Literature DB >> 35456744

Effect of Non-Lethal Selection on Spontaneous Revertants of Frameshift Mutations: The Escherichia coli hisF Case.

Sara Del Duca1, Anna Maria Puglia2, Vito Calderone3,4, Marco Bazzicalupo1, Renato Fani1.   

Abstract

Microorganisms possess the potential to adapt to fluctuations in environmental parameters, and their evolution is driven by the continuous generation of mutations. The reversion of auxotrophic mutations has been widely studied; however, little is known about the reversion of frameshift mutations resulting in amino acid auxotrophy and on the structure and functioning of the protein encoded by the revertant mutated gene. The aims of this work were to analyze the appearance of reverse mutations over time and under different selective pressures and to investigate revertant enzymes' three-dimensional structures and their correlation with a different growth ability. Escherichia coli FB182 strain, carrying the hisF892 single nucleotide deletion resulting in histidine auxotrophy, was subjected to different selective pressures, and revertant mutants were isolated and characterized. The obtained results allowed us to identify different indels of different lengths located in different positions in the hisF gene, and relations with the incubation time and the selective pressure applied were observed. Moreover, the structure of the different mutant proteins was consistent with the respective revertant ability to grow in absence of histidine, highlighting a correlation between the mutations and the catalytic activity of the mutated HisF enzyme.

Entities:  

Keywords:  directed-evolution experiment; protein structure; reverse mutation

Year:  2022        PMID: 35456744      PMCID: PMC9032791          DOI: 10.3390/microorganisms10040692

Source DB:  PubMed          Journal:  Microorganisms        ISSN: 2076-2607


1. Introduction

Microorganisms possess the potential to adapt to fluctuations in the environmental parameters of the niche they live in. They can develop novel metabolic functions through the activation of cryptic and silent genes, the selection of mutations in regulatory and/or structural genes, and also by the acquisition of new genes by horizontal transfer mechanisms [1,2]. In addition, gaining a lost metabolic function can also be achieved through the restoration of prototrophy in microorganisms harboring mutation(s) in one (or more) gene(s) involved in a given metabolic pathway, such as amino acid biosynthesis. Most of the studies concerning the origin of mutations have been largely debated since the last decades of the last century. Cairns and his collaborators [3] showed that mutations can arise in apparently static bacterial populations when subjected to nonlethal selective pressure, and evidenced that only selected for mutations appeared in a population during selection [4,5]. Indeed, selection allows beneficial mutations to increase in frequency, while neutral or deleterious types are easily missed [6]. This phenomenon was called “adaptive mutation”, and several models for the generation of these induced mutations have been proposed [3,7,8,9]. The most complete body of evidence in support of adaptive mutation has involved Escherichia coli mutants defective in lactose utilization (strain FC40) [10]; when subjected to extended incubation on minimal lactose medium, Lac+ revertant colonies arose and were isolated and characterized [11]. Today, it is well known that evolution by natural selection is driven by the continuous generation of mutations, and microorganisms’ enormous potential for adaptation may also explain why antibiotic resistance and virulence evolve so quickly in pathogenic strains [12,13]. Moreover, selective pressure on microbial amino acid auxotrophic strains can also be designed to evolve synthetic strains that can live with unnatural amino acids [14,15,16,17]. Concerning the reversion of amino acid auxotrophy, this phenomenon has been especially studied in the enterobacterium E. coli K12, harboring missense mutations in either trpA (trpA46) or trpB (trpB9578) genes (which encode the α and β subunits of tryptophan synthase) [4], or nonsense (ochre) mutations in trpE (trpE65) (encoding a subunit of anthranilate synthase), tyrA (tyrA14) (encoding a T-protein required for tyrosine biosynthesis) [18] or argE (argE3) (encoding a deacetylase involved in arginine biosynthesis) [19]. Moreover, reversion in mutations in the histidine operon of Salmonella typhimurium was also studied, either by the presence of mutagens in the culture medium, such as in the Ames mutagenicity assay used to detect chemical substances that can produce genetic damage [20], or in conditions of histidine starvation. In this case, two mutants altered in the hisG gene (hisG46 and hisG428), encoding the first enzyme of the histidine biosynthesis (i.e., the ATP phosphoribosyl transferase) were used, carrying a missense and a nonsense (ochre) mutation, respectively. Both mutants restored the His+ phenotype by mutations in either intra- or extragenic regions [21,22]. To the best of our knowledge, very little is known about the reversion of frameshift mutations resulting in amino acid auxotrophy and the correlation with the structure of the protein encoded by the mutated gene, as well as the growth rate in the absence of the amino acid whose biosynthetic pathway has been altered. For this reason, we investigated the different mutations restoring the prototrophy in an auxotrophic E. coli mutant (strain FB182 [23]) harboring the hisF892 single nucleotide deletion [24], causing a frame shift and resulting in the inability of E. coli cells to grow in the absence of histidine. The hisF gene, involved in the histidine biosynthetic pathway, was chosen as the subject of this study since it encodes a protein whose structure has been clearly elucidated in recent years, especially in the thermophilic bacterium Thermotoga maritima. This enzyme belongs to the TIM barrel family, and it is constituted by eight β-strands, each of which is separated by an α-helix. Since this (β/α)8 barrel structure is probably the most common enzyme fold and can be obtained by different amino acid sequences [25,26], the aims of this work were to test (i) whether the alteration of this three-dimensional structure might be compensated by different reverse mutations, which might restore—totally or partially—the correct three-dimensional structure with a different ability to allow growth in the absence of histidine, and (ii) whether different reverse mutations might appear over time and/or depending on the selective pressure applied.

2. Materials and Methods

2.1. Bacterial Strains

The E. coli FB8 strain (wild-type E. coli K12 UTH1038 [27]) and E. coli FB182 (hisF892) strain [23] were used in the present work. E. coli FB182 carries a single nucleotide deletion in position 718 or 719 of the hisF gene, causing a frame shift and the formation of a premature stop codon, resulting in a shorter (243 aa vs. 258 aa of the wild-type E. coli HisF protein) and non-functioning enzyme [24]. The list of the 67 E. coli FB182 HisF+ revertant strains obtained in this work is reported in Table 1.
Table 1

List of E. coli FB182 HisF+ revertants. The day of appearance on MMD containing different concentrations of histidine (0, 0.3 and 1 µg/mL) and the minimum concentration of histidine (M.C.H.) allowing the growth of revertants (see below) are reported. The ID represents the different type of molecular rearrangement occurred (see also Table 2).

IDMutant NameDay ofAppearance[His] (µg/mL)M.C.H.TotalIDMutant NameDay ofAppearance[His] (µg/mL)M.C.H.Total
1 248102 10 G60.303
PC220.30A120.30
2 F1612104320.30
A280.30 11 F03B10002
F1A3241010610
F03B2140.30 12 I2106
3 F1B22101PHC1200
4 N20011FP1B2910
PHC1511102400
F0B4180022810
F0B52200A1_220.30
660.30 13 PHA130.301
760.30 14 H2105
8210C2610
12610F1B3710
18810F0B73100
201110420.30
211410 15 D13101
5 F12102 16 PB14103
FP03B120.309310
6 E610811310
F20.30 17 C16101
D1_2310 18 C2_220.303
F0B62600F03A120.30
13710171110
15110.30 19 PHA480.301
16150.30 20 C1_22101
19810 21 PHB1410.31
7 A2_220.301 22 F1A62910.31
8 F0A12003 23 F1A114111
F0A2200 24 F1A429111
1400 25 F1A22010.32
9 F1B12102F03B1130.30.3
F0AP1210 Total 67

2.2. Directed-Evolution Experiment and Isolation of HisF+ Revertants

E. coli FB182 HisF+ revertants were obtained as follows: E. coli FB182 cells were grown overnight at 37 °C with shaking (150 rpm) in minimal medium Davis (MMD) [28] ((NH4)2SO4 1 g/L; K2HPO4 7 g/L; KH2PO4 2 g/L; Na3-citrate·2H2O 0.5 g/L; MgSO4·7H2O 0.1 g/L; pH 7.2) with glucose 1% and histidine 25 µg/mL. The optical density (O.D.600) of the culture was measured and the culture was diluted to O.D.600 0.1 in a final volume of 50 mL of MMD containing glucose 1% and histidine 25 µg/mL. The culture was then incubated at 37 °C with shaking (150 rpm); at the end of the log phase, cells were centrifuged, washed twice in saline solution (NaCl 0.9% w/v) and then spread on 100 mL MMD plates containing agar 1.6% and glucose 1% in the absence of histidine (three plates), or in the presence of histidine 0.3 µg/mL (three plates) or 1 µg/mL (three plates). 100 µL of 10−5 and 10−6 dilutions were plated on LB agar (Lysogeny Broth) [29] (NaCl 10 g/L, yeast extract 5 g/L, tryptone 10 g/L, agar 16 g/L), to evaluate the cells’ vital titer. Vital titer plates were incubated at 37 °C overnight. Selective pressure plates were incubated at 37 °C for 30 days, and the appearance of HisF+ revertants was checked daily. Three different experiments were carried out in triplicate. HisF+ revertants were tested for their ability to grow in the total absence or in low concentrations of histidine through streaking on MMD plates containing glucose 1% and histidine 0, 0.3, 1 µg/mL. Moreover, the number of viable cells plated on MMD in the absence or in the presence of 0.3 and 1 µg/mL of histidine was determined during the entire experiments as follows: every day, a portion of 1 cm diameter was picked up from each of the selective plates. The agar was then washed three times with saline solution (NaCl 0.9% w/v) for 30 s in order to recover the E. coli FB182 cells from the surface. Cells were then spread on MMD plates containing histidine (25 µg/mL) and incubated at 37 °C overnight, and the vital titer was calculated.

2.3. PCR Amplification and Sequencing

The nucleotide sequence of the E. coli K12 MG1655 (accession NC_000913) histidine operon was obtained from the NCBI database. Based on this sequence, primers were designed to anneal externally to hisF gene; the primers used in this study are coli_hisF_ext FW (5′-GCGGCGTAATAGTTGGTCG-3′) and coli_hisF_ext REV (5′-TCTAAGGCTTCCGGGTTCAT-3′), which anneal 61 bp upstream and 121 bp downstream of the hisF gene (777 bp), respectively, generating an amplicon of 959 bp. For the amplification of the HisF+ revertant hisF gene, thermal lysates were used as template. The PCR reaction was carried out in a total volume of 20 µL containing: DreamTaq buffer 1× (Thermo Fisher Scientific, Waltham, MA, USA), 0.25 mM of dNTPs, 0.2 µM of each primer, 1 U of DreamTaq polymerase (Thermo Fisher Scientific) and 1 µL of lysate. The amplification reaction was set as follows: 5 min at 95 °C for the initial denaturation, 35 cycles of 95 °C for 30 s, 59 °C for 45 s and 72 °C for 1 min, and the final extension at 72 °C for 10 min. PCR products were analyzed through 0.8% w/v agarose gel electrophoresis with 1X ethidium bromide solution in 1× TAE buffer. PCR products were diluted 1:5 in a final volume of 5 µL and purified with ExoSAP-IT™ Express PCR Product Cleanup kit (Applied Biosystems, Waltham, MA, USA) following manufacturer instructions. A sequencing reaction was performed using the BigDye™ Terminator v3.1 Cycle Sequencing kit (Applied Biosystems) in a total volume of 10 µL, containing: 1 µL of BigDye™ Terminator v3.1 Ready Reaction Mix, Sequencing Buffer 1× and 0.32 µM of primer forward or primer reverse. The sequencing reaction was set as follows: 3 min at 96 °C for the initial denaturation, 25 cycles of 96 °C for 10 s, 50 °C for 5 s and 60 °C for 4 min. Sequencing reactions were purified with BigDye XTerminator™ (Applied Biosystems) following manufacturer instructions. Capillary electrophoresis was performed in a SeqStudio Genetic Analyzer (Applied Biosystems). Obtained sequences were analyzed using BioEdit [30].

2.4. Prediction of Protein Three-Dimensional Structure

The three-dimensional structure of the HisF proteins encoded by the E. coli FB182 HisF+ revertants was predicted with RoseTTAFold software [31] through a comparative modeling approach. The template used was E. coli K12 HisF protein, predicted through AlphaFold2 [32] and available on the AlphaFold2 Protein Structure Database (accession number B1X6W2). Three-dimensional structures were superposed and the relevant root-mean-square deviations (RMSD) on all backbone atoms were calculated using UCSF Chimera v. 1.16 [33].

2.5. His+ Revertant Growth Curves and Statistical Analyses

E. coli FB182 HisF+ revertant growth curves were performed in microplates. Cells were grown overnight at 37 °C with shaking (150 rpm) in LB. The next morning, cell cultures were washed twice in saline solution (NaCl 0.9% w/v) and diluted to a starting O.D.600 of 0.01 in MMD supplemented with glucose 1% and histidine 0.3, 1, 25 μg/mL when required. Cells were then incubated at 37 °C and the O.D.600 measures were taken every hour for 48 h using the Infinite M Nano (Tecan, Männedorf, Switzerland) microplate reader. Each curve was performed in triplicate. The instantaneous growth rate of bacterial cultures was calculated according to Widdel [34]. Maximum growth rate (µMAX) was chosen to compare a specific mutant growth in the absence and presence of histidine in the culture medium. The average µMAX and the relative standard error were calculated since every growth curve was performed in triplicate; then, the ratio between the µMAX in the absence and presence of histidine was obtained. The same procedure was applied for the calculation of the ratio between the areas under the growth curve (AUC), obtained according to the chained trapezoidal rule [35]. An analysis of variance (ANOVA) using Tukey’s pairwise test was performed on the two ratios (between µMAX (r-µMAX) in the absence and presence of histidine, and AUC (r-AUC) in the absence and presence of histidine) among the different cell populations.

3. Results and Discussion

3.1. Isolation of E. coli FB182 HisF+ Revertants

HisF+ revertants from the E. coli strain FB182 were isolated as described in Materials and Methods on MMD plates in the absence of histidine or in the presence of two different histidine concentrations (i.e., 0.3 and 1 µg/mL, respectively). At the end of the experiments a total of 67 His+ colonies were found on all the selective plates and recovered. In particular, as shown in Table 1: 11 HisF+ colonies were isolated on MMD in the absence of histidine out of 3 × 109 viable cells plated; 20 HisF+ colonies were isolated on MMD in the presence of 0.3 µg/mL histidine out of 3 × 109 viable cells plated; 36 HisF+ colonies were isolated on MMD in the presence of 1 µg/mL histidine out of 3 × 109 viable cells plated.

3.2. Genetic Characterization of His+ Revertants

In order to identify the type and the localization, within the E. coli FB182 hisF gene, of the mutation(s) responsible for the HisF+ phenotype, a DNA fragment containing the entire hisF gene and its surrounding regions was amplified from each of the 67 HisF+ revertants via PCR, as described in Materials and Methods. An amplicon of the expected size (i.e., 959 bp) was obtained from each of them (not shown), suggesting that no large rearrangement occurred in the hisF gene of any of the 67 revertants. The nucleotide sequence of each amplicon was then determined and compared with that of both the E. coli wild-type strain and mutant E. coli FB182. The data obtained are shown in Table 2 and in Figure 1A, whose analysis revealed that—as it might be expected since the point mutation affecting the function of hisF gene in the mutant strain E. coli FB182 is a 1 bp deletion—two main types of genetic rearrangements occurred, i.e., either insertions or deletions (indels) of different lengths. In particular:
Table 2

Nucleotide sequence of hisF gene from E. coli FB182 HisF+ revertants. The type of mutation (I: insertion, D: deletion, S: substitution), the number of nucleotides inserted (+)/deleted (−), the location (u: upstream, d: downstream of the E. coli FB182 deletion) and position of the mutation, the number of revertants with a specific mutation (N. rev. A) and the number of revertants with the same number of inserted/deleted nucleotides (N. rev. B) are reported. The mutation is highlighted in red, the location of E. coli FB182 deletion is highlighted in grey. When mutation could have occurred in multiple positions, the last nucleotide(s) of the series is (are) highlighted and all the possible positions are reported. In the wild-type nucleotide sequence, the region belonging to the phosphate-binding domain is underlined. Different colors are assigned to the IDs on the basis of the number of inserted/deleted nucleotides. The same table reporting the reding frame for each sequence and the nucleotide sequence translation is reported in (Supplementary Material Table S1).

IDMut. TypeN. ntLocationPositionNucleotide Sequence (Positions 697–748)N. Rev. AN. Rev. B
wt ----GTATTCCACAAACAAATAATCAATATTGGTGAATTAAAAGCGTACCTGGCAA…-
FB182 D−1-718–719…GTATTCCACAAACAAATAATCA-TATTGGTGAATTAAAAGCGTACCTGGCAA…-
1 I+1-718–719…GTATTCCACAAACAAATAATCAATATTGGTGAATTAAAAGCGTACCTGGCAA…252
2 I+1u717–718…GTATTCCACAAACAAATAATCCA-TATTGGTGAATTAAAAGCGTACCTGGCAA…4
3 I+1u716–717…GTATTCCACAAACAAATAATTCA-TATTGGTGAATTAAAAGCGTACCTGGCAA…1
4 I+1u714–716…GTATTCCACAAACAAATAAATCA-TATTGGTGAATTAAAAGCGTACCTGGCAA…11
5 I+1u713–714…GTATTCCACAAACAAATTAATCA-TATTGGTGAATTAAAAGCGTACCTGGCAA…2
6 I+1u710–713…GTATTCCACAAACAAAATAATCA-TATTGGTGAATTAAAAGCGTACCTGGCAA…8
7 I+1d720…GTATTCCACAAACAAATAATCA-TGATTGGTGAATTAAAAGCGTACCTGGCAA…1
8 I+1d721…GTATTCCACAAACAAATAATCA-TACTTGGTGAATTAAAAGCGTACCTGGCAA…3
9 I+1d721–723…GTATTCCACAAACAAATAATCA-TATTTGGTGAATTAAAAGCGTACCTGGCAA…2
10 I+1d720–721…GTATTCCACAAACAAATAATCA-TAATTGGTGAATTAAAAGCGTACCTGGCAA…3
11 I+1d723–725…GTATTCCACAAACAAATAATCA-TATTGGGTGAATTAAAAGCGTACCTGGCAA…2
12 I+1d727–729…GTATTCCACAAACAAATAATCA-TATTGGTGAAATTAAAAGCGTACCTGGCAA…6
13 I+1d728…GTATTCCACAAACAAATAATCA-TATTGGTGATATTAAAAGCGTACCTGGCAA…1
14 I+1d729–731…GTATTCCACAAACAAATAATCA-TATTGGTGAATTTAAAAGCGTACCTGGCAA…5
15 S + I+1u709 + 706–713…GTATTCCACAAAAAAAATAATCA-TATTGGTGAATTAAAAGCGTACCTGGCAA…1
16 I+4u705/709/713…GTATTCCACAAACAAACAAATAATCA-TATTGGTGAATTAAAAGCGTACCTGGCAA…39
17 I+4u711–713…GTATTCCACAAACAAAAAAATAATCA-TATTGGTGAATTAAAAGCGTACCTGGCAA…1
18 I+4d715/719…GTATTCCACAAACAAATAATCA-ATCATATTGGTGAATTAAAAGCGTACCTGGCAA…3
19 I+4d719…GTATTCCACAAACAAATAATCA-TACATATTGGTGAATTAAAAGCGTACCTGGCAA…1
20 I+4d721…GTATTCCACAAACAAATAATCA-TATTTATTGGTGAATTAAAAGCGTACCTGGCAA…1
21 I+7u702…GTATTCCACATTCCACAAACAAATAATCA-TATTGGTGAATTAAAAGCGTACCTGGCAA…11
22 I+10d719…GTATTCCACAAACAAATAATCA-TATTGAATCATATTGGTGAATTAAAAGCGTACCTGGCAA…11
23 D−2u713–714…GTATTCCACAAACAAA--ATCA-TATTGGTGAATTAAAAGCGTACCTGGCAA…14
24 D−2u717–718…GTATTCCACAAACAAATAAT---TATTGGTGAATTAAAAGCGTACCTGGCAA…1
25 D−2d723–724…GTATTCCACAAACAAATAATCA-TATT--TGAATTAAAAGCGTACCTGGCAA…2
Figure 1

(a) Distribution of E. coli FB182 HisF+ revertants (in different shades of blue) and of the characterized mutations (in different shades of red). (b) Spatial distribution of mutations causing reversion in hisF gene. When a mutation could have occurred in multiple positions, the position of the last nucleotide(s) of the series is reported. The grey arrow points the position of E. coli FB182 mutation.

Insertion of four different length (+1,+4, +7, +10 bp) occurred; Just one type of deletion took place (−2 bp); no deletions longer than 2 bp were detected; The highest number of mutants (52 out of 67 corresponding to 78%) exhibit a +1 bp insertion; nine mutants exhibit a +4 bp insertion; 1 mutant exhibited a +7 bp and 1 a +10 bp insertion; Four mutants showed a −2 bp deletion; Fifteen different types of +1 insertions occurred (one in an identical position, five upstream and eight downstream of the E. coli FB182 deletion). Moreover, a single strain (ID 15) harbors, aside from a +1 insertion located upstream of the E. coli FB182 deletion, a single nucleotide substitution. To simplify, this strain was considered to be part of the +1 insertions group. Five different types of +4 insertions took place (two upstream and three downstream of the E. coli FB182 deletion). As might be expected, all the insertions and deletions detected are in close proximity to the original mutation. Concerning the +1 insertions, a very small number (2/52, 3.8%) of +1 bp insertions fell in this position. Indeed, the highest number of +1 insertions occurred between positions 710 and 716 (a total of 22), corresponding to 33% of the entire panel of mutants (Figure 1B).

3.3. Spatial Distribution of Mutations Causing HisF+ Reversion

The spatial distribution of the indels determining the reversion of the hisF892 mutation is shown in Figure 1B. As can be observed, the distribution spans from position 702 to 731. No difference between the number of the mutation reversion falling upstream or downstream of the hisF892 mutation was found. This might be expected; indeed, indels falling in proximity to the E. coli FB182 −1 bp deletion might change just a few numbers of residues which, in turn, might not alter the three-dimensional structure of the protein. On the other hand, a reversion occurring distantly from the original mutation would involve a number of amino acids sufficiently high to affect the correct folding of the last (β/α) module, thus interfering with the function of the HisF protein. Indeed, the region spanning from nucleotide 601 to nucleotide 729 (comprising the β-sheets/α-helices β-7, α-7, β-8, α-8) corresponds to the phosphate-binding domain (Table 2) [36]. Indeed, for HisF, it is known that both β/α loops 3 and 4 and β/α loops 7 and 8 contain phosphate-binding motifs, required by the nature of its biphosphate substrate (PRFAR) [37,38,39]. This motif is found in the C-terminal halves of a number of other TIM barrel enzymes (but not in the N-terminal halves) [40] and it is the most conserved region in many (β/α)8 barrels, including the E. coli HisF and HisA [36]. All the mutations obtained in this work fell in the HisF C-terminal phosphate-binding site. The prediction of the amino acid sequence of the E. coli FB182 HisF protein by inserting a single nucleotide (A, G, T, or C) in each position from 697 to 713 deeply altered the amino acid sequence of the phosphate-binding site (not shown), very likely interfering with the HisF catalytic activity.

3.4. Effect of the Strength of Selective Pressure

Results concerning the appearance of E. coli FB182 HisF+ colonies are shown in Figure 2A. As can be observed, the number of revertants increased with the increase in histidine concentration in the growth minimal medium. In other words, the lower the selective pressure (i.e., the higher the histidine concentration in the growth medium), the higher the number of HisF+ colonies obtained. This finding suggested that the arise of HisF+ colonies may require a residual growth of bacteria enabling DNA replication which, in turn, might allow the accumulation of revertants. On the other hand, plates without histidine still allowed the growth of 11 revertants, indicating that starving cells can induce mutations under stressful conditions [41].
Figure 2

(a) Timing of appearance of E. coli FB182 HisF+ revertants under different selective pressures. (b) Survival of E. coli FB182 cells under different selective pressure (i.e., different histidine concentrations in the culture medium). (c) Timing of appearance of E. coli FB182 His+ revertants on the basis of the different mutation.

In order to check this idea, the number of viable cells plated under selective pressure was determined throughout the entire experiment, as reported in Materials and Methods. The data obtained are reported in Figure 2B, whose analysis revealed that, after an initial increase in viable titer, the number of viable cells decreased constantly over time. However, a residual number of viable cells was also present after a long period of incubation at 37 °C, even in the absence of histidine. The largest rearrangements (+4, +7, +10, −2 bp) appeared only on MMD plates containing 0.3 or 1 µg/mL histidine (Figure 1A), suggesting that the mechanisms of mutation under a very strong selective pressure (i.e., the absence of the amino acid) could be different from that under mild selection conditions, not allowing the appearance of large rearrangements. It is not clear, on the basis of the available data, whether these larger rearrangements occurred in a single step or required multiple successive events.

3.5. Effect of Time

The data reported in Figure 2A show the timing of the appearance of E. coli FB182 HisF+ revertants; the analysis of these data revealed that no revertant appeared in the first 24 h after plating on MMD medium, independently from the applied selective pressure, while the wild-type strain in the same media shows well-grown colonies after 24 h. This result, together with the fact that mutants belonging to the most represented groups of mutations appeared in different days on different plates, suggested that no revertant was present in the bacterial culture before plating on MMD medium. The appearance of His+ revertants began after at least 48 h of incubation at 37 °C and the number of HisF+ colonies increased over time up to the 31st day. No additional revertant was detected later. About one-third of the entire panel of HisF+ revertants appeared on the second day of incubation at 37 °C. Overall, the longer the rearrangement occurred, the longer the time requested for its appearance. The timing of the appearance of E. coli FB182 His+ revertants on the basis of the different mutation is reported in Figure 2C. The majority of the most severe reversion mutations appeared after at least 13 days of incubation, suggesting a correlation between the long incubation time and the type of mutation that occurred.

3.6. Analysis of the Amino Acid Sequence of the HisF Proteins from HisF+ Revertants and Prediction of Tertiary Structure of HisF Proteins from wild-type E. coli and HisF+ Revertants

The hisF nucleotide sequence from each of the 25 E. coli FB182 HisF+ revertant groups was translated into the amino acid sequence of the corresponding protein. The data obtained concerning the regions immediately upstream and downstream of the hisF892 mutation are reported in Table 3, whose analysis revealed that 22 different predicted amino acid sequences were disclosed, since revertants belonging to class 2 and 3 harbor the same amino acid sequence, as well as mutants belonging to classes 4 and 5 and 8 and 11.
Table 3

Predicted amino acid sequence of the C-terminal region of HisF protein from E. coli FB182 HisF+ revertants. The type of mutation (I: insertion, D: deletion, S: substitution), the number of nucleotides inserted (+)/deleted (−), the location (u: upstream, d: downstream of the E. coli FB182 deletion) and position of the mutation, the number of revertants with a specific nucleotide mutation (N. rev. A), the number of revertants with the same amino acid sequence (N. rev. B) and the number of revertants with the same number of inserted/deleted nucleotides (N. rev. C) are reported. The asterisks represent the end of the sequence. The different amino acids are highlighted in red. In the wild-type amino acid sequence, the region belonging to the phosphate-binding domain [36] is underlined and two of the residues directly involved in the phosphate binding [42] are in bold. Different colors are assigned to the IDs on the basis of the number of inserted/deleted nucleotides.

IDMut. TypeN. ntLocationPositionAmino Acid Sequence (Positions 229–258)N. Rev. AN. Rev. BN. Rev. C
wt ----LAASVFHKQIINIGELKAYLATQGVEIRIC*---
FB182 D−1-718–719…LAASVFHKQIIILVN*---
1 I+1-718–719…LAASVFHKQIINIGELKAYLATQGVEIRIC*2252
2 I+1u717–718…LAASVFHKQIIHIGELKAYLATQGVEIRIC*45
3 I+1u716–717…LAASVFHKQIIHIGELKAYLATQGVEIRIC*1
4 I+1u714–716…LAASVFHKQINHIGELKAYLATQGVEIRIC*1113
5 I+1u713–714…LAASVFHKQINHIGELKAYLATQGVEIRIC*2
6 I+1u710–713…LAASVFHKQNNHIGELKAYLATQGVEIRIC*88
7 I+1d720…LAASVFHKQIIMIGELKAYLATQGVEIRIC*11
8 I+1d721…LAASVFHKQIIILGELKAYLATQGVEIRIC*35
11 I+1d721–723…LAASVFHKQIIILGELKAYLATQGVEIRIC*2
9 I+1d720–721…LAASVFHKQIIIFGELKAYLATQGVEIRIC*22
10 I+1d723–725…LAASVFHKQIIIIGELKAYLATQGVEIRIC*33
12 I+1d727–729…LAASVFHKQIIILVKLKAYLATQGVEIRIC*66
13 I+1d728…LAASVFHKQIIILVILKAYLATQGVEIRIC*11
14 I+1d729–731…LAASVFHKQIIILVNLKAYLATQGVEIRIC*55
15 S + I+1u709 + 706–713…LAASVFHKKNNHIGELKAYLATQGVEIRIC*11
16 I+4u705/709/713…LAASVFHKQTNNHIGELKAYLATQGVEIRIC*339
17 I+4u711–713…LAASVFHKQKNNHIGELKAYLATQGVEIRIC*11
18 I+4d715/719…LAASVFHKQIINHIGELKAYLATQGVEIRIC*33
19 I+4d719…LAASVFHKQIIIHIGELKAYLATQGVEIRIC*11
20 I+4d721…LAASVFHKQIIIFIGELKAYLATQGVEIRIC*11
21 I+7u702…LAASVFHIPQTNNHIGELKAYLATQGVEIRIC*111
22 I+10d719…LAASVFHKQIIILNHIGELKAYLATQGVEIRIC*111
23 D−2u713–714…LAASVFHKQNHIGELKAYLATQGVEIRIC*114
24 D−2u717–718…LAASVFHKQIIIGELKAYLATQGVEIRIC*11
25 D−2d723–724…LAASVFHKQIIIFELKAYLATQGVEIRIC*22
In order to check whether the mutation(s) that occurred in E. coli FB182 HisF+ revertants might have either restored the correct or altered the three-dimensional structure of the HisF protein, tertiary structure prediction was carried out as described in Materials and Methods and shown in Figure 3.
Figure 3

Prediction of the three-dimensional structure of E. coli FB182 revertants HisF protein superimposed on the three-dimensional structure of wild-type E. coli K12 HisF available on the AlphaFold2 Protein Structure Database (accession number B1X6W2) (in grey). Prediction was performed for one representative of each indels group (+1 bp group: ID 14; +4 bp group: ID 19; +7 bp group: ID 21; +10 bp group: ID 22; −2 bp group: ID 24). Detail of the HisF protein region containing the mutations is reported. RMSD values calculated on all backbone atoms between wild-type E. coli K12 HisF and HisF revertants are reported. The grey arrows point the position of mutations.

The two approaches used for structure prediction were AlphaFold2 and RoseTTAFold; they represent the two most reliable methods available nowadays to accomplish the always-dreamed-of capability of predicting three-dimensional structures, starting from the amino acid sequence [43,44]. In particular, the structure of the wild-type E. coli K12 HisF protein was directly downloaded from the AlphaFold2 Database, whereas all the mutant HisF structures were calculated with RoseTTAFold as reported in Materials and Methods. The superposition of the wild-type HisF with each mutant one showed, as expected, a significant structural difference in the region involving the mutations. The calculation of the RMSD between the wild-type and each revertant showed no significant deviation for mutants belonging to the +1 bp insertion group, where the number of residues does not change from the wild-type. Concerning the mutants that imply an increase or a decrease in the number of residues, the RMS deviation in that specific region went beyond 1.4 Å, reaching values beyond 2 Å for mutants belonging to the +7 bp insertion group. Mutants belonging to the +4 bp groups showed an RMSD around 1.5 Å; the mutant with the +10 bp insertion, despite the higher number of nucleotide insertions, showed an RMSD around 1.5 Å, but the perturbation was spread over a larger number of residues (Figure 3). These deviations are clearly visible in Figure 3, where the three-dimensional structure for one representative of each mutation group is reported. The higher the number of residue insertions, the higher the structural perturbation of the backbone in the C-terminal region. Despite the variations being located in a restricted residue range, this region might be involved in the catalytic activity of the protein. As already outlined in Paragraph 3.3, this region is critical to the catalytic activity of HisF because it binds a second phosphate; it is plausible that even modest rearrangements of the structure in this specific region could, for example, cause a decreased binding affinity for this phosphate, thus affecting the catalytic efficiency of the enzyme. An important structural parameter that would be useful to characterize in deeper detail the difference between wild-type and mutants is indeed the B-factors distribution. Their value indicates the degree of mobility of each atom and would allow for speculating about the possible implications and effects caused by the mutations. Unfortunately, in this case, no B-factors or no significant B-factors are available since the models used are not experimental. Moreover, as a control, all the structures predicted using the comparative modeling approach in RoseTTAFold were calculated also using the ab initio approach; the results obtained by performing the calculations with the model obtained in such a way were indeed superposable to those obtained with the comparative modeling approach.

3.7. Correlation of Reversion Mutation Occurred with the Ability to Grow in the Absence of Histidine

Since the 67 revertants were isolated on MMD under different selective pressures, there is no telling if the revertants that appeared on MMD plates under low selective pressures (i.e., 0.3 or 1 µg/mL of histidine) are able to grow in the absence of the amino acid. To check this and to try to correlate the type of reversion occurred and the HisF protein structure with the ability to grow under different growth conditions, HisF+ revertants were streaked on MMD plates containing 0, 0.3, 1 and 25 µg/mL histidine. The data obtained (not shown) revealed that most of them were able to grow in the absence of histidine independently from the day of appearance on MMD plates and the selective pressure applied (see M.C.H. values reported in Table 1). On the contrary, revertants belonging to the last five groups (21–25, isolated in the presence of 0.3 or 1 µg/mL of histidine and exhibiting the +7, + 10 and −2 bp indels) were not able to grow in the total absence of the amino acid. Thus, as described in Materials and Methods, growth curves in the absence and presence of histidine 25 µg/mL were performed for a representative of each of the 22 groups harboring a different HisF amino acid sequence (Figure 4 and Figure S1), confirming that +1 revertants were indistinguishable from the parental, and +4 revertants without histidine show slightly impaired growth curves, particularly types 16 and 17 whose amino acid sequence carries a higher number of residues different from the wild-type with respect to the other +4 mutants. The five revertants carrying a −2 bp deletion or +7 and +10 bp insertion were not able (or showed a very reduced ability) to grow in the complete absence of histidine, strongly suggesting that those mutations affected the correct functionality of the HisF protein.
Figure 4

Growth curves of His+ revertants in absence and presence of histidine 0.3, 1 and 25 µg/mL. Hours of incubation are reported on the x-axis, while logarithm of O.D.600 on the y-axis of the charts. Growth curves are reported for one representative of each indels group (+1 bp group: ID 14; +4 bp group: ID 19; +7 bp group: ID 21; +10 bp group: ID 22; −2 bp group: ID 24). Growth curves of all the single revertants are reported in Supplementary Material (Figure S1).

Hence, these five revertants were grown in MMD medium containing 0, 0.3, 1 and 25 µg/mL of histidine. The data obtained are reported in Figure 4 and Figure S1, whose analysis revealed that—as expected—the E. coli mutant FB182 did not grow in the absence of histidine but was able to grow slowly in the presence of 0.3 and 1 µg/mL of the amino acid, even if not reaching the final O.D.600 typical of its growth in the presence of 25 µg/mL of histidine. The five mutants grew better than E. coli FB182 in the presence of 0.3 and 1 µg/mL of histidine, despite being slower than the wild-type strain. Without histidine, these revertants grew very slowly, but still better than the original mutant. The results were confirmed by the analysis of the growth rate performed on the 22 HisF+ revertants and shown in Figure 5.
Figure 5

Average values of the ratios (a) between maximum growth rate (r-µMAX) in absence and in presence of histidine, and (b) between area under growth curve (r-AUC) in absence and in presence of histidine. Each color corresponds to a distinct cell population (+7 bp and + 10 bp insertions were joined in the group called “+ >4”), whereas bars represent standard errors. Significant differences were evaluated through analysis of variance (ANOVA) performed using Tukey’s pairwise test. Different letters indicate significant differences (p-value < 0.001).

Different scenarios can be depicted for this finding; the first one predicts that the catalytic activity of the HisF protein of revertants 21–25 was not completely recovered. As highlighted in Table 2 and Table 3, E. coli FB182 deletion lies in the phosphate-binding site, as well as all the revertant mutations. According to studies performed on T. maritima [44] and on the analysis of the HisF three-dimensional structures available in the Protein Data Bank (PDB) (PDB IDs: 1H5Y, 4EVZ, 5TQL, 7AC8), E. coli HisF+ revertant mutations did not change the residues directly involved in the phosphate binding, but fell immediately downstream of some of them (i.e., A231 and S232, Table 3). This makes sense, since mutations altering the amino acids directly binding the phosphate probably would not have allowed the functioning of the HisF protein and thus the growth of the revertants under selective pressure. However, some mutations could partially affect the correct functionality of the revertant HisF protein and, consequently, mutants’ ability to grow in the total absence of histidine in the culture medium. A second hypothesis relies on the fact that HisF can perform its activity when it interacts with the product of the hisH gene, forming the heterodimeric enzyme imidazole glycerol phosphate synthase (IGPS) [24]; hence, in principle, the slow growth of these revertants in the absence of histidine might be due to a weaker interaction of HisF protein with the HisH counterpart. However, at least in T. maritima, it is known that the HisH subunit docks onto the N-terminal face of the HisF subunit, located opposite the C-terminal’s active site face [45]. Since the revertant mutations are located in the C-terminal of HisF protein, its interaction with HisH subunit would appear not to be affected. A third possibility is based on the knowledge that IGPS catalyzes glutamine hydrolysis at the active site of HisH, producing ammonia (NH3) and glutamate, and that the generated NH3 travels from the HisH active site to the HisF one passing through the (β/α)8 barrel [46]. Thus, modifications in the three-dimensional HisF structure could affect the ammonia transfer from HisH to the C-terminal region of HisF. However, from the revertants HisF protein tertiary structure prediction, it was possible to observe that the modifications in the mutated enzymes conformation lie on the outer surface of the proteins, not affecting the HisF internal ammonia channel. A final hypothesis is based on the revertants HisF protein stability. Indeed, systematic studies of mutagenesis globally indicate that destabilization is the most common consequence of sequence alteration [47,48]. The revertants mutated amino acids are mainly located on the first turn (N-terminal) of the last α-helix. The C=O of the Asn side chain (N240 in the wild-type HisF protein) makes a typical H bond with the NH of the first turn of the helix. This is a typical helix N-cap and it is known to have a significant contribution to α-helix stability [49,50,51]. The alteration of this N-cap could determine the destabilization of some of the revertant HisF proteins. Thus, among these different hypotheses and based on the structural evidence, we could argue that the most likely ones are (i) the decreased binding affinity for phosphate, which, in turn, affects the catalytic activity without switching it off completely, and (ii) the destabilization of the HisF last α-helix.

3.8. Mechanisms of Frameshift Mutations

One of the typical mechanisms of frameshift mutation involves the insertion of one (or more) base(s), identical to an adjacent one already present in the original DNA [52]. This mechanism is represented by DNA polymerase slippage, occurring during DNA replication when DNA polymerase encounters a tandem repetition of single nucleotides or short oligonucleotides, and a transient dissociation of the template followed by an out-of-register annealing causes the pairing of a set of bases in one chain of the DNA molecule with the wrong, but complementary, set in the other chain. Studies have shown that the frequency of polymerase slippage increases as the number of repeat units in a run increases, with the most frequent types of corresponding frameshift mutations being single-unit insertions or deletions [53] and references therein. It is possible that DNA polymerase slippage might be responsible for the generation of (see Table 2) (i) type 6 insertion where a single A has been added in the triplet AAA, (ii) type 15 insertion where slippage presumably caused both the substitution of a C with an A and the insertion of an additional adenine to the run of As, (iii) type 16 insertion, where the four nucleotides CAAA were inserted immediately downstream of two in-tandem CAAA repetitions, and lastly (iv) type 17 insertion, where the four nucleotides AAAA were inserted immediately downstream of a repetition of three As. A similar mechanism could have been involved in the generation of type 18 insertion, where the four nucleotides ATCA were inserted immediately downstream of another ATCA sequence. Moreover, aside from type 6 and 15 where the added nucleotides lie downstream of a run of at least three identical bases, it is possible to observe that in most of the other +1 bp insertion types (10 among 13), the inserted nucleotide is identical to one or two of the adjacent bases. In these cases, the number of units repetition is low, and the insertion of that specific nucleotide might be a coincidence; however, it is not possible to exclude that polymerase slippage could have been involved in at least some of these insertions. However, it is unlikely that all the obtained reversion mutations might have occurred through this mechanism, in particular those in which long sequences, different from the adjacent regions, were inserted (i.e., +7 and +10 bp insertions) or deleted. In addition to the polymerase slippage model, proposed for describing frameshift mutations in repetitive DNA, “misincorporation misalignment” and “dNTP-stabilized misalignment” models have been proposed for non-repetitive DNA. The first one occurs when DNA polymerase initially forms a mismatched base pair at the 3′-end that subsequently realigns by pairing with a complementary downstream template base prior to undergoing further extension. Alternatively, in the second case, DNA misalignment could occur as the first step followed by the “correct” incorporation of an incoming dNTP [54]. These models have been proposed mainly to explain frameshift deletions.

4. Conclusions

In this work, we analyzed the molecular rearrangements responsible for the reversion of a deletion of a single nucleotide in the E. coli hisF mutant, trying to correlate the type of mutations occurred with: (i) the strength of the applied selective pressure, (ii) the time of appearance of reversions, (iii) the three-dimensional structure of the “reverted” HisF proteins, and (iv) the ability of these reverted proteins to perform the proper catalytic activity in the absence of histidine. The data obtained revealed that a total of 67 indels of different lengths (+1, +4, +7, +10, and −2 bp) occurred, whose number decreased with the increase in the inserted nucleotides. Moreover, the lower the strength of the selective pressure, the higher the number of revertants appeared on selective medium, and an additional correlation was also observed between the type of the occurred rearrangement and the time requested for its appearance. Some of the insertions were likely due to DNA polymerase slippage, whereas the molecular mechanisms responsible for most reversions (including the largest ones) are still unknown. The finding that most of the indels occurred in a very narrow region, thus slightly modifying the amino acid sequence and the three-dimensional structure of the HisF protein, likely correlates to the necessity of a specific tertiary structure of the HisF protein to allow its correct functionality; the structural evidence of the different mutants is consistent with the respective ability to grow in the absence of histidine, confirming a correlation between the mutations and the catalytic activity of the enzyme. Given the lack of studies on this type of mutations and their effect on protein structure, it is difficult to say whether this phenomenon is generalized. In spite of this, the data reported in this work represent a further step toward the comprehension of the relation existing between changes in a gene sequence, the structure of the encoded protein and the phenotypic effects they have.
  46 in total

1.  Imidazole glycerol phosphate synthase from Thermotoga maritima. Quaternary structure, steady-state kinetics, and reaction mechanism of the bienzyme complex.

Authors:  S Beismann-Driemeyer; R Sterner
Journal:  J Biol Chem       Date:  2001-03-22       Impact factor: 5.157

2.  Mutants of Escherichia coli requiring methionine or vitamin B12.

Authors:  B D DAVIS; E S MINGIOLI
Journal:  J Bacteriol       Date:  1950-07       Impact factor: 3.490

3.  Evidence for the existence of elaborate enzyme complexes in the Paleoarchean era.

Authors:  Bernd Reisinger; Josef Sperl; Alexandra Holinski; Veronika Schmid; Chitra Rajendran; Linn Carstensen; Sandra Schlee; Samuel Blanquart; Rainer Merkl; Reinhard Sterner
Journal:  J Am Chem Soc       Date:  2013-12-23       Impact factor: 15.419

4.  Mechanism for induction of adaptive mutations in Escherichia coli.

Authors:  L Boe
Journal:  Mol Microbiol       Date:  1990-04       Impact factor: 3.501

5.  A single sequence change destabilizes the influenza virus neuraminidase tetramer.

Authors:  J M Colacino; N Y Chirgadze; E Garman; K G Murti; R J Loncharich; A J Baxter; K A Staschke; W G Laver
Journal:  Virology       Date:  1997-09-15       Impact factor: 3.616

Review 6.  The TIM-barrel fold: a versatile framework for efficient enzymes.

Authors:  R K Wierenga
Journal:  FEBS Lett       Date:  2001-03-16       Impact factor: 4.124

7.  Chemical Evolution of a Bacterial Proteome.

Authors:  Michael Georg Hoesl; Stefan Oehm; Patrick Durkin; Elise Darmon; Lauri Peil; Hans-Rudolf Aerni; Juri Rappsilber; Jesse Rinehart; David Leach; Dieter Söll; Nediljko Budisa
Journal:  Angew Chem Int Ed Engl       Date:  2015-07-01       Impact factor: 15.336

8.  Evidence that F plasmid transfer replication underlies apparent adaptive mutation.

Authors:  T Galitski; J R Roth
Journal:  Science       Date:  1995-04-21       Impact factor: 47.728

9.  Starvation-associated mutation in Escherichia coli: a spontaneous lesion hypothesis for "directed" mutation.

Authors:  B A Bridges
Journal:  Mutat Res       Date:  1994-05-01       Impact factor: 2.433

10.  Multiomics Analysis Provides Insight into the Laboratory Evolution of Escherichia coli toward the Metabolic Usage of Fluorinated Indoles.

Authors:  Federica Agostini; Ludwig Sinn; Daniel Petras; Christian J Schipp; Vladimir Kubyshkin; Allison Ann Berger; Pieter C Dorrestein; Juri Rappsilber; Nediljko Budisa; Beate Koksch
Journal:  ACS Cent Sci       Date:  2020-11-20       Impact factor: 14.553

View more
  2 in total

1.  Genomic Analysis of Endophytic Bacillus-Related Strains Isolated from the Medicinal Plant Origanum vulgare L. Revealed the Presence of Metabolic Pathways Involved in the Biosynthesis of Bioactive Compounds.

Authors:  Giulia Semenzato; Tania Alonso-Vásquez; Sara Del Duca; Alberto Vassallo; Christopher Riccardi; Marco Zaccaroni; Nadia Mucci; Anna Padula; Giovanni Emiliani; Antonio Palumbo Piccionello; Anna Maria Puglia; Renato Fani
Journal:  Microorganisms       Date:  2022-04-27

2.  Microbial Genetics and Evolution.

Authors:  Sara Del Duca; Alberto Vassallo; Alessio Mengoni; Renato Fani
Journal:  Microorganisms       Date:  2022-06-23
  2 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.