Ola B Nilsson1, Rickard Hedman1, Jacopo Marino2, Stephan Wickles2, Lukas Bischoff2, Magnus Johansson3, Annika Müller-Lucks1, Fabio Trovato4, Joseph D Puglisi5, Edward P O'Brien4, Roland Beckmann2, Gunnar von Heijne6. 1. Department of Biochemistry and Biophysics, Center for Biomembrane Research, Stockholm University, 106 91 Stockholm, Sweden. 2. Gene Center and Center for Integrated Protein Science Munich, CiPS-M, Feodor-Lynen-Strasse 25, University of Munich, 81377 Munich, Germany. 3. Department of Cell and Molecular Biology, Biomedical Center, Uppsala University, Box 596, 751 24 Uppsala, Sweden. 4. Department of Chemistry, Pennsylvania State University, University Park, PA 16802, USA. 5. Department of Structural Biology, Stanford University School of Medicine, Stanford, CA 94305-5126, USA; Stanford Magnetic Resonance Laboratory, Stanford University School of Medicine, Stanford, CA 94305-5126, USA. 6. Department of Biochemistry and Biophysics, Center for Biomembrane Research, Stockholm University, 106 91 Stockholm, Sweden; Science for Life Laboratory, Stockholm University, Box 1031, 171 21 Solna, Sweden. Electronic address: gunnar@dbb.su.se.
Abstract
At what point during translation do proteins fold? It is well established that proteins can fold cotranslationally outside the ribosome exit tunnel, whereas studies of folding inside the exit tunnel have so far detected only the formation of helical secondary structure and collapsed or partially structured folding intermediates. Here, using a combination of cotranslational nascent chain force measurements, inter-subunit fluorescence resonance energy transfer studies on single translating ribosomes, molecular dynamics simulations, and cryoelectron microscopy, we show that a small zinc-finger domain protein can fold deep inside the vestibule of the ribosome exit tunnel. Thus, for small protein domains, the ribosome itself can provide the kind of sheltered folding environment that chaperones provide for larger proteins.
At what point during translation do proteins fold? It is well established that proteins can fold cotranslationally outside the ribosome exit tunnel, whereas studies of folding inside the exit tunnel have so far detected only the formation of helical secondary structure and collapsed or partially structured folding intermediates. Here, using a combination of cotranslational nascent chain force measurements, inter-subunit fluorescence resonance energy transfer studies on single translating ribosomes, molecular dynamics simulations, and cryoelectron microscopy, we show that a small zinc-finger domain protein can fold deep inside the vestibule of the ribosome exit tunnel. Thus, for small protein domains, the ribosome itself can provide the kind of sheltered folding environment that chaperones provide for larger proteins.
Cotranslational folding of proteins that have emerged from the ribosome exit tunnel has been studied for decades using either stalled ribosome-nascent chain complexes (RNCs) (Kolb et al., 2000; Kowarik et al., 2002; Kosolapov and Deutsch, 2009; Kaiser et al., 2011; Kelkar et al., 2012; Lin et al., 2012; Waudby et al., 2013; Nissley and O’Brien, 2014) or kinetic measurements (Nicola et al., 1999). Isolated elements of secondary structure and collapsed or partially structured folding intermediates have been detected inside the exit tunnel (Mingarro et al., 2000; Bhushan et al., 2010; Tu et al., 2014), but in no case has a protein domain been shown to be able to fold into its native structure while still inside the ribosome.On the basis of our finding that cotranslational processes such as protein translocation across, or insertion into, a membrane generate pulling forces on the nascent polypeptide chain (Ismail et al., 2012, 2015; Cymer and von Heijne, 2013), we previously suggested that proteins that start to fold cotranslationally while still in contact with the ribosome should exert a similar pulling force on the nascent chain (Ismail et al., 2012); that is, the free energy released by the folding reaction should be at least in part stored as an increased tension in the nascent chain (Figure 1A). This was recently confirmed in a study of cotranslational folding of the Top7 protein, a 93-residue protein that folds just outside the exit tunnel while exerting a force of ∼10 pN on the nascent chain (Goldman et al., 2015).
Figure 1
Cotranslational Folding of the ADR1a Zinc-Finger Domain
(A) Force measurement assay. The ADR1a domain is placed L residues away from the C-terminal Pro residue in the E. coli SecM AP. An unrelated segment from the E. coli LepB protein (LepB residues 78–226) is added to the N terminus in order to increase the size of the protein such that it can be readily visualized by SDS-PAGE, and a 23-residue C-terminal segment ensures that arrested and full-length forms of the protein can be easily separated on the gel. The LepB part is composed of five small β-hairpin segments that do not interact with one another in the LepB structure (PDB: 1B12) and hence cannot fold in itself. The cartoon below shows three ADR1a-AP constructs with different values of L (L1 < L2 < L3). The ribosomal tunnel is too tight for the protein to fold at L1, and the protein is already folded and outside the tunnel when the ribosome reasches the AP at L3. Only at L2 will folding of the protein against the widening ribosomal exit tunnel generate a pulling force F on the AP, leading to inefficient ribosomal stalling and an increase in the fraction full-length protein, fFL.
(B) Structure of ADR1a (PDB: 2ADR). The Zn2+ ion is shown in gold.
(C) In vitro translation the PURE system of the ADR1a-SecM (L = 24) (top) and ADR1a-SecM (L = 37) (bottom) constructs. Full-length (FL) and arrested (A) forms are indicated. Ac, control construct with a stop codon inserted directly after the AP; FLc, full-length control construct, where the critical Pro at the end of the AP is mutated to Ala; TPEN, translation carried out in the presence of 50 μM of the Zn2+ chelator TPEN; Zn2+, translation carried out in the presence of 50 μM Zn2+.
(D) Fraction full-length protein, fFL, plotted as a function of L for the ADR1a-AP constructs translated in the PURE in vitro system either in the absence (blue curve; to deplete the translation mix of Zn2+, the Zn2+ chelator TPEN was included at 50 μM) or presence (red curve) of 50 μM Zn2+. SEMs are indicated.
See also Figures S1 and S2.
Here, we have set out to follow the folding of a protein domain as it progressively moves out of the ribosome in step with chain elongation, using an assay that takes advantage of the force sensitivity of translational arrest peptides (APs) (Butkus et al., 2003; Ismail et al., 2012; Goldman et al., 2015). APs from bacterial SecM proteins are exquisitely sensitive to the tension present in the nascent chain at the precise moment when the ribosome translates the last codon in the AP, with the efficiency of the translational arrest being reduced in proportion to an increase in tension (Ismail et al., 2012, 2015; Goldman et al., 2015). By making a series of constructs in which a suitable AP is separated by a varying number of residues, L, from the protein to be studied and measuring the efficiency of translational arrest for each value of L, we can obtain an indirect measure of the instantaneous tension in the nascent chain during translation. We now demonstrate that such “force profiles” appear to give a direct insight into the folding transition that a protein undergoes as it passes down the exit tunnel. We compare the experimental profile recorded for a small zinc-finger domain with folding simulations based on coarse-grained molecular dynamics and determine the location of the domain inside the ribosome exit tunnel at the point of maximal folding force by cryo-EM (electron microscopy). Our results show that small protein domains can fold while still in the exit tunnel and establish the use of AP-mediated force measurements for the study of cotranslational protein folding.
Results
To explore the possibility of protein folding inside the exit tunnel, we chose the second of the two zinc-finger domains in the yeast ADR1 protein (Párraga et al., 1988) (Figure 1B). The domain (called ADR1a) is 29 residues long and folds around a Zn2+ ion using two histidines and two cysteines to chelate the ion. The folding of ADR1a is totally dependent on the presence of Zn2+ (Párraga et al., 1988) and can hence be easily manipulated (Conti et al., 2014). Moreover, the protein is small enough that it might be able to fold inside the exit tunnel, a possibility suggested by previous theoretical studies (O’Brien et al., 2010, 2011).We made a series of constructs in which ADR1a is placed L residues upstream of the critical C-terminal Pro residue in the relatively weakly stalling Escherichia coli SecM AP (Yap and Bernstein, 2009; Ismail et al., 2012; Goldman et al., 2015), which in turn is 23 residues upstream of the stop codon (Figure 1A; see Figure S1 for amino acid sequences). In constructs in which there is little tension in the nascent chain at the precise moment when the ribosome reaches the critical Pro codon, the ribosome will stall on the AP and a short, arrested version of the protein will be produced. In contrast, in constructs in which there is high tension (∼10 pN or more; Goldman et al., 2015) in the nascent chain at this moment, stalling will be inefficient, and mostly full-length protein will be produced. The fraction full-length protein, fFL, can therefore serve as a proxy for the tension in the nascent chain, as shown in previous studies (Ismail et al., 2012, 2015).
ADR1a Folds inside the Ribosome Exit Tunnel
Translation of ADR1a-SecM constructs in the PURE in vitro translation system (Shimizu et al., 2001, 2005), either in a Zn2+-depleted translation mix or in the presence of 50 μM Zn2+ (Figures 1C and 1D), showed efficient stalling in the absence of Zn2+ (fFL ≈ 0.1 for all values of L). In the presence of Zn2+, the picture is dramatically different, with fFL starting to increase at L ≈ 20 residues, going through a sharp maximum at Lmax = 24–26 residues and returning to baseline at L ≈ 30 residues. Mutating one or both of the Zn2+-binding His residues in ADR1a-SecM (L = 24) to Ala returns fFL to baseline (Figure S2A). Translation of ADR1a-SecM constructs in an E. coli S135 extract yields similar results, albeit with a lower maximal value of fFL (Figure S2B). Titration of Zn2+ in the S135 extract translation reaction shows that the half-maximal fFL value is reached at [Zn2+] ≈ 1 μM (Figure S2C); Zn2+ dissociation constants for typical zinc-finger domains are in the range 0.1–2 μM (Rich et al., 2012). A small signal can also be detected at Lmax = 25–27 residues when the constructs are expressed in live E. coli cells in the absence or presence of 500 μM Zn2+ in the medium (Figure S2B). We conclude that ribosomal stalling on the SecM AP is prevented when ADR1a folds and that, as it takes about 30 residues of extended nascent chain to span the ∼100 Å from the P-site to the tunnel exit (Bhushan et al., 2011), ADR1a folds inside the exit tunnel. This conclusion holds regardless of whether translation is carried out in vitro or in vivo.
Analysis of Ribosome Stalling on the SecM AP by Single-Ribosome Tracking
To characterize the effect of protein folding on the AP-induced translational arrest in more detail, we applied real-time fluorescence resonance energy transfer (FRET)-based single-ribosome tracking of ribosomes translating the ADR1a-SecM (L = 24) construct, that is, a construct for which there is very little stalling at 50 μM Zn2+ (see Figure 1C). In this case, the N-terminal 158-residue-long segment upstream of ADR1a was deleted (compare Figures 1A and S1). Using a previously established method of attaching fluorescent probes to the large and small ribosomal subunits, the transitions between the non-rotated and rotated states of individual ribosomes can be tracked as they translate along an mRNA (Marshall et al., 2008) (Figures 2A and S3), providing translation times at each codon. As shown in Figure 2B, very few ribosomes translate beyond the AP when translation of the ADR1a-SecM (L = 24) construct is carried out in the absence of Zn2+, as has been shown previously for another SecM construct (Tsai et al., 2014). Mutating the critical Pro residue at the end of the AP to Ala inhibits stalling, as expected (Figure 2C). Strikingly, when translation of the ADR1a-SecM (L = 24) construct is carried out in the presence of 50 μM Zn2+, stalling is completely inhibited, and ribosomes progress unhindered beyond the AP (Figure 2D), providing additional evidence of a SecM AP response to the folding of ADR1a. The complete disappearance of the stalling signal in the presence of Zn2+ (i.e., no long dwells in the rotated state beyond codon 48 or in the non-rotated state at codons around Pro54, compare Figures 2B and 2D) suggests that folding of the ADR1a domain occurs on a significantly shorter timescale than the elongation timescale in the experimental setup (∼5 s per codon) and that the pulling force exerted by the ADR1a domain is present already when the ribosome is a few codons upstream of the critical Pro54 codon, in accordance with the data shown in Figure 1D. It should be noted that the mRNA construct in the present study is much longer than what has been used before in these types of experiment (Tsai et al., 2014) and that uncertainty in codon assignment increases with codon number because of possible mis-assignments of state transitions (e.g., because of fluorophore blinking or very fast state transitions). However, an uncertainty in exact codon numbering around the arrest codons does not affect our conclusions.
Figure 2
Folding of the ADR1a Domain Prevents Ribosomal Stalling on the SecM AP
(A) The dynamics of ADR1a-SecM (L = 24; Δ1–158) translation were assayed in real time using inter-subunit FRET between Cy3B and BHQ-2. Transition from low Cy3B intensity (high FRET) to high intensity (low FRET) and back to low intensity again, as a consequence of the inter-subunit rotations, reports on one elongation cycle (i.e., peptidyl transfer and subsequent translocation). The time-trace example shows how one ribosome translates the whole ADR1a-SecM (L = 24) ORF in a construct in which the critical C-terminal Pro54 in the AP has been changed to Ala.
(B) Survival plot (left) and lifetimes of the rotated and non-rotated states (right) for each individual codon summarized from ADR1a-SecM (L = 24) translation time traces (n = 149). The critical Pro54 codon is shown in red for clarity.
(C) Inter-subunit FRET data from elongation of an ADR1a-SecM (L = 24) construct in which the Pro54 has been changed to Ala (n = 147).
(D) Inter-subunit FRET data from elongation of the ADR1a-SecM (L = 24) construct in the presence of 50 μM Zn2+ (n = 147). Lifetimes are fitted to single-exponential distributions. SEMs are indicated.
See also Figure S3.
Molecular Dynamics Modeling of ADR1a Folding in the Exit Tunnel
We next used a previously developed coarse-grained molecular dynamics protocol (O’Brien et al., 2010) to ask whether, as suggested by the fFL profile measurements, there is enough room in the exit tunnel to allow folding of ADR1a. ADR1a-SecM constructs with different tether lengths were modeled into a high-resolution structure of the E. coli ribosome (Zhou et al., 2012), and replica-exchange Langevin dynamics (Sugita and Okamoto, 1999) were run at each tether length. Figure 3A shows the probability that the ADR1a segment is found in its folded state as a function of tether length. The folding transition is predicted to take place over the interval L ≈ 24–32 residues with a midpoint at L = 28 residues (i.e., at ∼3 residues higher L values than seen in the force profile). Analysis of the data obtained with a tether length of L = 25 residues shows that folded ADR1a is found in the exit tunnel, with His21 located at a distance of 65–75 Å from the tRNA (Figure 3B, top). To provide a comparison with the cryo-EM results reported below, a simulation of the L = 25 construct was also carried out at T = 140 K, just above the water glass transition temperature; under these conditions, folded ADR1a is found in a more restricted portion of the exit tunnel, with His21 located 65–67 Å from the tRNA (Figure 3B, bottom).
Figure 3
Molecular Dynamics Simulation of Cotranslational Folding of ADR1a
(A) The probability that the ADR1a domain is folded at 37°C is plotted as a function of L.
(B) Distance distribution of the folded (root-mean-square deviation [rmsd] < 3.5 Å from the cryo-EM ADR1a model, after alignment of the isolated domains; red) and unfolded (rmsd > 5.5 Å from the cryo-EM ADR1a model; blue) ADR1a domains in the exit tunnel. Distance distributions were calculated as a function of the distance between the last P atom in the tRNA of the cryo-EM structure and the Cα of His21 in ADR1a (2Å bins). Alignment of the cryo-EM and simulated ribosome structures was performed in advance. Top: Simulation run at 310 K. Bottom: Simulation run at 140 K. The arrow indicates the distance between the tRNA and His21 in the cryo-EM reconstruction.
(C) Snapshot of the folded structure of ADR1a (green) from the 140 K simulation that best overlaps the cryo-EM structure (red) in the exit tunnel at tether length L = 25. His21 is displayed in in its coarse-grained two-ball representation for the simulation model and in ball-and-stick representation for the cryo-EM structure.
Visualization of ADR1a in the Exit Tunnel by Cryo-EM
To confirm that ADR1a folds inside the exit tunnel, we sought to visualize it in the ribosome at tether length L = Lmax (i.e., at the top of the fFL profile; Figure 1D) by cryo-EM. Because, with the relatively weak SecM AP from E. coli, fFL ≈ 1 at L = Lmax, stably stalled ribosome-ADR1a-SecM complexes of this kind cannot be isolated. We therefore introduced the previously described strongly stalling SecM (Ms-Sup1) AP (Ismail et al., 2012) instead (Figure S4A). Using the ADR1a-SecM (Ms-Sup1; L = 25) construct (with an added N-terminal purification tag and lacking the 158-residue-long segment upstream of ADR1a; compare Figure 1A), we purified stalled RNCs from a translation reaction in the PURE system supplemented with 50 μM Zn2+ (Figures S4B and S4C) and obtained a 4.8 Å 3D reconstruction by cryo-EM (Figures 4 and S4D–S4F). Parts of the SecM AP can be seen in the exit tunnel, as well as the P-site tRNA. Strikingly, an extra density, not present in empty ribosomes, is clearly visible in the exit tunnel, ∼60 Å from the tRNA (Figure 4A). Rigid-body docking of a molecular model of ADR1a derived from nuclear magnetic resonance (NMR) analysis (Protein Data Bank [PDB]: 2ADR) revealed an excellent fit, with a cross-correlation of 0.93 between the model and the density. The ADR1a domain is lodged between ribosomal proteins uL22 and uL23 and ribosomal rRNA helices H23, H24, and H50 (Figure 4C) and is located a few angstroms deeper in the exit tunnel in the cryo-EM reconstruction than in the ensemble of folded structures seen in the 140 K molecular dynamics trajectory (Figure 3B, bottom, arrow). The ADR1a snapshot structure (gold) from the 140 K simulation ensemble that best fits the cryo-EM reconstruction (red) in the exit tunnel is shown in Figure 3C.
Figure 4
Visualization by Cryo-EM of the ADR1a Domain in a Stalled Ribosome-ADR1a-SecM (Ms-Sup1; L = 25) Complex
(A) Schematic of the construct used for in vitro translation (top) and cryo-EM reconstructions of stalled E. coli ribosome-SecM-ADR1a complexes (left). The 30S subunit is depicted in yellow, the 50S subunit in gray, and the peptidyl-tRNA with the nascent polypeptide chain in green. Additionally, a cross-section through the cryo-EM density is shown in which the density for the nascent chain and the ADR1a domain (PDB: 2ADR) are depicted in green and red, respectively. A close-up of the tunnel and a schematic view are shown with the structure of the ADR1a domain fitted as rigid body depicted in red.
(B) Isolated density for the ADR1a domain (red) shown at different contour levels (top) compared with corresponding densities calculated from the NMR-derived molecular model of ADR1a (middle). Isolated cryo-EM density is shown transparent with the docked model (red) and the coordinated Zn2+ ion in yellow (bottom).
See also Figure S4.
Discussion
Here, we present an integrated approach to the study of cotranslational protein folding, in which the folding transition as a function of position relative to the exit tunnel is mapped by AP-mediated force measurements and molecular dynamics simulations. The location of the partially or fully folded protein or protein domain in the ribosome at relevant L values is then determined by mutating the AP such that it can withstand the folding force (see Cymer et al., 2015, for a large collection of APs of different stalling potency) and determining the structure of the resulting RNCs by cryo-EM. Using this approach, we show that the small zinc-finger domain ADR1a folds cotranslationally as the tether connecting it to the ribosome grows in length from ∼20 to ∼30 residues. Both coarse-grained molecular dynamics simulation and cryo-EM visualization of ribosome-bound ADR1a at a tether length corresponding to the midpoint of the folding transition show ADR1a buried deep in the vestibule of the exit tunnel, providing a clear demonstration that small proteins or protein domains can fold within the ribosome, as predicted by computational studies (O’Brien et al., 2010, 2011). Although the zinc finger is one of the smallest independently folding protein domains, it has been estimated that ∼9% of all structural domains found in the PDB are less than 40 residues long, and ∼18% are less than 60 residues long (Wheelan et al., 2000). Folding of protein domains wholly or partly inside the exit tunnel may thus be not too uncommon, despite its relatively constrained geometry (Voss et al., 2006).Although we cannot completely rule out that ADR1a relieves the translational stall not by exerting a pulling force but by some kind of indirect mechanism whereby, for example, interactions between folded ADR1a and the tunnel wall give rise to a long-range (>60 Å) allosteric effect on the peptidyl transferase center, we consider this unlikely. First, published 3.5–5.5 Å resolution cryo-EM structures of SecM and MifM APs stalled in the exit tunnel show conformational changes in the ribosome only close to the peptidyl transferase center (Bhushan et al., 2011; Sohmen et al., 2015), and not over such long distances as would be required for an allosteric effect of ADR1a. Second, direct pulling on a stalled SecM AP by optical tweezers shows that the mean life time of the stalled state is reduced in proportion to the pulling force (Goldman et al., 2015). Third, qualitatively similar effects on fFL as seen with ADR1a are seen when pulling forces are induced by processes as diverse as the insertion of a transmembrane helix into the inner membrane (Ismail et al., 2012), the translocation of negatively charged residues across the inner membrane (Ismail et al., 2015), and folding of a larger protein, Top7, just outside the exit tunnel (Goldman et al., 2015). The most parsimonious hypothesis is thus that, also for ADR1a, it is the pulling force rather than some ADR1a-specific allosteric interaction with the tunnel wall that is responsible for the variation in fFL with L.Taken together with a recent study of the Top7 protein (Goldman et al., 2015), our results demonstrate that APs can be used to study folding both inside and outside the exit tunnel; optical tweezer measurements (Goldman et al., 2015) or comparison of AP-based fFL measurements with forces calculated from a physical model of the same process (Ismail et al., 2015) can provide estimates of the relation between the actual folding force (in piconewtons) and fFL. Future studies will allow more precise definitions of how the size and shape of a protein domain dictate where it folds in relation to the exit tunnel and may allow us to probe the interactions between a cotranslationally folding protein and, for example, chaperones or cofactors of various kinds as a function of its degree of exposure outside the ribosome.
Experimental Procedures
Plasmids
All ADR1a constructs were generated from the previously described pING1 plasmid carrying a truncated lepB gene containing a [6L,13A] H segment insert and the E. coli SecM AP under the control of an arabinose-inducible promoter (Ismail et al., 2012), as detailed in the Supplemental Information. For RNA transcription using the T7 promoter, all constructs were subcloned into plasmid pET19b (Novagen) using NcoI and BamHI.
In Vitro Transcription and Translation
In vitro transcription was performed with T7 RNA polymerase according to the manufacturer’s protocol (Promega) using PCR products as templates for the generation of truncated nascent chains. RNA obtained was purified using RNeasy Mini Kit (Qiagen). Translation was performed in the commercially available PUREfrex system (Shimizu et al., 2005) and in a Zn2+-free S135 E. coli extract (Welte et al., 2012) modified from Schwarz et al. (2007). Proteins were separated by SDS-PAGE, visualized on a Fuji FLA-3000 phosphoimager, and quantified. Values of fFL were calculated as fFL = IFL/(IFL + IA), where IFL is the intensity of the band corresponding to the full-length protein, and IA is the intensity of the band corresponding to the arrested form of the protein (compare Figure 1C). Experiments were repeated three times, and SEMs were calculated.
In Vivo Pulse-Labeling Analysis
Expression of ADR1a-SecM constructs in E. coli MC1061 cells was induced with arabinose for 5 min. ZnCl2 was added to a final concentration of 0.5 mM at the point of induction. Cells were then pulse-labeled with [35S]-Met for 2 min at 37°C, trichloroacetic acid-precipitated, and prepared for SDS-PAGE analysis.
Single-Ribosome Inter-Subunit FRET Experiments
fMet-tRNAfMet-bound 30S pre-initiated complexes, Cy3B labeled on the 16S rRNA (Marshall et al., 2008), were formed on the ADR1a-SecM (L = 24; Δ1–158) mRNA constructs and immobilized to the surface of pre-treated zero-mode waveguide (ZMW) chips through hybridization of the mRNAs to biotinylated splint DNA oligos (Tsai et al., 2014). Elongation mixtures were delivered to the ZMW chips in a modified PacBio RS sequencer whereby all individual ZMWs are illuminated with 532 nm laser and fluorescence data are acquired over time (Tsai et al., 2014). Preparation of native or fluorophore-labeled biomolecules was performed as described in Johansson et al. (2014). The elongation reactions were carried out in a Tris-based polymix buffer at 20°C in the presence of 1 μM IF2, 4 mM guanosine triphosphate, 2 mM Trolox, and a protocatechuic acid/protocatechuate-3,4-dioxygenase oxygen-scavenging system. Fluorescence data were collected at 10 Hz for 10 min and filtered and analyzed using MATLAB (The MathWorks) scripts, as has been described previously (Tsai et al., 2014).
Molecular Dynamics Simulations
The cotranslational folding curve of the ribosome-ADR1a nascent chain complex was calculated on an arrested ribosome using the coarse-grained model of O’Brien et al (2011, 2012). In the simulations, the 50S subunit of the E. coli ribosome (PDB: 3UOS) and the nascent chain are explicitly represented. Zinc ions were not represented in the simulation; instead their effect on protein stability was implicitly accounted for by linearly scaling the Lennard-Jones well depth of residue pairs that are in contact in the native state (O’Brien et al., 2011, 2012) such that the stability of the folded zinc finger in isolation was equal to −2.0 kcal/mol at 310 K. ADR1a was then covalently attached to unstructured linkers having the same sequences as used in the experiments (see Figure S1). At each linker length, replica-exchange simulations (Sugita and Okamoto, 1999) were run with eight temperature windows ranging between 290 and 370 K.
Cloning and Purification of ADR1a-SecM (Ms-Sup1; L = 25) RNCs
The E. coli SecM stalling sequence in the ADR1a-SecM (L = 25) construct was modified by mutating five residues to obtain the Sup1 version of the Mannheimia succiniciproducens SecM AP (HPPIRGSP) (Yap and Bernstein, 2009), yielding ADR1a-SecM (Ms-Sup1; L = 25). The construct was subsequently cloned into the p7XNH vector. The final sequence used was MHHHHHHHHHHLEVLFQGPSYPYDVPDYAKPYPCGLCNRCFTRRDLLIRHAQKIHSGNSGSGVMSSFSTPVWISQHPPIRGSPA, including N-terminal His10-CT-HA tags for purification.In vitro translation in the presence of 50 μM ZnCl2 was performed using 500 μl of the PURE system (NEB) following the manufacturer’s instructions. RNCs were prepared as described in the Supplemental Information.
Cryo-EM Specimen Preparation, Data Collection, Processing, and Model Building
Carbon-coated holey grid preparation of ADR1a-SecM (Ms-Sup1; L = 25) RNCs was carried out as described previously (Bischoff et al., 2014). Cryo-EM data were collected on a Titan Krios TEM (FEI) operated at 300 keV and equipped with a back-thinned Falcon II (FEI) direct electron detector, as described in the Supplemental Information.All processing was performed using the SPIDER software package (Frank et al., 1996). The final data set contained 151,900 particles and was refined to a final average resolution of 4.8 Å according to the Fourier shell correlation criterion at a cutoff of 0.14.For structural comparison and interpretation of the cryo-EM density obtained, we fitted the structure of the E. coli 70S ribosome (PDB: 3OFR) using UCSF Chimera (Pettersen et al., 2004). A poly-alanine model of the SecM-stalled nascent chain was built on the basis of the model of a TnaC stalled peptide (PDB: 4YU8) (Bischoff et al., 2014). The extra density at the end of the stalled SecM was compared with PDB-derived density maps of the ADR1a domain (PDB: 2ADR) at different resolutions and contour levels. Finally, the structure of the ADR1a domain was rigid-body-fitted according to the highest cross-correlation between the density model maps and the electron density.
Author Contributions
G.v.H, R.B., E.P.O. and J.D.P. conceived the project. O.B.N., R.H., J.M., L.B., M.J. and A.M.-L. designed and performed the experiments. J.M., S.W., L.B., M.J., F.T., and E.P.O. performed the computational analyses. G.v.H wrote the manuscript with input from all other authors.
Authors: Anne M Rich; Elisa Bombarda; Austin D Schenk; Paul E Lee; Elizabeth H Cox; Anne M Spuches; Lynn D Hudson; Bruno Kieffer; Dean E Wilcox Journal: J Am Chem Soc Date: 2012-06-14 Impact factor: 15.419
Authors: Daniel H Goldman; Christian M Kaiser; Anthony Milin; Maurizio Righini; Ignacio Tinoco; Carlos Bustamante Journal: Science Date: 2015-04-23 Impact factor: 47.728
Authors: Daniel Sohmen; Shinobu Chiba; Naomi Shimokawa-Chiba; C Axel Innis; Otto Berninghausen; Roland Beckmann; Koreaki Ito; Daniel N Wilson Journal: Nat Commun Date: 2015-04-23 Impact factor: 14.919
Authors: Christopher A Waudby; Hélène Launay; Lisa D Cabrita; John Christodoulou Journal: Prog Nucl Magn Reson Spectrosc Date: 2013-07-27 Impact factor: 9.795
Authors: Khanh Dao Duc; Sanjit S Batra; Nicholas Bhattacharya; Jamie H D Cate; Yun S Song Journal: Nucleic Acids Res Date: 2019-05-07 Impact factor: 16.971
Authors: Avi J Samelson; Madeleine K Jensen; Randy A Soto; Jamie H D Cate; Susan Marqusee Journal: Proc Natl Acad Sci U S A Date: 2016-11-07 Impact factor: 11.205
Authors: Florian Wruck; Alexandros Katranidis; Knud H Nierhaus; Georg Büldt; Martin Hegner Journal: Proc Natl Acad Sci U S A Date: 2017-05-15 Impact factor: 11.205
Authors: Zheng Liu; Cristina Gutierrez-Vargas; Jia Wei; Robert A Grassucci; Madhumitha Ramesh; Noel Espina; Ming Sun; Beril Tutuncuoglu; Susan Madison-Antenucci; John L Woolford; Liang Tong; Joachim Frank Journal: Proc Natl Acad Sci U S A Date: 2016-10-10 Impact factor: 11.205