Botulinum neurotoxins (BoNTs) are the most lethal toxin known to human. Biodefense requires early and rapid detection of BoNTs. Traditionally, BoNTs can be detected by looking for signs of botulism in mice that receive an injection of human material, serum or stool. While the living animal assay remains the most sensitive approach, it is costly, slow and associated with legal and ethical constrains. Various biochemical, optical and mechanical methods have been developed for BoNTs detection with improved speed, but with lesser sensitivity. Here, we report a novel nanopore-based BoNT type B (BoNT-B) sensor that monitors the toxin's enzymatic activity on its substrate, a recombinant synaptic protein synaptobrevin 2 derivative. By analyzing the modulation of the pore current caused by the specific BoNT-B-digested peptide as a marker, the presence of BoNT-B at a subnanomolar concentration was identified within minutes. The nanopore detector would fill the niche for a much needed rapid and highly sensitive detection of neurotoxins, and provide an excellent system to explore biophysical mechanisms for biopolymer transportation.
Botulinum neurotoxins (BoNTs) are the most lethal toxin known to human. Biodefense requires early and rapid detection of BoNTs. Traditionally, BoNTs can be detected by looking for signs of botulism in mice that receive an injection of human material, serum or stool. While the living animal assay remains the most sensitive approach, it is costly, slow and associated with legal and ethical constrains. Various biochemical, optical and mechanical methods have been developed for BoNTs detection with improved speed, but with lesser sensitivity. Here, we report a novel nanopore-based BoNT type B (BoNT-B) sensor that monitors the toxin's enzymatic activity on its substrate, a recombinant synaptic protein synaptobrevin 2 derivative. By analyzing the modulation of the pore current caused by the specific BoNT-B-digested peptide as a marker, the presence of BoNT-B at a subnanomolar concentration was identified within minutes. The nanopore detector would fill the niche for a much needed rapid and highly sensitive detection of neurotoxins, and provide an excellent system to explore biophysical mechanisms for biopolymer transportation.
Entities:
Keywords:
biosensor; botulinum; nanopore; neurotoxin; peptide; single molecules
Botulinum neurotoxins
(BoNTs) are the most poisonous substances known to human, with a median
lethal dose (LD50) of 1 ng per kg of body weight,[1] and are the cause of the life-threatening neuroparalytic
illness botulism.[2] BoNTs are regarded as
potential biological warfare agents that could be used for bioterrorism
attacks on the food chain. Of the seven known serotypes of botulinum
neurotoxins (BoNTs), designated A-G, BoNT-A, -B, -E and -F are toxic
to humans.[3] They are mainly produced by Clostridium botulinum and released from this bacillus
as single polypeptide chains. After cleavage by bacterial or host
proteases, these polypeptides adopt an active dichain form of toxin,
which consists of a 100 kDa heavy (H) chain linked to 50 kDa light
(L) chain by a disulfidebond. H chains control cellular internalization
of the toxins via receptor-mediated endocytosis, allowing them to
preferentially attack the nervous system. Upon endocytosis of the
holo-protein, the L chain is translocated from the vesicular lumen
into the cytosol, where it acts as a Zn2+-endopeptidase
to specifically cleave components of the soluble N-ethylmaleimide-sensitive
fusion protein attachment protein receptor (SNARE) complex, and thus
hampers exocytosis and neurotransmitter release. Currently, worldwide
geographical distributions of BoNTs, which are dictated by the type
of foods that serve as the toxins source, have started to blur owing
to the ever increasing international trade of food products. Moreover,
the majority of new cases of BoNT intoxication have a trend to be
associated with drug use, in particular that of black tar heroin.[4] Owing to the ease of distribution of BoNTs, along
with their potency, the Centers for Disease Control and Prevention
(CDC) in Atlanta, Georgia, lists BoNTs as one of the six most dangerous
bioterrorist threats.[5] On the other hand,
due to their specific actions, BoNTs are the first toxins licensed
for human use in the United States to treat muscle dysfunctions/spasms[1] and associated skin wrinkles.[6]Both bioterrorism defense and medical attention require
an early and rapid detection of BoNTs. Traditionally, this is accomplished
by looking for signs of botulism in mice that receive an injection
of human serum or stool samples.[5] Although
this bioassay remains the most sensitive detection approach, it is
costly, slow (takes days), associated with legal and ethical constraints
and is restricted to the CDC along with some state health department
laboratories. Besides the use of living animals in detection, various
biochemical assays, such as electrophoresis and immunoblot analysis
have been used to detect the cleavage of specific SNARE proteins.[7−9] These in vitro detections are faster (within 1 day), but with reduced
sensitivity, compared to the mousebioassay. The subsequent development
of time-resolved fluorescence-based enzyme-linked immunosorbent assays
(ELISA)[10] allowed utilizing Eu3+-tagged antibodies[11] to detect BoNT-A
and -B. ELISA sped up the outcome of BoNT assays to hours. Within
a similar time-frame, the BoNT-A activity can also be monitored using
the substrate SNAPtide, a fluorescently conjugated synthetic peptide
that contains the native cleavage site for BoNT-A.[12] Recent developments in mechano- and fluorescence resonance
energy transfer (FRET)-based sensors offer a reduced detection time
and/or increased sensitivity. The micromechanosensor uses force spectroscopy
to detect BoNT-B.[13] This toxin cleaved
synaptobrevin 2 (Sb2) [reviewed in refs (14) and (15)] attached to a bead, which was suspended off a cantilever
via Sb2 interaction with syntaxin 1A attached to the cantilever. The
detachment of the bead from the cantilever marked the cleavage of
Sb2, allowing detection of low nanomolar range of BoNT-B within 15
min.[13] Additionally, in vitro detection
using FRET probes that contain fragments of SNARE proteins as toxin
substrates shows picomolar sensitivity within 4−16 h.[16] Although the two latter assays are very promising
for practical use, they require expensive and technically complex
equipment. Overall, there is a need for further development of assays
for detection of BoNTs.Nanopore technology provides a single-molecule
platform for sensitive biodetection.[17−20] Target molecules interacting
with a nanopore can specifically modulate the pore’s ion current.
The resulting single-molecule signatures can be analyzed to report
both the target identity and quantity. The nanopore sensor has been
extensively explored for nucleic acids structural detections[21−25] and is being developed as a next-generation sequencing technology.[26,27] We also utilized the nanopore-based sensor to detect biomarker nucleic
acids such as microRNAs for disease diagnostics.[28,29] Recently, the nanopore approach has demonstrated its power in analyzing
peptide/protein processes, from peptide–nanopore interactions,[30,31] protein unfolding[32,33] and peptide–metal ion
interaction,[34] to peptide translocation,[35] peptide modification[36] and protein sensing.[37,38] Notably, the nanopore can reveal
the function of enzymes through analyzing the enzyme-processed peptides.[36,39−41] In this report, we describe a nanopore-based assay
for detection of BoNT-B. We utilized the emerging aerolysin pore[42−45] to track the BoNT-B digestion of its substrate, a derivative of
the synaptic protein Sb2 (also known as vesicle-associated membrane
protein 2, VAMP2).[7] The dynamic change
of the specific digestion product reported the existence of the toxin
at subnanomolar concentration within minutes. We also demonstrate
the specificity of detection in serum, a blood-derived material that
is presently used for detection of the toxin presence in human. This
system also demonstrates usefulness in studying biophysical mechanisms
for peptide translocation and interaction with the nanopore.
Results
Design
of Synaptobrevin 2 Substrate Protein for Nanopore Detection of BoNT-B
The BoNT-B light chain is a Zn2+-endopeptidase that
specifically cleaves the synaptic protein Sb2.[7] To detect BoNT-B, we designed a recombinant derivative of Sb2, Lp-Sb2(1-93),
which contains the truncated Sb2 cytoplasmic domain [amino acids (aa)
1-93] appended to the C-terminus of a 36 aa lead peptide (Lp) (Figures 1a and S1, Supporting Information). Six histidines at the N-terminus of Lp-Sb2(1-93) ease the protein
purification. In the presence of Zn2+, the BoNT-B light
chain can cleave Lp-Sb2(1-93) into two fragments, the long N-terminal
Lp-Sb2(1-76)d and the short C-terminal Sb2(77-93)d. Due to the characteristics
of these digests (Table S1, Supporting Information), we posit that they generate different signals in the nanopore
current recordings (Figure 1b), which we experimentally
tested. For simplicity, we refer to the toxin’s light chain
as BoNT-B.
Figure 1
Schematized principle of BoNT-B detection using aerolysin nanopore.
(a) BoNT-B substrate design and its cleavage products. The 116 aa
vesicular exocytotic protein synaptobrevin 2 (Sb2, red; linearized
form shown to the right) spans the vesicular membrane. Its N-terminus
is located in the cytosol with its cytosolic domain being a target
for proteolytic (Zn2+-endopeptidase) activity of BoNT-B
light chain, which in the presence of Zn2+ cleaves (indicated
by scissors, left) the Q76-F77 peptide bond (yellow band, right).
The recombinant protein, Lp-Sb2(1-93), contains truncated cytoplasmic
domain (left, truncation site indicated by arrow) aa 1–93 appended
to the C-terminus of the lead peptide (Lp; right, black); six histidine
residues (right, turquoise) in the lead peptide ease the purification
of this chimera. The digested products, Lp-Sb2(1-76)d and Sb2(77-93)d,
are generated by BoNT-B/Zn2+ digestion of Lp-Sb2(1-93)
substrate. Drawings are not to scale (see Figure S1, Supporting Information, for detailed information). (b) Illustration
of the principle for nanopore BoNT-B detection. Lp-Sb2(1-93) (based
on structure PDB ID code 2KOG in the Protein Data Bank (www.pdb.org))
would not affect the pore current, as shown by the hypothetical trace
below the structure. After the cleavage of Lp-Sb2(1-93) by BoNT-B/Zn2+ (arrow), the short digested product Sb2(77-93)d would generate
a distinct modulation of pore currents, as shown by downward transient
blocks in the hypothetical trace, while the long product Lp-Sb2(1-76)d
would not affect the nanopore current. Dotted lines are levels of
zero current. Analytes would be applied from the cis (pore vestibule)
side of the bilayer that partitions the recording chamber.
Schematized principle of BoNT-B detection using aerolysin nanopore.
(a) BoNT-B substrate design and its cleavage products. The 116 aa
vesicular exocytotic protein synaptobrevin 2 (Sb2, red; linearized
form shown to the right) spans the vesicular membrane. Its N-terminus
is located in the cytosol with its cytosolic domain being a target
for proteolytic (Zn2+-endopeptidase) activity of BoNT-B
light chain, which in the presence of Zn2+ cleaves (indicated
by scissors, left) the Q76-F77 peptide bond (yellow band, right).
The recombinant protein, Lp-Sb2(1-93), contains truncated cytoplasmic
domain (left, truncation site indicated by arrow) aa 1–93 appended
to the C-terminus of the lead peptide (Lp; right, black); six histidine
residues (right, turquoise) in the lead peptide ease the purification
of this chimera. The digested products, Lp-Sb2(1-76)d and Sb2(77-93)d,
are generated by BoNT-B/Zn2+ digestion of Lp-Sb2(1-93)
substrate. Drawings are not to scale (see Figure S1, Supporting Information, for detailed information). (b) Illustration
of the principle for nanopore BoNT-B detection. Lp-Sb2(1-93) (based
on structure PDB ID code 2KOG in the Protein Data Bank (www.pdb.org))
would not affect the pore current, as shown by the hypothetical trace
below the structure. After the cleavage of Lp-Sb2(1-93) by BoNT-B/Zn2+ (arrow), the short digested product Sb2(77-93)d would generate
a distinct modulation of pore currents, as shown by downward transient
blocks in the hypothetical trace, while the long product Lp-Sb2(1-76)d
would not affect the nanopore current. Dotted lines are levels of
zero current. Analytes would be applied from the cis (pore vestibule)
side of the bilayer that partitions the recording chamber.
Nanopore Detection of BoNT-B-Digested Sb2
Fragments
The background ion current through an empty aerolysin
pore was 62.7 ± 0.9 pA (IRMS = 1.6
pA) at +120 mV in 1 M KCl (Figure 2a). This
background current was unaffected when BoNT-B (500 pM) or Lp-Sb2(1-93)
(20 nM) alone or combined with Zn2+ (100 nM) was presented
to the cis recording solution (Figure S2, Supporting
Information), indicating that each reactant, substrate or toxin
protein alone, does not interact with the aerolysin pore. However,
when Lp-Sb2(1-93) (20 nM) was mixed with BoNT-B (500 pM) in the presence
of Zn2+ (100 nM) in the cis solution for 30 min, we recorded
a series of transient blocks of nanopore current (Figure 2b). After incubation for 180 min, these events became
more frequent (Figure 2c). Given that each
reactant alone cannot block the pore (Figure S2, Supporting Information), we hypothesize that these blocking
events are generated by the reaction digests, Lp-Sb2(1-76)d and/or
Sb2(77-93)d fragments, generated by the BoNT-B/Zn2+ cleavage
of Lp-Sb2(1-93).
Figure 2
Experimental detection of BoNT-B activity using the aerolysin
pore. (a) Current traces for the empty pore without analytes. (b,c)
BoNT-B/Zn2+ digestion of Lp-Sb2(1-93) generated transient
pore blocks (arrows) after 30 min, and more prominently, after 180
min of incubation, respectively. (d) Current trace showing that the
recombinant Lp-Sb2(1-76), identical to the N-terminal digest Lp-Sb2(1-76)d,
did not produce blocks of the aerolysin pore. (e,f) Synthetic Sb2(76-93)s
peptide (10 and 100 nM, respectively), emulating the C-terminal digest
Sb2(77-93)d, generates pore current blocks (arrows) in concentration-dependent
manner (also see Figure S3, Supporting Information, for more traces). All analytes were applied into the cis side of
the recording chamber, with currents recorded at +120 mV. Dotted lines
represent the zero current. (g–j) Current amplitude (g and
i) and duration of blocks (h and j) generated by the substrate–toxin
[Lp-Sb2(1-93)-BoNT-B/Zn2+] mixture (g and h) or by the
synthetic peptide Sb2(76-93)s (i and j). The all-point histograms
(g and i) includes instantaneous current values of every sampling
time point. Two populations of blocking events were observed based
on the current amplitude and fitted with a Gaussian distribution.
Block duration (h and j) was fitted with an exponential function.
Experimental detection of BoNT-B activity using the aerolysin
pore. (a) Current traces for the empty pore without analytes. (b,c)
BoNT-B/Zn2+ digestion of Lp-Sb2(1-93) generated transient
pore blocks (arrows) after 30 min, and more prominently, after 180
min of incubation, respectively. (d) Current trace showing that the
recombinant Lp-Sb2(1-76), identical to the N-terminal digest Lp-Sb2(1-76)d,
did not produce blocks of the aerolysin pore. (e,f) Synthetic Sb2(76-93)s
peptide (10 and 100 nM, respectively), emulating the C-terminal digest
Sb2(77-93)d, generates pore current blocks (arrows) in concentration-dependent
manner (also see Figure S3, Supporting Information, for more traces). All analytes were applied into the cis side of
the recording chamber, with currents recorded at +120 mV. Dotted lines
represent the zero current. (g–j) Current amplitude (g and
i) and duration of blocks (h and j) generated by the substrate–toxin
[Lp-Sb2(1-93)-BoNT-B/Zn2+] mixture (g and h) or by the
synthetic peptide Sb2(76-93)s (i and j). The all-point histograms
(g and i) includes instantaneous current values of every sampling
time point. Two populations of blocking events were observed based
on the current amplitude and fitted with a Gaussian distribution.
Block duration (h and j) was fitted with an exponential function.To determine which digestion fragment
plays a role in the observed nanopore current modulation, we studied
the effect of each fragment on the current when applied to the cis
solution. First, we constructed the recombinant Lp-Sb2(1-76) that
is identical to the Lp-Sb2(1-93) N-terminal digestion fragment Lp-Sb2(1-76)d.
Lp-Sb2(1-76) cannot be cleaved by BoNT-B, as it lacks the N-terminal
portion of Sb2 needed for the action of BoNT-B.[14] We found that the recombinant Lp-Sb2(1-76) alone (20 nM)
did not produce transient blocks (Figure 2d).
Next, we investigated the synthetic peptide Sb2(76-93)s that emulates
the Lp-Sb2(1-93) C-terminal digestion fragment Sb2(77-93)d. Unlike
Lp-Sb2(1-76), Sb2(76-93)s (10 nM) generated transient pore blocks
(Figure 2e) similar to events observed when
Lp-Sb2(1-93) was treated with BoNT-B/Zn2+ (compare to Figure 2b,c). The frequency of these blocking events also
increased with increasing concentration of the synthetic peptide (Figures 2f and S3, Supporting Information). These results suggest that the nanopore blocks observed in the
substrate/toxin mixture are generated by the short C-terminal digestion
peptide Lp-Sb2(77-93)d. This conclusion was further confirmed by the
similar characteristics of the blocks for the substrate/toxin mixture
(Figure 2b,c) and the synthetic peptide Sb2(76-93)s
(Figure 2e,f). The current of blocks for the
substrate/toxin mixture was distributed broadly with two populations
located around 8.2 ± 0.9 pA (lower) and 26.8 ± 1.1 pA (higher),
i.e., relative conductance of 13.1% and 42.9%, respectively (Figure 2g). Similarly, synthetic Sb2(76-93)s also reduced
the pore currents to 7.9 ± 1.5 pA and 25.3 ± 1.4 pA, corresponding
to relative conductance of 12.6% and 40.5%, respectively (Figure 2i). In addition, the duration of both populations
for the Lp-Sb2(1-93)/BoNT-B/Zn2+ mixture was 170 ±
40 μs (Figure 2h), similar to 170 ±
40 μs (Figure 2j) for synthetic Sb2(76-93)s
events. Both block durations were also similar at various voltages
(Figure S4, Supporting Information). We
interpret that the population with lower blocking level (13%) could
be generated by the peptide translocation to the contralateral (from
cis to trans) side of the chamber, while the events with a higher
blocking level (40%) could be caused by the peptide partially entering
the pore (“bumping-the-pore”) with a subsequent retrieval
back to the ipsilateral (cis) side of the chamber. This interpretation
is consistent with previous studies on protein interactions with the
aerolysin pore. For example, the translocation of unfolded maltose
binding protein (370 aa) reduced the current to 20%, while “bumping-the-pore”
blocks partially reduced the current to 55%;[44] the translocation and “bumping” of an unfolded histidine-containing
phosphotransfer protein (86 aa) blocked the current to 14% and 54%,
respectively.[45] Overall, we conclude that
in the BoNT-B/Zn2+–substrate reaction mixture, only
the short C-terminal digest peptide (17 amino acids) can specifically
block the aerolysin pore current from the cis side. The peptide-generated
nanopore signatures are markers that can be used to determine the
presence of BoNT-B in the solution.
Mechanism for Capturing
Peptides in the Aerolysin Pore
In the above study, the Sb2
substrate digest can be selectively captured into the aerolysin pore.
Understanding the biopolymer capture mechanism is important because
optimized capture efficiency can enhance the detection sensitivity.[46−49] The capture efficiency is measured by the capture rate constant.
Therefore, we investigated the voltage-dependent and the nanopore
sensor directionality-dependent capture rate constant for both the
synthetic Sb(76-93)s and digest Sb(77-93)d in the toxin/substrate
mixture.The current traces in Figure 3a show that the capture of Sb(76-93)s from the cis side is highly
dependent on the voltage polarity: the block was much more prominent
at positive than negative voltages (see Figure S5, Supporting Information, for additional traces). The capture
rate constant (kon, μM–1·s–1) at +120 mV was 81 ± 11 μM–1·s–1, 9 times higher than that
at −120 mV (8.7 ± 3.3 μM–1·s–1, Figure 3b), suggesting that
this peptide can be driven by positive voltage. However, such observed
voltage-dependence is opposite to the expectation based on the electrostatic
analysis. The in silico analysis of protein/peptides (Table S1, Supporting Information) indicates that the substrate
Lp-Sb2(1-93) and its N-terminal digest Lp-Sb2(1-76) appeared negatively
charged (−2.7e and −6.7e, receptively), while the pore
blocking Sb2(77-93)d and synthetic Sb(76-93)s carried positive charge
(+3.76e). Thus, due to the static charges alone, the cationic Sb(76-93)s
applied to the cis (grounded) side should be attracted to the pore
by a negative voltage applied from the trans side. This discrepancy
between the predicted and measured voltage-dependence of kon suggests that the peptide capture could be dominated
by factors other than the electrostatic attraction. We propose that
the peptide capture is enhanced by the electroosmotic effect originating
from the ion selectivity of the aerolysin pore. Namely, it has been
reported that the aerolysin pore is a moderately anion-selective channel,
with its cation/anion permeability ratio (P+/P–) of 0.21.[50] We experimentally verified this anion selectivity of the
aerolysin pore (Figure S6, Supporting Information). Consequently, the pore current (in 1 M KCl) at a positive voltage
(applied from the trans side) is dominated by a cis-to-trans anion
flow (Cl–) (Figure 3d). The
water molecules accompanying this net anion flow produce an electroosmotic
force to drive the peptide presented in the cis solution toward the
pore. When the electroosmotic force dominates over the opposite electrostatic
force that repulses the cationic peptide from the pore at positive
voltage, the overall driving direction is toward the pore, which is
what we observed.
Figure 3
Mechanism for capture of peptide into the aerolysin pore.
(a) Current traces showing block events for synthetic Sb2(76-93)s
peptide (1 μM) from cis (grounded) side of the pore at ±120
mV (applied from trans side). See Figure S5 (Supporting
Information) for the additional currents recorded at ±80
mV and ±100 mV. (b) Voltage-dependence of the capture rate (kon) for Sb2(76-93)s. The blocks were more prominent
at positive over negative voltages. Block events at voltages above
+120 mV were not analyzed because they were affected by the spontaneous
pore current flicking,[44] while blocks at
voltages above −60 mV and lower than +60 mV were not analyzed
because the block recognition at low voltages was affected by the
noise of background current (empty pore). (c) Current traces showing
fewer blocks for Sb2(76-93)s (1 μM) from trans side at ±120
mV. (d) Cartoon showing the detection layout and directionality of
the pore block by the peptide. As the pore is anion selective, under
our detection conditions, there is a Cl– flow from
cis to trans side, resulting in electroosmosis (EO)-driven peptide
translocation. Peptide can interact with the pore from cis (arrow),
but not trans side (crossed arrow).
Mechanism for capture of peptide into the aerolysin pore.
(a) Current traces showing block events for synthetic Sb2(76-93)s
peptide (1 μM) from cis (grounded) side of the pore at ±120
mV (applied from trans side). See Figure S5 (Supporting
Information) for the additional currents recorded at ±80
mV and ±100 mV. (b) Voltage-dependence of the capture rate (kon) for Sb2(76-93)s. The blocks were more prominent
at positive over negative voltages. Block events at voltages above
+120 mV were not analyzed because they were affected by the spontaneous
pore current flicking,[44] while blocks at
voltages above −60 mV and lower than +60 mV were not analyzed
because the block recognition at low voltages was affected by the
noise of background current (empty pore). (c) Current traces showing
fewer blocks for Sb2(76-93)s (1 μM) from trans side at ±120
mV. (d) Cartoon showing the detection layout and directionality of
the pore block by the peptide. As the pore is anion selective, under
our detection conditions, there is a Cl– flow from
cis to trans side, resulting in electroosmosis (EO)-driven peptide
translocation. Peptide can interact with the pore from cis (arrow),
but not trans side (crossed arrow).In addition to voltage dependence, the aerolysin pore also
displays rectification for the peptide binding. We found that the
addition of Sb(76-93)s to the trans side of the chamber rarely blocked
the pore at either negative or positive holding potentials (Figures 3c and S5, Supporting Information). Similar sidedness selectivity for peptide translocation has been
reported previously.[44] The reason is not
clear, but this complex process should be related to the peptide structure
and its interaction with the pore entry motif such as the flexible
loop domain at the trans entrance.[51] Overall,
the toxin-digested peptide can translocate through the pore driven
by an electroosmotic flow from the cis side at a positive voltage
with an optimized capture rate at +120 mV.
Detection of BoNT-B Activity
In practical toxin detection, the observation of the blocks for
the specific digest peptide can mark the presence of BoNT-B. Furthermore,
the dynamic change of the block frequency would not only confirm the
presence of the toxin but also reveal the toxin activity. We identified
a positive correlation between the frequency of blocking event (f) and the Sb2(76-93)s peptide concentration (Figure 4), which could be linearly fitted on a log–log
plot. Given the 1000-fold dynamic range of the linear relationship,
this nanopore sensor can be calibrated using the synthetic peptide
in order to selectively detect and quantify the BoNT-B digest Sb2(77-93)d.
The dynamic change of the digest concentration would indicate the
activity of BoNT-B.
Figure 4
Correlation between the frequency of blocking events and
the concentration of synthetic peptide Sb2(76-93)s. Peptide was applied
to the cis chamber at +120 mV. The linear fitting of the log–log
plot by the equation log(f) = a·log([Sb2(76-93)s])
+ b (a = 0.55, b = 0.22, R2 = 0.98) represents a calibration
curve for the BoNT-B nanopore detector.
Correlation between the frequency of blocking events and
the concentration of synthetic peptide Sb2(76-93)s. Peptide was applied
to the cis chamber at +120 mV. The linear fitting of the log–log
plot by the equation log(f) = a·log([Sb2(76-93)s])
+ b (a = 0.55, b = 0.22, R2 = 0.98) represents a calibration
curve for the BoNT-B nanopore detector.To analyze the activity of BoNT-B digestion, we recorded
the nanopore currents for the time-course of the Lp-Sb2(77-93)d formation
over 3 h (Figure 5a). The reaction product
Lp-Sb2(77-93)d was generated by BoNT-B (500 pM)/Zn2+ (100
nM) mixed with its substrate Lp-Sb2(1-93) at two concentrations (8.75
and 20 nM). From the current traces, we measured the correlation of
the product Lp-Sb2(77-93)d to the frequency of the current block,
i.e., the block frequency-digesting time (f–t) curves (Figure 5b). Of note, recordings
from the empty pore showed the absence of any blocks, i.e., a simple
background (Figure S7, Supporting Information). For both substrate concentrations, the block frequency exhibited
a rapid initial increase, which tapered off to reach a plateau in
about 2 h. The f–t curves allowed for analysis
of the BoNT enzymatic activity. Traditionally, the enzyme activity
can be analyzed using the Lineweaver–Burk (L-B) plot, which
can give the maximal digestion rate (Vmax) and the substrate concentration at the half maximal rate (Km). Of note, the L-B plot is valid for relatively
high substrate concentrations (μM to mM levels).[39,52] In the nanopore detection, however, the substrate concentration
(10 nM level) is at least 2 orders of magnitude below that and also
far lower than Km for BoNT-B (100 μM
level[52]). In this case, the L-B plot would
be inaccurate. Instead, the simplified Michaelis–Menten rate
equation V = Vmax·[Lp-Sb2(1-93)]/Km is valid, where the digestion rate V is the increase in Sb2(77-93)d concentration per unit
time (nM·min–1), [Lp-Sb2(1-93)] is the estimated
substrate concentration, and the slope of the linear fitting of the V vs [Lp-Sb2(1-93)] gives the ratio Vmax/Km. Specifically, V was obtained from the f–t curves (Figure 5b) in two steps: (1) the
frequency of the product Sb2(77-93)d event at each time point was
transformed into the Sb2(77-93)d concentration based on the frequency–concentration
correlation using Sb2(76-93)s (Figure 4) and
(2) the digestion rate was obtained by the increase of Sb2(77-93)d
concentration between adjacent time points divided by the time interval.
The substrate concentration [Lp-Sb2(1-93)] at each time point during
digestion was evaluated by the initial substrate concentration [Lp-Sb2(1-93)]0 (8.75 and 20 nM) minus the estimated product Sb2(77-93)d
concentration [Sb2(77-93)d]. Through this process, we obtained the
plot of V vs [Lp-Sb2(1-93)] in Figure 5c, which involved data from both digesting curves in Figure 5b. The digestion rates for both substrate concentrations
can be fitted together with the single line, showing the slope (Vmax/Km) of 0.012
min–1. The Km for BoNT-B
light chain targeting Sb2 has been reported to be 350 μM.[53] Thus, Vmax was 0.06
μM·s–1. From Vmax, the maximal turnover rate Vmax/[BoNT-B]
can be evaluated, where [BoNT-B] is the toxin concentration, which
in our setting was 500 pM. The maximal turnover rate is estimated
to be ∼120 s–1, a value comparable to and
within the order of magnitude of 40 s–1 as in previous
reports.[52,54] Overall, the nanopore has been proven useful
in detecting the BoNT-B light chain by quantitative analysis of the
toxin enzymatic cleavage of the designed Sb2-based probe/substrate.
Figure 5
Kinetics
of BoNT-B enzymatic activity on Lp-Sb2(1-93) substrate. (a) Time-lapse
(5 to 180 min) of the nanopore current traces recording the digestion
of Lp-Sb2(1-93) substrate at two set initial concentrations (left, 8.75 nM; right, 20 nM), by light
chain BoNT-B (500 pM)/Zn2+(100 nM). (b) Frequency of blocking
events reporting on the presence of the digestion product Sb2(77-93)d
at the two substrate concentrations (squares, 8.75 nM; circles, 20
nM) over digestion time. (c) Simplified Michaelis–Menten plot
showing the digestion rate (V) as the function of
the evaluated Lp-Sb2(1-93) substrate concentration ([Lp-Sb2(1-93)])
during digestion. See text for definitions of V and
[Lp-Sb2(1-93)] and their evaluation methods. The data that was obtained
from both digesting curves in panel b were fitted together with a
line V = a·[Lp-Sb2(1-93)]
+ b, where a = 0.012 min–1 is the ratio of V/Km, and b = 9.2 × 10–5 nM·min–1 (R2 = 0.97).
Kinetics
of BoNT-B enzymatic activity on Lp-Sb2(1-93) substrate. (a) Time-lapse
(5 to 180 min) of the nanopore current traces recording the digestion
of Lp-Sb2(1-93) substrate at two set initial concentrations (left, 8.75 nM; right, 20 nM), by light
chain BoNT-B (500 pM)/Zn2+(100 nM). (b) Frequency of blocking
events reporting on the presence of the digestion product Sb2(77-93)d
at the two substrate concentrations (squares, 8.75 nM; circles, 20
nM) over digestion time. (c) Simplified Michaelis–Menten plot
showing the digestion rate (V) as the function of
the evaluated Lp-Sb2(1-93) substrate concentration ([Lp-Sb2(1-93)])
during digestion. See text for definitions of V and
[Lp-Sb2(1-93)] and their evaluation methods. The data that was obtained
from both digesting curves in panel b were fitted together with a
line V = a·[Lp-Sb2(1-93)]
+ b, where a = 0.012 min–1 is the ratio of V/Km, and b = 9.2 × 10–5 nM·min–1 (R2 = 0.97).As serum would be an penultimate material received
for detection of the toxin in humans, we examined the possibility
of detecting the activity of a BoNT-B spike-in in serum. It has been
reported (which we confirm) that the lipid bilayer membrane with embedded
protein pore can be easily raptured using the original serum sample.[38] Therefore, as in the previous study,[38] we used diluted serum (see Table S2, Supporting Information, for serum components)
as a medium for detection of BoNT-B. Specifically, we mixed 8.75 nM
Lp-Sb2(1-93), 500 pM BoNT-B and 100 nM Zn2+ in the prediluted
serum (1% v/v in 1 M KCl) for 3 h. The empty pore current was not
significantly affected when diluted serum alone was added to the cis
side (Figure 6a). In contrast, when the BoNT-B/Zn2+–substrate mixture in diluted serum was added to the
cis side, the signature pore blocks, at a frequency of 5.7 min–1, caused by Sb2(77-93)d were evident (Figure 6b). In a positive control experiment, the addition
of the 10 nM synthetic peptide Sb2(76-93)s alone to the diluted serum
generated similar pore blocks with the frequency of 8.7 min–1 (Figure 6c). These results suggest that the
BoNT-B can be detected in diluted serum by detecting the presence
of the pore blocks caused by the specific toxin-digested peptide.
Figure 6
Detection
of BoNT-B in diluted serum. Sterile filtered fetal bovine serum (1%
v/v) was diluted in 1 M KCl. (a) Current trace through the aerolysin
pore for diluted serum alone. No signature blocks were observed. (b)
Current trace in the presence of toxin BoNT-B (500 pM), Zn2+ (100 nM) and substrate protein Lp-Sb2(1-93) (8.75 nM) in the serum-containing
solution after incubation for 3 h. Signature blocks for the digested
short peptide Sb2(77-93)d were identified at a frequency of 5.7 min–1. (c) Current trace for synthetic Sb2(76-93)s (10
nM) as the positive control. Signature blocks for the synthetic Sb2(77-93)s
were identified at 8.7 min–1. All analytes were
applied to the cis chamber at +120 mV.
Detection
of BoNT-B in diluted serum. Sterile filtered fetal bovine serum (1%
v/v) was diluted in 1 M KCl. (a) Current trace through the aerolysin
pore for diluted serum alone. No signature blocks were observed. (b)
Current trace in the presence of toxin BoNT-B (500 pM), Zn2+ (100 nM) and substrate protein Lp-Sb2(1-93) (8.75 nM) in the serum-containing
solution after incubation for 3 h. Signature blocks for the digested
short peptide Sb2(77-93)d were identified at a frequency of 5.7 min–1. (c) Current trace for synthetic Sb2(76-93)s (10
nM) as the positive control. Signature blocks for the synthetic Sb2(77-93)s
were identified at 8.7 min–1. All analytes were
applied to the cis chamber at +120 mV.
Discussion
We have used the aerolysin protein pore
to develop a novel BoNT-B sensor with subnanomolar sensitivity achieved
within minutes. The neurotoxin is detected through measuring the frequency
of the nanopore current blocks generated by the specific BoNT-B cleavage
product of the recombinant substrate. Hence, the aerolysin pore selectively
detects dynamic levels of the C-terminal 17 aa digest peptide Sb2(77-93)d,
while it is insensitive to other analytes, i.e., BoNT-B/Zn2+, the toxin’s substrate Lp-Sb2(1-93) and its longer N-terminal
digest Lp-Sb2(1-76)d. Of note, α-hemolysin, another protein
pore, has been used for distinction of enzymatically cleaved/modified
peptides.[36,39,40] However, the
α-hemolysin pore has proved inadequate for detection of BoNT-B
itself or its activity based on digest products (Figure S8, Supporting Information). Also, the selective
pore blocking action of short Sb2(77-93)d/Sb2(76-93)s on the aerolysin
pore differs from previous studies, which have showed that long peptides/proteins
can translocate through the aerolysin pore.[44,45,55] A possible explanation for these seemingly
disparate findings perhaps rests with the protein state. Namely, the
peptides/proteins in the previous studies were denatured (unfolded)
prior to their translocation through the pore, while here all the
proteins/peptides we studied were in their native (folded) state.
Thus, it appears that the aerolysin pore might be inaccessible to
such large proteins/peptides in their native state, which could also
explain the ability to detect BoNT-B activity in serum (Figure 6), as the aerolysin pore is insensitive to serum
components (Figure S8, Supporting Information). Taken together, we attained accuracy for detection of BoNT-B activity
in serum, a bodily fluid derivative, which is the most common material
that would be analyzed in medical practice when diagnosing botulism.We have identified the electroosmotic effect that can enhance the
capture efficiency of the digest peptide in the aerolysin pore. In
our detection, the cationic Sb2(77-93)d and Sb2(76-93)s are driven
both by the electroosmotic and electrophoretic forces, albeit in the
opposite direction. The electrophoretic effect is relatively weak
because the charge of the peptide is shielded in high salt solution
(1 M KCl). As a result, the electroosmotic effect that originates
from the anion selectivity of the pore overpowers that of the opposing
electrophoretic drive. Therefore, the overall effect is that the peptide
is attracted to the pore against the electric field direction. The
nanopore electroosmosis originates from the ion selectivity of the
pore.[56] This effect has been found to be
able to enhance the binding of small compounds[57] and influence the capture of nucleic acids[46,48] in the nanopore. Because the peptides/proteins used in those studies
were negatively charged, the electrophoretic and electroosmotic forces
were in the same detection and hence indistinguishable in the recordings.The nanopore BoNT-B sensor has an inherently built-in amplification
of the product as each BoNT-B molecule can cleave many molecules of
substrate. Accordingly, the frequency of blocking events can be increased
many-fold, as seen in f–t curves (Figure 5b). Thus, the nanopore approach greatly shortens
the analytical time, while retaining high detection accuracy. We have
demonstrated the detection of 500 pM or 25 ng/mL BoNT-B (light chain)
by measuring the dynamic levels of the digest peptide in the nanopore.
This sensitivity is similar to the detection levels of flow cytometry-based
assays (73 ng/mL for BoNT-B)[58] and FRET
endopeptidase assays (a Sb2-based sensor, 30 ng/mL of BoNT-B),[16,59] but lower than the sensitivity of the “gold” standard
mouse lethality assay, improved ELISA assays, and immuo-PCR (see refs (60)–[63]); of note, the U.S. Environmental Protection
Agency (EPA) lists the lethal dose concentration for botulinum type
A and B at 300 ng/mL. The nanopore performance in BoNT-B detection
could be greatly enhanced by increasing the concentration of the substrate
peptide. The substrate concentration in this study (∼10 nM)
is much lower than Km of BoNT-B (100 μM
level).[53] At low substrate concentration,
the actual digestion rate by 500 pM BoNT-B is only 0.2 nM min–1, which is equivalent to a turnover rate of 0.4 s–1, almost 3 orders of magnitude slower than that at
the maximal cleavage speed (120 s–1). The actual
low turnover rate is associated with two issues: (1) the detection
time is prolonged when the BoNT-B level is extremely low and (2) due
to the low concentration of the digestion product, the frequency of
blocking events is lowered, thus lowering the detection sensitivity.
We could partly resolve this issue by simply increasing the concentration
of the substrate. Incidentally, miniaturized nanopore systems allow
for the presence of high substrate concentration. For example, the
droplet-interfaced bilayer[64−66] system has been reported to be
able to detect hundreds of molecules in its small volume sample (less
than 1 μL).[67] With small volume (as
compared to presently used 2 mL), it is possible to achieve high substrate
concentration at low cost to elevate the digest rate. This allows
generating sufficient digest peptides for nanopore detection at a
low toxin concentration, therefore increasing the sensitivity. In
addition, more digest peptides can be produced in a shorter time,
enhancing the time-efficiency of the detection.
Conclusion
The
aerolysin protein pore can be used to elucidate the interaction of
the nanopore with a synaptic protein Sb2 derivative and its BoNT-B
cleavage products. We determined that only the small C-terminal BoNT-B
digest peptide in its native state can interact with the pore to generate
current blocks, while other native peptides/proteins in the reaction
mixture and serum cannot produce observable blocking events. By specifically
tracking the dynamic change in frequency of the small peptide-generated
signatures, we determined the existence of the BoNT-B toxin in the
subnanomolar range within minutes. This research is motivated by danger
posed by BoNT-B, which is one of the most potent biotoxins. Rapid
and sensitive detection of this toxin, be that due to drug-use, food-poising
or terrorism, is a priority in toxicology and biodefense. This is
an area of future interest and a fertile ground for improvements of
the present BoNT-B nanopore detection scheme. The above described
approach has potential to be adapted to the selective peptide detection
for biosensing and investigating biological processes, including the
detection of activity of Clostridial toxins, and biophysical mechanisms for biopolymers interaction and
translocation through the nanopore.
Methods
Plasmids
We used a plasmid (generously provided by Edwin R. Chapman, University
of Wisconsin, Madison, WI) encoding the most of the cytoplasmic domain,
i.e., amino acids (aa) 1–93, of ratsynaptobrevin 2 (Sb2) fused
to the C-terminus of the vector (pTrcHisA) sequence encoding the 36
aa lead peptide (MGGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGS),
which contains a six histidine (H6) tag near the N-terminus. We termed
the recombinant fusion protein, produced using this plasmid, as Lp-Sb2(1-93)
(see Figure S1, Supporting Information).
This plasmid served as the PCR template for subcloning of another
plasmid, which encodes the fusion protein containing the lead peptide
followed by aa 1–76 of Sb2 (see Figure S1, Supporting Information); we termed the resulting recombinant
protein as Lp-Sb2(1-76). The subcloning was done using the In-Fusion
HD Cloning Kit (Clontech Laboratories, Inc., Mountain View, CA) and
the following four primers with the 15 bp overlapping sequences: Insert
Fwd, 5′- AGCACCGCCTACATACCTCGCTCTGCTAATCCTG
-3′; Insert Rev, 5′- TCATTACTATTATCACTGGGAGGCCCCTGCCTGGAG
-3′; Vector Fwd, 5′- TGATAATAGTAATGAATTCGAAGCTTGGCTGTTTTGGCGGATG
-3′, Vector Rev: 5′- TATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTG
-3′. DNA Sequencing of constructs was used to confirm the above-described
encoding of Lp-Sb2(1-93) and Lp-Sb2(1-76).
Recombinant Proteins
The above plasmids were utilized in recombinant protein production
and purified with nickel–Sepharosebeads (Qiagen, Valencia,
CA) as per manufacturer procedure. H6-tagged proteins were quantified
using the Bradford reagent (Pierce Biotechnology, Rockford, IL, USA)
and bovine serum albumin as a standard. Determined protein concentrations
were as 0.1 μg/μL for Lp-Sb2(1-93) and 0.175 μg/μL
for Lp-Sb2(1-76). Purified recombinant proteins represented 84–97%
of the total protein content.[68]
Western
Blotting
Generation of the recombinant proteins was confirmed
by Western blotting, as previously described.[68,69] Samples with purified proteins were loaded at 1 μg per lane
and subjected to 15% SDS-PAGE, followed by transfer to nitrocellulose
membranes. Membranes were probed with specific antibodies against
the H6 tag (Chemicon, catalogue no. MAB3114, 1:500 dilution). Immunoreactivity
of the bands was detected using enhanced chemiluminescence (Amersham
Biosciences). All proteins showed single immunoreactive bands with
appropriate molecular weights.
Peptide Synthesis
We obtained custom synthesized 18 aa peptide with Sb2(76-93) sequence
(APeptide Co., Ltd., ShangHai, China) having purity of 95% (HPLC).
Note that this Sb2(76-93)s peptide contains Q76 otherwise not present
in Sb2(77-93)d, the Lp-Sb2(1-93) C-terminal fragment after its cleavage
by BoNT-B light chain/Zn2+.
In Silico Protein/Peptide
Analysis
We carried out an in silico peptide analysis using
the Vector NTI Suite v.6 BioPlot module (Informax, Inc., Bethesda,
MD) to obtain various predicted characteristics (Table S1, Supporting Information), which assisted us with
the nanopore experimental design and results interpretation.
BoNT-B
The light chain of botulinum neurotoxin type B (50 kDa, List Biological
Laboratories, Campbell, CA) was used to cleave recombinant Sb2.[13] Hence, a mixture of Lp-Sb2(1-93) with the Zn2+-endopeptidase BoNT-B (500 pM) and zinc chloride (100 nM)
in solution (1 M potassium chloride, 10 mM HEPES, pH = 7.35) results
in two fragments, the N-terminal digest, annotated as Lp-Sb2(1-76)d
to discriminate it from the otherwise identical recombinant protein
Lp-Sb2(1-76) produced above, and the 17 aa C-terminal digest, annotated
as Sb2(77-93)d.
Serum
Sterile filtered fetal bovine
serum was purchased from HyClone, Thermo Fisher Scientific Inc., Waltham,
MA (catalogue No. SH30910, lot No. AWB98615; see Table S2 (Supporting Information) of biochemical analysis
provided by the manufacturer). The serum sample (1% v/v) for the nanopore
detection was prepared by diluting it 100 times in 1 M KCl. Specifically,
200 μL of fetal bovine serum was mixed with 20 mL of 1 M KClbuffered with 10 mM HEPES (pH = 7.35), to obtain 1% (v/v) serum solution.
Digestion
2.5 μL of 7 μM (0.1 μg/μL)
recombinant Lp-Sb2(1-93), 1 μL of 1 μM (0.05 μg/μL)
BoNT-B light chain and 2 μL of 100 μM ZnCl2, were mixed with 2 mL of 1 M KCl solution or prediluted serum solution.
The concentrations of various species in the mixture were: Lp-Sb2(1-93),
8.75 nM (initial concentration); BoNT-B light chain, 0.5 nM; and Zn2+, 100 nM. After incubation for 3 h at room temperature, the
mixture was released to the cis chamber for nanopore recording.
Aerolysin and Recordings Using Single Aerolysin Pores
Proaerolysin
was purchased from Aerohead Scientific, SK, Canada. According to the
product information, to activate proaerolysin, 2 μM proaerolysin
was incubated with 1 μg/mL trypsin (final concentration in the
mixture) for 1.5 h to cleave a short fragment from the carboxyl terminal.
The activated aerolysin was stored at −80 °C. The electrical
setup for recording single protein pore or channel have been described
in previous reports such as reference.[24] Briefly, the recording apparatus was composed of two chambers (cis
and trans) that were partitioned with a Teflon film. The planar lipidbilayer of 1,2-diphytanoyl-sn-glycerophosphatidylcholine
(Avanti Polar Lipids) was formed spanning a 100–150 μm
hole in the center of the partition. 1–5 μL of the aerolysin
stock solution was released in the cis solution. After a couple of
minutes, single aerolysin proteins can be inserted in the lipid bilayer
to form molecular pores. Both cis and trans chambers were filled with
1 M salt solutions (KCl) buffered with 10 mM HEPES and titrated to
pH = 7.35. For detection of digestion peptides, the incubation solution
(described above) was presented in the cis chamber. For the α-hemolysin
experiment, the α-hemolysin heptameric protein was synthesized
using in vitro transcription and translation and obtained as described
previously.[23,24] 1–5 μL of the α-hemolysin
stock solution was released in the cis solution to form the pores
in the lipid bilayer. To increase the capture rate constant, the cis
and trans chambers were filled with 1 and 0.2 M asymmetric KCl solutions,
respectively.[46] All saline solutions (without
protein addition) were filtered with MillexGP 0.22 uM membrane (EMD
Millipore Corporation, Billerica, MA) before use. Single-channel currents
were recorded with an Axopatch 200A patch-clamp amplifier (Molecular
Device Inc., former Axon Inc.), filtered with a built-in four-pole
low-pass Bessel Filter at 5 kHz, and acquired with Clampex 9.0 software
(Molecular Device Inc.) through a Digidata 1332 A/D converter (Molecular
Device Inc.) at a sampling rate of 20 kHz. All reactants were applied
to the cis chamber, with the sole exception of experiments in Figures 3b and S3b (Supporting Information) where Sb2(76-93)s was alternatively applied to the trans chamber.
Data were based on at least four separate experiments and obtained
by Single Channel Search function pClamp provided for events that
blocked the current more than 50%. The current amplitude and duration
histograms of blocking events were fitted by the Gaussian and exponential
functions, respectively. The electrophysiology experiments were conducted
at 22 ± 1 °C. Data were represented as mean ± SD for
at least three independent experiments.
Authors: G Schiavo; F Benfenati; B Poulain; O Rossetto; P Polverino de Laureto; B R DasGupta; C Montecucco Journal: Nature Date: 1992-10-29 Impact factor: 49.962