant fractions from the wild-type (CRY998 strain) and the Sup35 N-terminal truncated mutant strains (CRY1001 strain) were analyzed by SDS-PAGE and Western blotting using the anti-Sup35 antibody. Samples were prepared as described elsewhere [2]. The N-terminal truncated form of Sup35 protein was enriched in the pellet fraction of heat-shocked cells, as well as the wild-type form of Sup35 protein, suggesting that only Sup35 C-terminal part is sufficient to localize this protein to the heat-induced stress granules.

Translation Elongation Factor eEF3 (Yef3p) Accumulates in RNP Complexes Even at 42°C

Despite the fact that eEF3 factor (Yef3p) was not significantly enriched in the pellet fraction of the cells heat-shocked at 42°C (see Fig. 1A), we also analyzed the distribution of this protein by fluorescence microscopy under these stress conditions. Surprisingly, Yef3-GFP or Yef3-mCherry accumulated in cytoplasmic foci even upon heat shock at 42°C (Fig. 5A). It should be noted that Yef3-mCherry fusion protein forms fewer granules in comparison to Yef3-GFP protein under heat shock at 42°C. The accumulations of eEF3 (Yef3-GFP) after heat shock at 42°C for 10 minutes were transient and dissolved after releasing cells from the stress conditions (Fig. 5B).
Figure 5

Translation elongation and termination factors accumulate in the same foci at 42

°C. (A) The distribution of Yef3-GFP or Yef3-mCherry fusion protein was analyzed in wild-type cells (CRY510 strain: CRY1339 strain) heat-shocked at 42°C for 10 minutes. Whereas the Yef3-GFP and Yef3-mCherry fusion protein were uniformly cytosolic at 30°C, they formed discrete cytoplasmic foci in the cells heat-shocked at 42°C for 10 minutes. (B) Distribution of the Yef3-GFP protein (CRY510 strain) was analyzed in control, heat-shocked (at 42°C) and recovering cells. Yef3-GFP accumulations were dissolved within 20 minutes of the cell recovery from the stress. (C) The distribution of Sup35-GFP (CRY412 strain), Sup45-GFP (CRY1552 strain) and Tef4-GFP (CRY554 strain) was analyzed under control conditions at 30°C and under heat shock at 42°C. Whereas Sup35-GFP protein remained uniformly cytosolic even upon the heat shock at 42°C, Sup45-GFP and Tef4-GFP proteins accumulated into discrete cytoplasmic foci (D) Yef3-mCherry fusion protein was co-localized either with Tef4-GFP (CRY1315 strain), Dcp2-GFP (CRY1559 strain) or Ngr1-GFP (CRY1287 strain) fusion proteins, as well as Sup45-GFP fusion protein was co-localized with Dcp2-mCherry fusion protein (CRY1636 strain), in cells heat-shocked at 42°C.

Translation elongation and termination factors accumulate in the same foci at 42

°C. (A) The distribution of Yef3-GFP or Yef3-mCherry fusion protein was analyzed in wild-type cells (CRY510 strain: CRY1339 strain) heat-shocked at 42°C for 10 minutes. Whereas the Yef3-GFP and Yef3-mCherry fusion protein were uniformly cytosolic at 30°C, they formed discrete cytoplasmic foci in the cells heat-shocked at 42°C for 10 minutes. (B) Distribution of the Yef3-GFP protein (CRY510 strain) was analyzed in control, heat-shocked (at 42°C) and recovering cells. Yef3-GFP accumulations were dissolved within 20 minutes of the cell recovery from the stress. (C) The distribution of Sup35-GFP (CRY412 strain), Sup45-GFP (CRY1552 strain) and Tef4-GFP (CRY554 strain) was analyzed under control conditions at 30°C and under heat shock at 42°C. Whereas Sup35-GFP protein remained uniformly cytosolic even upon the heat shock at 42°C, Sup45-GFP and Tef4-GFP proteins accumulated into discrete cytoplasmic foci (D) Yef3-mCherry fusion protein was co-localized either with Tef4-GFP (CRY1315 strain), Dcp2-GFP (CRY1559 strain) or Ngr1-GFP (CRY1287 strain) fusion proteins, as well as Sup45-GFP fusion protein was co-localized with Dcp2-mCherry fusion protein (CRY1636 strain), in cells heat-shocked at 42°C. We also analyzed distribution of other newly identified components of SGs, e.g. Tef4, Sup45 and Sup35 proteins, upon the heat shock at 42°C. Despite we did not see accumulation of Sup35-GFP, we were able to observe formation of visible assemblies of Tef4-GFP and Sup45-GFP under these stress conditions (Fig. 5C). Subsequent microscopic analyses of strains co-expressing Tef4-GFP with Yef3-mCherry, Dcp2-GFP with Yef3-mCherry, Sup45-GFP with Dcp2-mCherry and Ngr1-GFP with Yef3-mCherry from the chromosomal sites confirmed that all these proteins co-localized in distinct foci in cells heat-shocked at 42°C for 10 minutes (Fig. 5D). Similar results were obtained for the strains co-expressing Ngr1-GFP with Dcp2-mCherry and Pub1-GFP with Dcp2-RFP fusion proteins (data not shown). To determine whether the Yef3-containing foci formed at 42°C comprise mRNA, we used the PGK1 mRNA/U1A-GFP detection reporter system [9]. Initially, we observed that fine granules of PGK1 mRNA (U1A-GFP) were present even under control temperature in a majority of cells. The heat shock at 42°C induced accumulation of some of these granules into larger clusters. We observed co-localization of the PGK1 mRNA (U1A-GFP) clusters with accumulations of Yef3-mCherry fusion protein under these heat shock conditions (Fig. 6A). We used the “Co-localization Finder” plugin (ImageJ) to express statistically the overlaps. The value of the Pearson’s correlation coefficient (Rr) for both cultures about 0.5 indicates co-localization, but also means that there is always a portion of Yef3 translation elongation factor which is not directly associated with the mRNA-U1A-GFP and vice versa. We supposed that the translation polysome profiles of the heat-shocked cells would be altered at 42°C. Indeed, as shown in Fig. 6B, the polysomal fraction was smaller and the 80S peak enlarged for cells heat-shocked at 42°C comparing the polysome profile of non-stressed cells. This suggested that mRNA molecules leave the active translation cycle and accumulate in cytoplasmic Yef3-containing RNP complexes. To support these results, we performed experiments in which mRNA was trapped in polysomes after cycloheximide (CYH) pretreatment. As expected, Yef3-containing accumulations were not assembled in cells pretreated with CYH and heat-shocked at 42°C for 10 minutes (Fig. 6C). This confirms that free mRNA outside the ribosome (polysome) is a prerequisite for the formation of RNP accumulations upon heat shock at 42°C.
Figure 6

Heat shock at 42°C alters translation and triggers accumulation of mRNA in Yef3 foci.

(A) Distribution of PGK1 mRNA (PGK1 mRNA/U1A-GFP reporter system) at 30°C or upon heat shock at 42°C was analyzed in cells expressing Yef3-mCherry fusion protein (CRY1618 strain). Fine granules of PGK1 mRNA (U1A-GFP) were present at 30°C in a majority of cells. The heat shock at 42°C induced an accumulation of some of these granules into larger clusters and formations of Yef3 foci. Arrows point to obviously overlapping signals of both fusions. Scale bar 4 µm. (B) Polysome profiles of wild-type strain (BY4741) at permissive temperature and after heat shock at 42°C for 10 minutes. Translation profile was altered in heat-shocked cells. P/M stands for polysome/monosome ratio. (C) Distribution of Yef3-GFP (CRY510 strain) was analyzed in cells heat-shocked at 42°C for 10 minutes with or without preincubation in the presence of cycloheximide (CYH). When this drug was added before the heat shock, no accumulations of Yef3-GFP protein were formed. Scale bar 4 µm.

Heat shock at 42°C alters translation and triggers accumulation of mRNA in Yef3 foci.

(A) Distribution of PGK1 mRNA (PGK1 mRNA/U1A-GFP reporter system) at 30°C or upon heat shock at 42°C was analyzed in cells expressing Yef3-mCherry fusion protein (CRY1618 strain). Fine granules of PGK1 mRNA (U1A-GFP) were present at 30°C in a majority of cells. The heat shock at 42°C induced an accumulation of some of these granules into larger clusters and formations of Yef3 foci. Arrows point to obviously overlapping signals of both fusions. Scale bar 4 µm. (B) Polysome profiles of wild-type strain (BY4741) at permissive temperature and after heat shock at 42°C for 10 minutes. Translation profile was altered in heat-shocked cells. P/M stands for polysome/monosome ratio. (C) Distribution of Yef3-GFP (CRY510 strain) was analyzed in cells heat-shocked at 42°C for 10 minutes with or without preincubation in the presence of cycloheximide (CYH). When this drug was added before the heat shock, no accumulations of Yef3-GFP protein were formed. Scale bar 4 µm. We published earlier [2] that formation of heat-induced SGs and translation arrest accompanying robust heat shock are independent of Gcn2 kinase. In accordance with these findings, we observed that formation of Yef3-containing foci at 42°C and the alteration of polysome profile seen at 42°C are also Gcn2 independent (Fig. S2).

Accumulations of RNP Complexes Formed at 42°C Determine Sites for SGs Assembled at 46°C

To analyze the RNP accumulations formed at 42°C in detail, we used the edc3Δlsm4ΔC mutant, which is unable to form visible P-bodies [8]. We prepared appropriate edc3Δlsm4ΔC mutant strains expressing GFP fusion variants of some proteins found to accumulate in joint assemblies under heat shock at 42°C (see above), e.g. Yef3p, Dcp2p, Ngr1p and Pub1p. We found that in contrast to wild-type cells, the edc3Δlsm4ΔC mutant did not exhibit any accumulations of the Dcp2-GFP fusion protein under control conditions at 30°C or upon heat shock at 37°C (Fig. 7A). These cells only displayed the Dcp2-GFP signal in the nuclear region. However, the mutant cells displayed distinct accumulations of Dcp2-GFP under heat shock at 42°C. We conclude that these Dcp2-GFP accumulations at 42°C do not depend on P-bodies scaffolding proteins Edc3 and Lsm4. Interestingly, we found that also accumulations of other proteins Ngr1-GFP, Pub1-GFP and Yef3-GFP at 42°C was independent on Edc3 and Lsm4 proteins (Fig. 7B). The distribution pattern of these protein accumulations in the mutant was similar to that of wild-type cells. We conclude that Dcp2-containing accumulations at 42°C, similarly to other components of SGs, do not require P-bodies scaffolding proteins.
Figure 7

RNP accumulations formed at 42°C serve as “seeds” for genuine SGs.

(A) Distribution of Dcp2-GFP was analyzed in wild-type (CRY564 strain) and edc3Δlsm4ΔC mutant (CRY977 strain) cells after incubation at 30°C, 37°C and 42°C for 10 minutes. These wild-type cells exhibited increasing number of enlarged accumulations of the Dcp2-GFP fusion protein corresponding to raising temperatures of the heat shock. In contrast, edc3Δlsm4ΔC mutant cells did not exhibit any cytoplasmic accumulations of the Dcp2-GFP fusion protein upon incubation at 30°C or 37°C. However, these mutant cells displayed accumulations of Dcp2-GFP upon heat shock at 42°C for 10 minutes. (B) The distribution of fusion proteins Pub1-GFP, Ngr1-GFP and Yef3-GFP was analyzed in edc3Δlsm4ΔC mutant cells (CRY1035, CRY1041 and CRY1146 strains) either at 30°C or upon heat shock at 42°C for 10 minutes. All of these proteins accumulated in the mutant cells at 42°C, thus independently of P-body scaffolding proteins Edc3 and Lsm4. (C) Time lapse experiment using the cells co-expressing Yef3-GFP and Rpg1-RFP fusion proteins (CRY649 strain) showing the formation of Yef3-GFP foci after 10 minutes at 42°C, accumulation of Rpg1-RFP protein during the temperature rise from 42°C to 46°C and after 10 minutes at 46°C. Yef3-GFP foci were first formed at 42°C, whereas the localization of the Rpg1-RFP protein was still uniformly cytoplasmic at this temperature. During heating from 42°C to 46°C and upon cultivation at 46°C, the Rpg1-RFP protein only accumulated at the preformed Yef3-GFP foci. Scale bar 4 µm.

RNP accumulations formed at 42°C serve as “seeds” for genuine SGs.

(A) Distribution of Dcp2-GFP was analyzed in wild-type (CRY564 strain) and edc3Δlsm4ΔC mutant (CRY977 strain) cells after incubation at 30°C, 37°C and 42°C for 10 minutes. These wild-type cells exhibited increasing number of enlarged accumulations of the Dcp2-GFP fusion protein corresponding to raising temperatures of the heat shock. In contrast, edc3Δlsm4ΔC mutant cells did not exhibit any cytoplasmic accumulations of the Dcp2-GFP fusion protein upon incubation at 30°C or 37°C. However, these mutant cells displayed accumulations of Dcp2-GFP upon heat shock at 42°C for 10 minutes. (B) The distribution of fusion proteins Pub1-GFP, Ngr1-GFP and Yef3-GFP was analyzed in edc3Δlsm4ΔC mutant cells (CRY1035, CRY1041 and CRY1146 strains) either at 30°C or upon heat shock at 42°C for 10 minutes. All of these proteins accumulated in the mutant cells at 42°C, thus independently of P-body scaffolding proteins Edc3 and Lsm4. (C) Time lapse experiment using the cells co-expressing Yef3-GFP and Rpg1-RFP fusion proteins (CRY649 strain) showing the formation of Yef3-GFP foci after 10 minutes at 42°C, accumulation of Rpg1-RFP protein during the temperature rise from 42°C to 46°C and after 10 minutes at 46°C. Yef3-GFP foci were first formed at 42°C, whereas the localization of the Rpg1-RFP protein was still uniformly cytoplasmic at this temperature. During heating from 42°C to 46°C and upon cultivation at 46°C, the Rpg1-RFP protein only accumulated at the preformed Yef3-GFP foci. Scale bar 4 µm. The similarity of RNP accumulations formed at 42°C to SGs formed at 46°C indicated that they are structurally related. We performed a time-lapse experiment using the strain co-expressing Yef3-GFP with the SGs marker protein Rpg1-RFP (Fig. 7C). The cells were pre-heated to 42°C and then continuously heated up to 46°C. The Yef3-GFP fusion protein was accumulated during the initial cultivation at 42°C and also later on. In contrast, the Rpg1-RFP fusion protein began to accumulate around Yef3-GFP foci only after raising the temperature above 42°C, with most focused accumulations being observed at 46°C. We conclude that the RNP accumulations formed at 42°C serve as “seeds” for genuine SGs assembled upon robust heat shock at 46°C.

Translation Initiation Factor eIF2α Subunit is Recruited to Heat-induced SGs Upon a Stress Relief

In contrast to P-bodies, the composition of SGs suggests that SGs might be sites where translation initiates during the cell recovery from a stress. In our previous work [2], we described that α subunit of the translation initiation factor eIF2 (Sui2p) is not a constituent of the robust heat shock-induced SGs in S. cerevisiae. Here we analyzed distribution of the Sui2 protein in cells recovering from the heat shock using a strain co-expressing Sui2-GFP fusion protein with the stress granule marker Rpg1-RFP. In contrast to the cells heat-shocked at 46°C, where distribution of Sui2-GFP was uniformly cytosolic, the cells recovering from the heat shock displayed accumulations of Sui2-GFP overlapping with dissolving SGs (Rpg1-RFP) (Fig. 8A).
Figure 8

Sui2p associates with dissolving SGs in cells recovering from the heat shock.

(A) The localization of fusion proteins Sui2-GFP and Rpg1-RFP was analyzed in cells (CRY1332 strain) cultivated at 30°C or heat-shocked at 46°C for 10 minutes or cultivated after heat shock for additional 10 minutes. Sui2-RFP protein was not accumulated in stress granules (Rpg1-GFP) of heat-shocked cells (single arrow). Sui2 protein began to accumulate with stress granules during the cell recovery phase after cultivation of the heat-shocked cells at 30°C for additional 10 minutes (double arrows). (B) The same situation as in (A), but in the gcn2Δ strain (CRY1691 strain). Scale bar 4 µm.

Sui2p associates with dissolving SGs in cells recovering from the heat shock.

(A) The localization of fusion proteins Sui2-GFP and Rpg1-RFP was analyzed in cells (CRY1332 strain) cultivated at 30°C or heat-shocked at 46°C for 10 minutes or cultivated after heat shock for additional 10 minutes. Sui2-RFP protein was not accumulated in stress granules (Rpg1-GFP) of heat-shocked cells (single arrow). Sui2 protein began to accumulate with stress granules during the cell recovery phase after cultivation of the heat-shocked cells at 30°C for additional 10 minutes (double arrows). (B) The same situation as in (A), but in the gcn2Δ strain (CRY1691 strain). Scale bar 4 µm. To analyze whether accumulation of Sui2-GFP on SGs during the recovery from the stress is dependent on a phosphorylation status of Sui2p, we used a new strain carrying Sui2-GFP and Rpg1-RFP proteins together with the gcn2 deletion. We found that Sui2-GFP accumulated on dissolving SGs even in the absence of the Gcn2 kinase (Fig. 8B). It means that Sui2p accumulated on SGs is present also in its non-phosphorylated form, thus translation competent. Our data thus support the hypothesis that SGs serve as sites to initiate translation after a stress relief.

Discussion

It is widely accepted that stress granules (SGs) are composed of stalled translation preinitiation complexes (48S) containing mRNA, small ribosomal subunits and some translation initiation factors [15], [41]. Here we provide evidence that the heat-induced SGs formed at 46°C in S. cerevisiae also contain certain translation elongation and translation termination factors. Some of them, elongation factors eEF3 and eEF1Bγ2 and the termination factor eRF1 accumulate already at 42°C on Dcp2 foci independently of P-bodies scaffolding proteins. We also showed, on the example of eEF3 factor, that an accumulation of the protein at 42°C is independent on the Gcn2 kinase activity. However, these foci still determine sites for assembly of SGs upon heat shock at 46°C. Our data suggest that assembly of these SGs might be controlled by translation elongation and termination factors released from ongoing translation. Furthermore, recruitment of the key translation initiation factor eIF2α (Sui2p) to dissolving SGs points to the recovery of translation at these sites after stress relief. Although SGs are referred to as stalled translation preinitiation complexes, it is generally accepted that the composition of SGs varies depending on organisms and cell types, as well as on intensity and type of the stress [42]. For example, SGs induced by a high concentration of ethanol in S. cerevisiae contain only the eIF3c/Nip1 subunit of the eIF3 complex [3] and SGs induced by a prolonged glucose deprivation do not harbor the eIF3 complex at all [1]. With respect to the intensity of the stress, treatment with a low concentration of NaN3 does not affect the distribution of eIF3a (Rpg1p/Tif32p) [2] but at higher concentration this drug induces eIF3a accumulation in SGs [17]. We show here that SGs induced by the robust heat shock in S. cerevisiae contain translation elongation factors eEF3 (Yef3p) and eEF1Bγ2 (Tef4p) together with translation termination factors eRF1 (Sup45p) and eRF3 (Sup35p). These factors have never been observed in SGs of any other eukaryotic cell. However, the termination factors have been found to accumulate in P-bodies [1], [43]. Those authors have concluded that presence of translation termination factors in P-bodies is coupled to the P-bodies assembly. A similar role could be suggested for presence of these factors in heat-induced SGs. The proteins with self-aggregation (prion-like) domain, like TIA-1 or TIAR in mammalian cells, have been described to influence dynamics of SGs [40]. A newly identified component of the heat-induced SGs in S.cerevisiae, Sup35p, possesses a prion-like domain at the N-terminus. Sup35p can thus convert into the prion form, known as [PSI+]. The N-terminal part of the protein is indispensable for the prion formation and maintenance [38], [39]. Similarly to a situation in mammalian cells [40] we found that rather a non-prion part of Sup35p is responsible for accumulation of the protein in SGs. However, observations that SGs are formed even in the absence of the N-terminal prion-like domain of Sup35p indicate that unlike in mammals, the assembly of heat-induced SGs in S. cerevisiae is not driven by these “prion” structural elements. This hypothesis is also supported by our earlier findings that heat-induced SGs are formed even in the absence of yeast orthologs of mammalian TIA-1 and TIAR proteins, Ngr1 and Pub1 proteins in S. cerevisiae [2]. Translation termination factors eRF1 (Sup45p) and eRF3 (Sup35p) are responsible for effective termination of translation [44]. In addition, they seem to be required for an effective function of the fungal-specific elongation factor eEF3 (Yef3p) [45] in recycling of the translation posttermination complexes after the release of newly synthetized peptide chains [46], [47]. In this respect, identification of elongation and termination factors in heat-induced SGs may indicate that these SGs are composed of translation posttermination complexes stalled before the ribosome recycling step. However, we did not observe any accumulation of several essential proteins of the 60S ribosomal subunits under robust heat shock [2] and Grousl et al. (unpublished data). In addition, all the published information on recycling of the translation posttermination complexes comes from in vitro experiments only. Therefore, it is currently unclear, how recycling is catalyzed in vivo and the reasons for presence of the translation elongation and the termination factors in robust heat shock-induced SGs remain to be elucidated. Whereas different roles for SGs and P-bodies in cell survival upon heat stress conditions could be suggested, both accumulations are always closely spatially and functionally intertwined. In S. cerevisiae cells, P-bodies promote formation of SGs [1], [2]. The assembly of P-bodies is connected with changes in expression profiles and adaptation to changed environmental conditions, when the translation of certain transcripts is inhibited and, on the other hand, the translation of new transcripts is induced [11]. They are present in cells even under non-stress conditions and they enlarge under various stresses, such as a heat shock at 39°C [21] and 42°C [48]. However, one of the major components of P-bodies, Dcp2p that is engaged in mRNA decapping [5], [9], [10], is also a component of the robust heat shock-induced SGs, which may form independently of the P-bodies scaffolding proteins Edc3 and Lsm4 [2]. On the contrary to glucose-deprived cells [1], [8] and cells heat-shocked at 37°C, we show here that Dcp2 foci formed in cells heat-shocked at 42°C do not depend on these scaffolds. These Dcp2 accumulations do not contain translation initiation factors and still serve as sites for assembly of SGs upon continuous and more robust heat stress. They might be considered as “premature SGs”, as well as Dcp2-containing structures related to P-bodies. The stress-induced phosphorylation of translation initiation factor eIF2α is the best characterized mechanism of stress granule assembly [14], [15]. However, there are other ways, how to induce SGs or influence their dynamics. Apart influencing other translation initiation factors, they concern the metabolism of polyamines or hexosamines and the stress-induced tRNA derivates [29], [31], [49], [50]. Moreover, since eIF2α-phosphorylation independent mechanisms of SGs assembly prevail in lower eukaryotes, it seems that these are evolutionary older. We show here that accumulations of translation elongation factor eEF3 (Yef3p) on Dcp2 foci at 42°C precede assembly of eIF3-containing SGs in cells heat-shocked at 46°C. This suggests that the translation elongation phase is affected first in the stressed cells. It is conceivable that there might be a shortage of the eEF3 factor due to its sequestration into cytoplasmic foci at 42°C. This may cause an alteration of kinetics of the translation elongation, which results in a deceleration of translation initiation. Such regulation of translation at the elongation step has also been proposed as a possible function of the Stm1 protein, which is able to stall ribosomes after the 80S complex formation in vitro and to promote decapping of a subset of mRNA [51]. Moreover, Stm1p has been shown to regulate interaction of eEF3 factor with ribosomes and to play a complementary role to eEF3 in translation under nutrient stress conditions [52]. Interestingly, we did not observe an accumulation of Stm1-GFP fusion protein neither upon heat shock at 42°C nor under heat shock at 46°C (Figure S3). Additionally, we did not see any effect of the stm1Δ on assembly of SGs in cells heat-shocked at 46°C (Figure S4). Therefore, the roles of Stm1 protein and eEF3 factor in the Gcn2-independent signaling and translation repression resulting in SGs assembly in heat-shocked cells remain elusive. Meanwhile assembly of P-bodies is generally connected with reprogramming of cells to new growth conditions, SGs are formed in response to severe stresses when the translation of housekeeping genes is completely shut down. Although SGs are thought to be sites where mRNA molecules are sorted, selected, and together with translation factors, sheltered from the effects of a stress [15], [53], the fate of SGs components after a stress relief is mainly unknown [42]. However, it is conceivable that at least some SGs protein components may also return back to the active translation. In this respect, our observation of accumulation of the key translation initiation factor eIF2α (Sui2p) on dissolving SGs during cell recovery from the heat stress suggests that SGs may help cells to effectively recover after a stress relief. To recover, a fast restart of translation is facilitated by increasing a local concentration of translation initiation and elongation components in SGs, where only the key regulator, eIF2α factor (Sui2p), is missing and recruited after a stress relief only. There is a supporting evidence from mammalian cells where a phospho-variant of the eIF2α factor subunit was found to be recruited to disassembling SGs and considered as important for SGs disassembly [15]. On the contrary, we found that the eIF2α factor (Sui2p) accumulation on SGs does not depend on the phosphorylation status of this factor. It implies that the eIF2α factor is recruited to dissolving SGs also in its unphosphorylated state, thus translation competent. Taken together, it reinforces the hypothesis that SGs serve as sites where translation is effectively initiated at the time of a stress relief. We showed here that a portion of the key translation initiation factor eIF2α (Sui2p) is recruited to dissolving SGs, but some of the Sui2-GFP foci did not co-localize with SGs markers in these cells. We suggest that these particular Sui2-GFP foci may represent the eIF2B bodies [54]. In accordance with our assumption that translation is restored on dissolving SGs, the eIF2B bodies should also be formed under recovery from the stress. The eIF2B bodies most probably serve as sites, where guanine nucleotide exchange of the eIF2α factor takes place and the eIF2α-GDP form is converted to the translation competent eIF2α-GTP form. The eIF2B bodies would then help to regenerate efficiently the translation competent form of the eIF2α factor as suggested previously [55]. The eIF2α-GTP form would then be recruited to sites on dissolving SGs. Altogether, our data support the current view that the composition of stress granules depends on the type and the intensity of the applied stress. We confirmed that formation of yeast heat shock-induced SGs is not dependent on the translation initiation arrest caused by phosphorylation of eIF2α and we propose that translation machinery in heat shocked-cells seems to be primarily modulated at the level of translation elongation since also some translation elongation and termination factors accumulate within SGs. Our data further indicate that SGs reflect the sites where translation initiates after a stress relief. We also show that RNP accumulations formed upon heat shock at 42°C and containing translation elongation and termination factors may develop into genuine SGs upon robust heat shock at 46°C. Although we confirmed that all these accumulations depend on mRNA released from translation, links between heat-induced repression of translation and SGs assembly still remain to be elucidated. Factor eRF1 (Sup45p) co-localizes with Dcp2 and Ngr1 proteins in stress granules. (A) The subcellular distribution of Sup45-GFP and Dcp2-mCherry (CRY1636 strain) or (B) Sup45-GFP and Ngr1-mCherry (CRY1638) fusion proteins under heat shock at 46°C. Both pairs of proteins co-localize within stress granules. Values of the Pearsońs correlation coefficient (Rr) over 0.5 confirmed the co-localization. Scale bar 4 µm. (TIF) Click here for additional data file. An accumulation of eEF3 factor and an alteration of polysome profile at 42°C are Δ independent. (A) The distribution of Yef3-GFP protein in gcn2Δ strain (CRY1336 strain) at 30°C and under heat shock at 42°C. The protein accumulates in the same extend as the wild-type strain (compare with Figure 5) upon the heat shock. (B) Polysome profiles of gcn2Δ strain (CRY309 strain) at permissive temperature and after heat shock at 42°C for 10 minutes. Translation profile was altered in heat-shocked cells. P/M stands for polysome/monosome ratio. (TIF) Click here for additional data file. Subcellular distribution of Stm1-GFP fusion protein is not altered upon heat shock at 42°C and 46°C. The distribution of Stm1-GFP fusion protein (CRY1516 strain) remains diffusely cytosolic under all tested conditions. Scale bar 4 µm. (TIF) Click here for additional data file. Deletion of the gene does not affect assembly of heat-induced SGs. (A) The distribution of Pab1-GFP and Rpg1-RFP proteins in wild-type cells (CRY528 strain) at 30°C and upon heat shock at 46°C for 10 minutes. Both proteins are accumulated in stress granules. (B) The stm1Δ mutant (CRY1760 strain) displayed a similar pattern of stress granules as the wild-type cells. Scale bar 4 µm. (TIF) Click here for additional data file.
  54 in total

1.  Stress granule assembly is mediated by prion-like aggregation of TIA-1.

Authors:  Natalie Gilks; Nancy Kedersha; Maranatha Ayodele; Lily Shen; Georg Stoecklin; Laura M Dember; Paul Anderson
Journal:  Mol Biol Cell       Date:  2004-09-15       Impact factor: 4.138

2.  eIF2alpha kinases provide a new solution to the puzzle of substrate specificity.

Authors:  Alan G Hinnebusch
Journal:  Nat Struct Mol Biol       Date:  2005-10       Impact factor: 15.369

3.  Movement of eukaryotic mRNAs between polysomes and cytoplasmic processing bodies.

Authors:  Muriel Brengues; Daniela Teixeira; Roy Parker
Journal:  Science       Date:  2005-09-01       Impact factor: 47.728

4.  In vitro reconstitution of eukaryotic translation reveals cooperativity between release factors eRF1 and eRF3.

Authors:  Elena Z Alkalaeva; Andrey V Pisarev; Lyudmila Y Frolova; Lev L Kisselev; Tatyana V Pestova
Journal:  Cell       Date:  2006-06-16       Impact factor: 41.582

Review 5.  P bodies: at the crossroads of post-transcriptional pathways.

Authors:  Ana Eulalio; Isabelle Behm-Ansmant; Elisa Izaurralde
Journal:  Nat Rev Mol Cell Biol       Date:  2007-01       Impact factor: 94.444

6.  Inhibition of ribosome recruitment induces stress granule formation independently of eukaryotic initiation factor 2alpha phosphorylation.

Authors:  Rachid Mazroui; Rami Sukarieh; Marie-Eve Bordeleau; Randal J Kaufman; Peter Northcote; Junichi Tanaka; Imed Gallouzi; Jerry Pelletier
Journal:  Mol Biol Cell       Date:  2006-07-26       Impact factor: 4.138

Review 7.  eIF2 and the control of cell physiology.

Authors:  Christopher G Proud
Journal:  Semin Cell Dev Biol       Date:  2004-12-10       Impact factor: 7.727

8.  Eukaryotic initiation factor 2alpha-independent pathway of stress granule induction by the natural product pateamine A.

Authors:  Yongjun Dang; Nancy Kedersha; Woon-Kai Low; Daniel Romo; Myriam Gorospe; Randal Kaufman; Paul Anderson; Jun O Liu
Journal:  J Biol Chem       Date:  2006-09-02       Impact factor: 5.157

Review 9.  Localization of the translational guanine nucleotide exchange factor eIF2B: a common theme for GEFs?

Authors:  Susan G Campbell; Mark P Ashe
Journal:  Cell Cycle       Date:  2006-04-01       Impact factor: 4.534

10.  Conceptual modeling in systems biology fosters empirical findings: the mRNA lifecycle.

Authors:  Dov Dori; Mordechai Choder
Journal:  PLoS One       Date:  2007-09-12       Impact factor: 3.240

View more
  26 in total

1.  An aggregation-prone mutant of eIF3a forms reversible assemblies escaping spatial control in exponentially growing yeast cells.

Authors:  Lenka Senohrabkova; Ivana Malcova; Jiri Hasek
Journal:  Curr Genet       Date:  2019-02-04       Impact factor: 3.886

2.  Defining the protein complexome of translation termination factor eRF1: Identification of four novel eRF1-containing complexes that range from 20S to 57S in size.

Authors:  Clyde L Denis; Roy Richardson; Shiwha Park; Chongxu Zhang; Wen Xi; Thomas M Laue; Xin Wang
Journal:  Proteins       Date:  2017-11-27

3.  Only a subset of the PAB1-mRNP proteome is present in mRNA translation complexes.

Authors:  Chongxu Zhang; Xin Wang; Shiwha Park; Yueh-chin Chiang; Wen Xi; Thomas M Laue; Clyde L Denis
Journal:  Protein Sci       Date:  2014-06-02       Impact factor: 6.725

4.  Class I and II Small Heat Shock Proteins Together with HSP101 Protect Protein Translation Factors during Heat Stress.

Authors:  Fionn McLoughlin; Eman Basha; Mary E Fowler; Minsoo Kim; Juliana Bordowitz; Surekha Katiyar-Agarwal; Elizabeth Vierling
Journal:  Plant Physiol       Date:  2016-07-29       Impact factor: 8.340

5.  Profilin 1 associates with stress granules and ALS-linked mutations alter stress granule dynamics.

Authors:  Matthew D Figley; Gregor Bieri; Regina-Maria Kolaitis; J Paul Taylor; Aaron D Gitler
Journal:  J Neurosci       Date:  2014-06-11       Impact factor: 6.167

Review 6.  Translational Control by Prion-like Proteins.

Authors:  Liying Li; J P McGinnis; Kausik Si
Journal:  Trends Cell Biol       Date:  2018-03-09       Impact factor: 20.808

7.  Reversible, Specific, Active Aggregates of Endogenous Proteins Assemble upon Heat Stress.

Authors:  Edward W J Wallace; Jamie L Kear-Scott; Evgeny V Pilipenko; Michael H Schwartz; Pawel R Laskowski; Alexandra E Rojek; Christopher D Katanski; Joshua A Riback; Michael F Dion; Alexander M Franks; Edoardo M Airoldi; Tao Pan; Bogdan A Budnik; D Allan Drummond
Journal:  Cell       Date:  2015-09-10       Impact factor: 41.582

8.  Quantifying Nucleation In Vivo Reveals the Physical Basis of Prion-like Phase Behavior.

Authors:  Tarique Khan; Tejbir S Kandola; Jianzheng Wu; Shriram Venkatesan; Ellen Ketter; Jeffrey J Lange; Alejandro Rodríguez Gama; Andrew Box; Jay R Unruh; Malcolm Cook; Randal Halfmann
Journal:  Mol Cell       Date:  2018-07-05       Impact factor: 17.970

Review 9.  Modulation of efficiency of translation termination in Saccharomyces cerevisiae.

Authors:  Anton A Nizhnikov; Kirill S Antonets; Sergey G Inge-Vechtomov; Irina L Derkatch
Journal:  Prion       Date:  2014-11-01       Impact factor: 3.931

Review 10.  Biomolecular Assemblies: Moving from Observation to Predictive Design.

Authors:  Corey J Wilson; Andreas S Bommarius; Julie A Champion; Yury O Chernoff; David G Lynn; Anant K Paravastu; Chen Liang; Ming-Chien Hsieh; Jennifer M Heemstra
Journal:  Chem Rev       Date:  2018-10-03       Impact factor: 60.622

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.