Literature DB >> 25415360

Respiratory syncytial virus human experimental infection model: provenance, production, and sequence of low-passaged memphis-37 challenge virus.

Young-In Kim1, John P DeVincenzo2, Bart G Jones3, Rajeev Rudraraju3, Lisa Harrison4, Rachel Meyers5, Jeff Cehelsky5, Rene Alvarez5, Julia L Hurwitz6.   

Abstract

Respiratory syncytial virus (RSV) is the leading cause of lower respiratory tract infections in children and is responsible for as many as 199,000 childhood deaths annually worldwide. To support the development of viral therapeutics and vaccines for RSV, a human adult experimental infection model has been established. In this report, we describe the provenance and sequence of RSV Memphis-37, the low-passage clinical isolate used for the model's reproducible, safe, experimental infections of healthy, adult volunteers. The predicted amino acid sequences for major proteins of Memphis-37 are compared to nine other RSV A and B amino acid sequences to examine sites of vaccine, therapeutic, and pathophysiologic interest. Human T- cell epitope sequences previously defined by in vitro studies were observed to be closely matched between Memphis-37 and the laboratory strain RSV A2. Memphis-37 sequences provide baseline data with which to assess: (i) virus heterogeneity that may be evident following virus infection/transmission, (ii) the efficacy of candidate RSV vaccines and therapeutics in the experimental infection model, and (iii) the potential emergence of escape mutants as a consequence of experimental drug treatments. Memphis-37 is a valuable tool for pre-clinical research, and to expedite the clinical development of vaccines, therapeutic immunomodulatory agents, and other antiviral drug strategies for the protection of vulnerable populations against RSV disease.

Entities:  

Mesh:

Substances:

Year:  2014        PMID: 25415360      PMCID: PMC4240712          DOI: 10.1371/journal.pone.0113100

Source DB:  PubMed          Journal:  PLoS One        ISSN: 1932-6203            Impact factor:   3.240


Introduction

Respiratory syncytial virus (RSV) is a paramyxovirus that infects more than 60% of children during the first year of life [1]. This virus is associated with significant morbidity and mortality, particularly among young infants [2]. Globally, RSV infections were estimated to cause 66,000–199,000 deaths in 2005 in children under the age of 5 years, mostly occurring in the developing world, and no vaccine or effective antiviral treatment for RSV disease exists. Prior to the clinical testing of new vaccines, antivirals, and other novel interventions in infants, safety and efficacy tests should be performed in and proven in consenting adults. However, RSV-directed drug efficacy is difficult to evaluate in healthy adult populations, because natural RSV infections severe enough to prompt a health care concern are relatively rare in adults, producing generally mild symptoms that are difficult to distinguish from those of the common cold. The development of an RSV human adult experimental infection model is therefore imperative to expedite drug paths to licensure and commercialization. RSV Memphis-37 was isolated from a child with bronchiolitis, characterized, and manufactured for use as a challenge virus in the adult experimental infection model. It supports safe, reproducible, quantifiable, and transient RSV infection and respiratory disease manifestations in adult volunteers. The virus has been used for studies of human RSV disease [3], [4] and the clinical testing of disease inhibitory drugs including anti-inflammatory immunomodulators and passively-transferred antibodies (e.g. MEDI-557 by MedImmune LLC [ClinicalTrials.gov identifier NCT01475305], ALS-008176 by Alios Biopharma, Inc. [ClinicalTrials.gov identifier NCT02094365], ALN-RSV01 by Alnylam Pharmaceuticals [ClinicalTrials.gov identifier NCT00496821], GS-5806 by Gilead Sciences [5], and RV568 by Respivert Ltd. [ClinicalTrials.gov identifier NCT01230645]), as well as pre-clinical research [4], [6]–[10]. Based on results from human adult tests with RSV Memphis-37, antiviral drug products are gaining regulatory approval for testing in high-risk adult populations, infants and children. In this report, we describe the provenance of Memphis-37. We also compare 11 predicted protein sequences of Memphis-37 to those of other RSV A and B isolates. This information serves as a baseline reference for evaluation of future tests with the experimental RSV infection model. In addition, when escape mutants appear after vaccine or therapeutic drug testing with Memphis-37, results will indicate viral sites that may be targeted when second-generation drugs are developed.

Results and Discussion

In order to select a challenge virus for a reliable and useful RSV human experimental infection model, children with RSV were first identified from an outpatient urgent care center, emergency department, or from the inpatient area of a large regional pediatric hospital in Memphis, TN. All investigations involving any human subject were approved by the University of Tennessee Health Science Center Internal Review Board. Written informed consent was obtained from parents or legal guardians of the subjects, all of whom were below the age of ascent. From the years 2000–2005, 288 patients without chronic underlying conditions under two years of age who tested positive for RSV by antigen detection (Binax Now and Directigen) were enrolled. Participants were excluded if they had a history of prematurity, cardiac disease, chronic lung disease, immune deficiencies, bacterial co-infections, treatment with corticosteroids, ribavirin, RSV-Ig (Respigam), or palivizumab, or any experimental RSV intervention. The initial nasal aspirates were collected quantitatively as described previously [11] using FDA-approved sterile normal saline for inhalation. The samples were then aliquoted into sterile-sealed polystyrene vials. One fresh aliquot was utilized to quantify RSV by quantitative plaque assay in HEp2 cells without freezing [11], while the remainder of the sample was snap-frozen on dry ice and stored at −80°C. All 288 virus samples were evaluated by RSV strain-specific antibodies, N-gene specific genotype PCR, and quantitative PCR [11], [12]. To manufacture a virus that caused infection and disease similar to natural RSV infection in humans, we kept the viral passage number as low as possible. This minimized nucleic acid mutations caused by RNA-dependent RNA polymerase infidelity and the consequent loss of primary virus features, including patterns of viral protein glycosylation defined by post-translational modifications in human respiratory tract epithelial host cells. Original aliquots of samples from the 288 patients with the six highest viral loads in nasal washes (that were RSV-A defined by both serotyping and genotyping) were taken into a manufacturing suite and processed following Current Good Manufacturing Practices (cGMP). Samples were thawed and plaqued in FDA-approved Vero cell cultures. Each of the six selected viruses produced visible cytopathic effects (CPE), and three individual plaques from each of the six viruses were selected and aliquoted. One aliquot from each of the 18 plaques was placed into a Vero cell serum-free culture to assess quantitative viral growth kinetics. Primary aliquots from cultures exhibiting the most optimal in vitro growth kinetics were then manufactured using cGMP guidelines by passage in Vero cell culture roller bottles. Memphis-37 was then selected for final production, and the fill-finish was aliquoted in sterile glass vials and stored at −80°C. The final test product was passaged only five times. Tests for purity and adventitious agents during cGMP production were negative as listed in the FDA guidance documents for live viral vaccine production for human use. The patient from whom Memphis-37 was originally isolated was a four month old, 5.9 kg, non-breast fed, African-American male who was the 2.6 kg product of a 40 week full term gestation. He was previously healthy and without environmental tobacco smoke exposure. In 2001, he developed respiratory symptoms without fever. On the 5th day of symptoms, the child was hospitalized for bronchiolitis, at which time informed consent and repository consent were obtained, and the patient's first nasal aspirate (from which Memphis-37 strain was isolated) was collected. His mother's prenatal labs were negative for human immunodeficiency virus (HIV) and the surface antigen of the hepatitis B virus (HBsAg), and her standard pre-natal screening labs were unremarkable. She had no history of transfusion or sexually transmitted infection. The patient's initial viral load was >6.78 log plaque forming units (PFU)/ml by fresh quantitative culture on HEp2 cells. The patient's quantitative culture-based viral load declined typically over successive days indicating normal RSV clearance [13]. The patient's viral load by qPCR was initially 7.29 log PFU(e)/ml and declined similarly over successive days. The patient remained hospitalized for four days, did not require supplemental oxygen, never required intensive care or mechanical ventilation, and did not receive any antivirals, passive antibodies or antibiotics. The Memphis 37 virus was plaqued onto HEp-2 cells to examine morphology. Virus plaquing was performed with the patient's initial nasal aspirate and with the virus that had been passaged five times on Vero cells. The latter sample was also examined by electron microscopy at Advanced Biotechnologies Inc. (Columbia, MD). Plaques were easily countable on both HEp-2 cells and Vero cells. No contaminating adventitious agents including other viruses, yeasts, molds or bacteria were found. Virions were pleomorphic, round or filamentous, and of size consistent with RSV. As expected, small spikes were observed on virion surfaces. Memphis-37 was amplified once more in HEp2 cells (for a total of six passages) to obtain RNA for Sanger sequencing. The complete sequence was submitted to GenBank (Accession # KM360090). There were several base positions for which major and minor peaks were identified in Sanger electropherograms. Affected positions and major and minor bases in the GenBank sequence were: 4188 (G/A), 4734 (A/G), 6041 (C/T), 8990 (A/C), 10,101 (A/T), 10,102 (A/T), 10,103 (A/T), and 14,102 (G/T). Attention to these heterogeneous sequences may reveal genetic bottlenecks in future infection or transmission studies with the Memphis-37 challenge virus. The predicted amino acid sequences of RSV Memphis-37 proteins were determined using CLC software (Genomics Workbench, Qiagen) and aligned with nine additional viral sequences from GenBank, including five RSV type A sequences and four RSV type B sequences. Only the major bases described above were used for amino acid predictions. Within the comparator sequences were four laboratory isolates, including RSV A2 and Long, which are routinely used in basic and translational research laboratories [14], [15]. Results are shown for the RSV membrane glycoprotein (G) and fusion (F) protein in Figures 1 and 2, respectively, and for the nine additional proteins in Supplementary Figures (Figure S1. NS-1 protein; Figure S2. NS-2 Protein; Figure S3. N Protein; Figure S4. P protein; Figure S5. M Protein; Figure S6. SH Protein [16]; Figure S7. M2-1 Protein; Figure S8. M2-2 Protein; Figure S9. L protein [15], [17]). Memphis-37 was confirmed to be a type A virus and was subtyped as GA5 based on G protein C-terminal sequences (beginning at a.a. position 210 [18], [19]). GA5 was a common circulating genotype in 2001, the isolation year for Memphis-37 [18], [20].
Figure 1

Predicted amino acid sequence for RSV Memphis-37 G protein and alignments.

Predicted amino acid sequence is shown for the RSV Memphis-37 G protein. Sequence was aligned with five subtype A viruses (including two laboratory strains) and four subtype B viruses (including two laboratory strains). Virus nomenclature and GenBank Accession numbers used in the alignment are: RSVA Nashville (JX069801.1), RSVA Denver (GU591769.1 [42]), RSVA Milwaukee (JF920069.1 [43]), RSVA VR-26 Long (AY911262.1, Laboratory strain), RSVA A2 (M74568.1, Laboratory strain [15]), RSVB Dallas (JQ582843.1), RSVB Milwaukee (JN032117.1 [43]), RSVB 9320 (AY353550.1, B9320 Laboratory strain), RSV strain B1 (AF013254.1, B1 Laboratory strain [44]). N-terminal variable region: a.a. 67–147, central conserved region: a.a. 148–198, C-terminal hypervariable region: a.a. 199–298, CX3C motif: a.a. 182–186. RSV Memphis-37 sequencing methods: For sequencing purposes, Memphis-37 was taken after five passages and was amplified once more in a T25 flask of HEp-2 cells. Briefly, virus was added to cells in DMEM/0.1% BSA for 1.5 hours. Medium was removed and replaced with EMEM/5% FCS for four days. A lysate was prepared and viral RNA was extracted using a Qiagen viral RNA mini kit. PCR reactions were performed using the TaKaRa One Step RNA PCR Kit (AMV) using 5 µl (145 ng/µl) of viral RNA extracted with Qiagen QIAmp Viral RNA Mini Kit. Forward and reverse oligonucleotides were prepared at concentrations of 100 µM and 1 µl of each pair was used in each reaction. Incubations were at 50°C for 30 min. and 94°C for 2 min. Then 40 cycles were run at 94°C for 30 seconds, 60°C for 30 seconds, and 72°C for 1.5 min. For each sequencing reaction, 40 ng PCR product were mixed with 3.2 pmoles oligonucleotide primer in a final volume of 12 µl and submitted to the Hartwell Center at St. Jude for Sanger sequencing. Sequences were edited and a contig was created in Vector NTI SeqMan. The consensus contig for Memphis-37 was imported into CLC Workbench and predicted amino acid sequences were aligned with other RSV sequences.

Figure 2

Predicted amino acid sequence for RSV Memphis-37 F protein and alignments.

Alignments are as described in Figure 1, but for the F protein. Features of interest are shaded or boxed as indicated below the sequence. The blue line marks an antigenic site A, which is targeted by the monoclonal antibody Palivizumab.

Predicted amino acid sequence for RSV Memphis-37 G protein and alignments.

Predicted amino acid sequence is shown for the RSV Memphis-37 G protein. Sequence was aligned with five subtype A viruses (including two laboratory strains) and four subtype B viruses (including two laboratory strains). Virus nomenclature and GenBank Accession numbers used in the alignment are: RSVA Nashville (JX069801.1), RSVA Denver (GU591769.1 [42]), RSVA Milwaukee (JF920069.1 [43]), RSVA VR-26 Long (AY911262.1, Laboratory strain), RSVA A2 (M74568.1, Laboratory strain [15]), RSVB Dallas (JQ582843.1), RSVB Milwaukee (JN032117.1 [43]), RSVB 9320 (AY353550.1, B9320 Laboratory strain), RSV strain B1 (AF013254.1, B1 Laboratory strain [44]). N-terminal variable region: a.a. 67–147, central conserved region: a.a. 148–198, C-terminal hypervariable region: a.a. 199–298, CX3C motif: a.a. 182–186. RSV Memphis-37 sequencing methods: For sequencing purposes, Memphis-37 was taken after five passages and was amplified once more in a T25 flask of HEp-2 cells. Briefly, virus was added to cells in DMEM/0.1% BSA for 1.5 hours. Medium was removed and replaced with EMEM/5% FCS for four days. A lysate was prepared and viral RNA was extracted using a Qiagen viral RNA mini kit. PCR reactions were performed using the TaKaRa One Step RNA PCR Kit (AMV) using 5 µl (145 ng/µl) of viral RNA extracted with Qiagen QIAmp Viral RNA Mini Kit. Forward and reverse oligonucleotides were prepared at concentrations of 100 µM and 1 µl of each pair was used in each reaction. Incubations were at 50°C for 30 min. and 94°C for 2 min. Then 40 cycles were run at 94°C for 30 seconds, 60°C for 30 seconds, and 72°C for 1.5 min. For each sequencing reaction, 40 ng PCR product were mixed with 3.2 pmoles oligonucleotide primer in a final volume of 12 µl and submitted to the Hartwell Center at St. Jude for Sanger sequencing. Sequences were edited and a contig was created in Vector NTI SeqMan. The consensus contig for Memphis-37 was imported into CLC Workbench and predicted amino acid sequences were aligned with other RSV sequences.

Predicted amino acid sequence for RSV Memphis-37 F protein and alignments.

Alignments are as described in Figure 1, but for the F protein. Features of interest are shaded or boxed as indicated below the sequence. The blue line marks an antigenic site A, which is targeted by the monoclonal antibody Palivizumab. RSV G (Figure 1) is an attachment protein that adheres virus to its target mammalian cell, in part by binding glycosaminoglycans on the host cell surface [21]. A relatively well-conserved central cysteine loop region (a.a. 148–198) was shared in sequence between Memphis-37 and other RSV type A viruses. This region contains a CX3C motif (CWAIC at a.a. position 182–186) known to modify the host immune response during RSV infection by chemokine mimicry and alteration of leukocyte migration [22]. The CX3C motif binds the fractalkine receptor CX3CR1 and modifies CX3CR1-positive RSV-specific T-cell responses [23]. Antibodies generated toward this central conserved region of RSV G have some ability to cross-neutralize RSV A and B strains [24], [25]. Multiple potential N-linked glycosylation sites (N-X-T or N-X-S when X is not proline) were present in the G protein. The G protein alignment in Figure 1 illustrated the positioning of variable regions known to include sites for neutralizing antibody recognition and associated virus escape [26]. Alignments of predicted amino acid sequences for other RSV proteins (Figure 2 and Figures S1 to S9) showed additional variable regions including those in the C-terminal, extracellular region of SH (including a site of potential N-linked glycosylation, a.a. positions 52-54 in Figure S6), the central region of M2-2, and two regions in L [17]. The RSV F protein (Figure 2) is essential for RSV fusion and entry into its host cell target. The full-length protein F0 is cleaved to fragments F1 and F2 to form the mature F protein. Figure 2 illustrates important features of F including its signal peptide (a.a. 1–22), furin cleavage sites (a.a. 106–109 and 133–136 [27]), pep27 (a.a. 110–136, a small peptide released upon protein cleavage), the transmembrane domain (a.a. 526–548), and the cytoplasmic domain (a.a. 550–574). A key site for virus resistance to a monoclonal antibody that is used as RSV prophylaxis in children (Palivizumab [28]) exists between a.a. positions 257–276 (antigenic site A, indicated by the blue line in Figure 2). Amino acid substitutions in this site that have conferred resistance to Palivizumab in cell culture, animal models, or humans are N262Y/S, N268I, K272E/M/N/Q/T, S275F, and N276Y [29]–[31]. These substitutions were not identified in the Memphis-37 sequence. A more recently described D25 antibody also exhibits potent neutralization of RSV [32]. D25 inhibits F-mediated fusion. This antibody binds a quaternary epitope named antigenic site Ø at the membrane-distal apex of the pre-fusion F trimer. It interacts with the α4 helix (F1 residues 196–210) and forms intermolecular hydrogen bonds with F2 residues 63, 65, 66, and 68. Antibody contact points are shared between RSV Memphis 37 and A2, but not between RSV A and B isolates. Continued research studies with neutralizing antibodies and Memphis 37 are encouraged to unravel mechanisms of virus inhibition, while defining new strategies for RSV control. RSV-specific CD4-positive and CD8-positive T lymphocytes partner with antibodies to inhibit virus infections by producing cytokines, killing virus infected targets, and regulating innate and adaptive effector functions. We examined human T-cell epitope sequences that had previously been described by in vitro studies, mapped onto the RSV A2 sequence [33]–[41]. Table 1 shows that these epitope sequences were almost entirely matched between Memphis-37 and RSV A2. All epitopes within the G, N, M, M2, and NS proteins showed 100% sequence homology between the two strains. A T-cell epitope sequence flanking the CXC3 motif in the RSV G protein was perfectly matched between RSV A2 and Memphis-37 (a.a. 162–175). Only a few epitope sequences within the F proteins, which are bolded in Table 1, were observed to be different. As studies with the experimental infection model progress, attention should be paid to variable sites and regions, which may mark positions of virus escape from candidate vaccines and therapeutic drugs.
Table 1

Comparison of human CD4 and CD8 T-lymphocyte epitope sequences between respiratory syncytial virus Memphis-37 and A2 strains.

RSV proteinAmino acid positionPeptide sequence*% Homology between peptides
RSV-Memphis-37RSV-A2
CD4 G162−175DFHFEVFNFVPCSIDFHFEVFNFVPCSI100
F7−30KTNAITTILAAVTLCFASSQNITEKANAITTILTAVTFCFASGQNITE83
F25−42 SQNITEEFYQSTCSAVSKGQNITEEFYQSTCSAVSK94
F43−60GYLSALRTGWYTSVITIEGYLSALRTGWYTSVITIE100
F49−72RTGWYTSVITIELSNIKENKCNGTRTGWYTSVITIELSNIKENKCNGT100
F55−72SVITIELSNIKENKCNGTSVITIELSNIKENKCNGT100
F73−90DAKVKLIKQELDKYKNAVDAKVKLIKQELDKYKNAV100
F85−102KYKNAVTELQLLMQSTPA KYKNAVTELQLLMQSTPP94
F109−132RELPRFMNYTLNNTKNNNVTLSKKRELPRFMNYTLNNAKKTNVTLSKK88
F175−192NKAVVSLSNGVSVLTSKVNKAVVSLSNGVSVLTSKV100
F193−210LDLKNYIDKQLLPIVNKQLDLKNYIDKQLLPIVNKQ100
F229−252RLLEITREFSVNAGVTTPVSTYMLRLLEITREFSVNAGVTTPVSTYML100
F265−288PITNDQKKLMSNNVQIVRQQSYSIPITNDQKKLMSNNVQIVRQQSYSI100
F295−318EVLAYVVQLPLYGVIDTPCWKLHTEVLAYVVQLPLYGVIDTPCWKLHT100
F337−360TDRGWYCDNAGSVSFFPQAETCKVTDRGWYCDNAGSVSFFPQAETCKV100
F391−408YDCKIMTSKTDVSSSVITYDCKIMTSKTDVSSSVIT100
F409−426SLGAIVSCYGKTKCTASNSLGAIVSCYGKTKCTASN100
F427−444KNRGIIKTFSNGCDYVSNKNRGIIKTFSNGCDYVSN100
F457−486YYVNKQEGKSLYVKGEPIINFYDPLVFPSDYYVNKQEGKSLYVKGEPIINFYDPLVFPSD100
F493−516SQVNEKINQSLAFIRKSDELLHNVSQVNEKINQSLAFIRKSDELLHNV100
F517−534NVGKSTTNIMITTIIIVINAGKSTTNIMITTIIIVI94
F541−558LIAVGLFLYCKARSTPVTLIAVGLLLYCKARSTPVT94
CD8 F8−17 TNAITTILAAANAITTILTA80
F93−102LQLLMQSTPALQLLMQSTPA100
F106–113RARRELPRFRARRELPRF100
F109–118RELPRFMNYTRELPRFMNYT100
F260–269LINDMPITNDLINDMPITND100
F273–282LMSNNVQIVRLMSNNVQIVR100
F285–294SYSIMSIIKESYSIMSIIKE100
F374–383TLPSEVNLCNTLPSEVNLCN100
F388–397NPKYDCKIMTNPKYDCKIMT100
F519–528GKSTTNIMITGKSTINIMIT90
F521–530STTNIMITTISTINIMITTI90
F542–550IAVGLFLYCIAVGLLLYC89
N46–59KLCGMLLITEDANHKLCGMLLITEDANH100
N232–245STRGGSRVEGIFAGSTRGGSRVEGIFAG100
N250–263AYGAGQVMLRWGVLAYGAGQVMLRWGVL100
N253–266AGQVMLRWGVLAKSAGQVMLRWGVLAKS100
N256–269VMLRWGVLAKSVKNVMLRWGVLAKSVKN100
N298–311AGFYHILNNPKASLAGFYHILNNPKASL100
N306–314NPKASLLSLNPKASLLSL100
M195–203IPYSGLLLVIPYSGLLLV100
M229–237YLEKESIYYYLEKESIYY100
M2-164–72AELDRTEEYAELDRTEEY100
M2-1151–159RLPADVLKKRLPADVLKK100
NS141–49LAKAVIHTILAKAVIHTI100

Legend: *Differences between Memphis-37 and RSV A2 are bolded.

Legend: *Differences between Memphis-37 and RSV A2 are bolded. In conclusion, we have described the provenance, production, and sequences of Memphis-37. These data serve as valuable reference material for the evaluation of RSV vaccines and therapeutics in the adult human experimental infection model. Memphis 37 has already supported RSV research in vitro and in vivo, including studies in lambs, monkeys and man Clinical studies test numerous drug products, including candidates for RSV prophylaxes in children (e.g. monoclonal antibodies) and RSV treatments (e.g. small molecules and siRNAs). Future research will continue to examine the characteristics of Memphis 37 in challenge, transmission and serological studies while expediting the development of clinical vaccines and therapeutic drug strategies for the protection of vulnerable populations against RSV disease. Predicted amino acid sequence for RSV Memphis-37 NS1 protein and alignments. Alignments are as described for Figure 1, but for the NS1 protein. (TIF) Click here for additional data file. Predicted amino acid sequence for RSV Memphis-37 NS2 protein and alignments. Alignments are as described for Figure 1, but for the NS2 protein. (TIF) Click here for additional data file. Predicted amino acid sequence for RSV Memphis-37 N protein and alignments. Alignments are as described for Figure 1, but for the N protein. (TIF) Click here for additional data file. Predicted amino acid sequence for RSV Memphis-37 P protein and alignments. Alignments are as described for Figure 1, but for the P protein. (TIF) Click here for additional data file. Predicted amino acid sequence for RSV Memphis-37 M protein and alignments. Alignments are as described for Figure 1, but for the M protein. (TIF) Click here for additional data file. Predicted amino acid sequence for RSV Memphis-37 SH protein and alignments. Alignments are as described for Figure 1, but for the SH protein. Transmembrane domain: a.a. 23–41, Potential site for glycosylation: a.a. 52–54. (TIF) Click here for additional data file. Predicted amino acid sequence for RSV Memphis-37 M2-1 protein and alignments. Alignments are as described for Figure 1, but for the M2-1 protein. (TIF) Click here for additional data file. Predicted amino acid sequence for RSV Memphis-37 M2-2 protein and alignments. Alignments are as described for Figure 1, but for the M2-2 protein. (TIF) Click here for additional data file. Predicted amino acid sequence for RSV Memphis-37 L protein and alignments. Alignments are as described for Figure 1, but for the L protein. (PDF) Click here for additional data file.
  43 in total

1.  Cleavage at the furin consensus sequence RAR/KR(109) and presence of the intervening peptide of the respiratory syncytial virus fusion protein are dispensable for virus replication in cell culture.

Authors:  Gert Zimmer; Karl-Klaus Conzelmann; Georg Herrler
Journal:  J Virol       Date:  2002-09       Impact factor: 5.103

2.  Respiratory syncytial virus load, viral dynamics, and disease severity in previously healthy naturally infected children.

Authors:  Chadi M El Saleeby; Andy J Bush; Lisa M Harrison; Jody A Aitken; John P Devincenzo
Journal:  J Infect Dis       Date:  2011-10-01       Impact factor: 5.226

3.  Respiratory syncytial virus G protein and G protein CX3C motif adversely affect CX3CR1+ T cell responses.

Authors:  Jennifer Harcourt; Rene Alvarez; Les P Jones; Christine Henderson; Larry J Anderson; Ralph A Tripp
Journal:  J Immunol       Date:  2006-02-01       Impact factor: 5.422

4.  Structure of RSV fusion glycoprotein trimer bound to a prefusion-specific neutralizing antibody.

Authors:  Jason S McLellan; Man Chen; Sherman Leung; Kevin W Graepel; Xiulian Du; Yongping Yang; Tongqing Zhou; Ulrich Baxa; Etsuko Yasuda; Tim Beaumont; Azad Kumar; Kayvon Modjarrad; Zizheng Zheng; Min Zhao; Ningshao Xia; Peter D Kwong; Barney S Graham
Journal:  Science       Date:  2013-04-25       Impact factor: 47.728

5.  Function of the respiratory syncytial virus small hydrophobic protein.

Authors:  Sandra Fuentes; Kim C Tran; Priya Luthra; Michael N Teng; Biao He
Journal:  J Virol       Date:  2007-05-09       Impact factor: 5.103

6.  Genetic variability of group A human respiratory syncytial virus strains circulating in Germany from 1998 to 2007.

Authors:  Janine Reiche; Brunhilde Schweiger
Journal:  J Clin Microbiol       Date:  2009-04-22       Impact factor: 5.948

7.  Nonreplicating vaccines can protect african green monkeys from the memphis 37 strain of respiratory syncytial virus.

Authors:  Jim E Eyles; J Erik Johnson; Shakuntala Megati; Vidia Roopchand; Paul J Cockle; Risini Weeratna; Shawn Makinen; Tom P Brown; Susanne Lang; Susan E Witko; Cheryl S Kotash; Julia Li; Kate West; Oscar Maldonado; Derek J Falconer; Clare Lees; George J Smith; Phil White; Paul Wright; Peter T Loudon; James R Merson; Kathrin U Jansen; Maninder K Sidhu
Journal:  J Infect Dis       Date:  2013-04-17       Impact factor: 5.226

8.  Vaccination to induce antibodies blocking the CX3C-CX3CR1 interaction of respiratory syncytial virus G protein reduces pulmonary inflammation and virus replication in mice.

Authors:  Wenliang Zhang; Youngjoo Choi; Lia M Haynes; Jennifer L Harcourt; Larry J Anderson; Les P Jones; Ralph A Tripp
Journal:  J Virol       Date:  2009-10-28       Impact factor: 5.103

9.  Identification of immunodominant epitopes derived from the respiratory syncytial virus fusion protein that are recognized by human CD4 T cells.

Authors:  Grada M van Bleek; Martien C Poelen; Robbert van der Most; Humphrey F Brugghe; Hans A M Timmermans; Claire J Boog; Peter Hoogerhout; Henny G Otten; Cécile A C M van Els
Journal:  J Virol       Date:  2003-01       Impact factor: 5.103

10.  Human respiratory syncytial virus Memphis 37 grown in HEp-2 cells causes more severe disease in lambs than virus grown in Vero cells.

Authors:  Rachel J Derscheid; Albert van Geelen; Jodi L McGill; Jack M Gallup; Tomas Cihlar; Randy E Sacco; Mark R Ackermann
Journal:  Viruses       Date:  2013-11-22       Impact factor: 5.048

View more
  16 in total

1.  Deep sequencing of RSV from an adult challenge study and from naturally infected infants reveals heterogeneous diversification dynamics.

Authors:  Jessica W Lau; Young-In Kim; Ryan Murphy; Ruchi Newman; Xiao Yang; Michael Zody; John DeVincenzo; Yonatan H Grad
Journal:  Virology       Date:  2017-08-03       Impact factor: 3.616

2.  Comparative Therapeutic Potential of ALX-0171 and Palivizumab against Respiratory Syncytial Virus Clinical Isolate Infection of Well-Differentiated Primary Pediatric Bronchial Epithelial Cell Cultures.

Authors:  Lindsay Broadbent; Hong Guo Parke; Lyndsey J Ferguson; Andrena Millar; Michael D Shields; Laurent Detalle; Ultan F Power
Journal:  Antimicrob Agents Chemother       Date:  2020-01-27       Impact factor: 5.191

Review 3.  Advances in respiratory virus therapeutics - A meeting report from the 6th isirv Antiviral Group conference.

Authors:  John H Beigel; Hannah H Nam; Peter L Adams; Amy Krafft; William L Ince; Samer S El-Kamary; Amy C Sims
Journal:  Antiviral Res       Date:  2019-04-08       Impact factor: 5.970

Review 4.  A review of metabolomics approaches and their application in identifying causal pathways of childhood asthma.

Authors:  Kedir N Turi; Lindsey Romick-Rosendale; Kelli K Ryckman; Tina V Hartert
Journal:  J Allergy Clin Immunol       Date:  2017-05-04       Impact factor: 10.793

Review 5.  Zika Vaccines: Role for Controlled Human Infection.

Authors:  Anna P Durbin; Stephen S Whitehead
Journal:  J Infect Dis       Date:  2017-12-16       Impact factor: 5.226

Review 6.  Controlled Human Infection Models To Accelerate Vaccine Development.

Authors:  Robert K M Choy; A Louis Bourgeois; Christian F Ockenhouse; Richard I Walker; Rebecca L Sheets; Jorge Flores
Journal:  Clin Microbiol Rev       Date:  2022-07-06       Impact factor: 50.129

7.  Safety and Antiviral Effects of Nebulized PC786 in a Respiratory Syncytial Virus Challenge Study.

Authors:  John DeVincenzo; Lindsey Cass; Alison Murray; Kathy Woodward; Elizabeth Meals; Matthew Coates; Leah Daly; Vicky Wheeler; Julie Mori; Charlie Brindley; Amanda Davis; Meabh McCurdy; Kazuhiro Ito; Bryan Murray; Pete Strong; Garth Rapeport
Journal:  J Infect Dis       Date:  2022-06-15       Impact factor: 7.759

8.  Delivery of ALX-0171 by inhalation greatly reduces respiratory syncytial virus disease in newborn lambs.

Authors:  Alejandro Larios Mora; Laurent Detalle; Jack M Gallup; Albert Van Geelen; Thomas Stohr; Linde Duprez; Mark R Ackermann
Journal:  MAbs       Date:  2018-07       Impact factor: 5.857

Review 9.  Sendai Virus-Vectored Vaccines That Express Envelope Glycoproteins of Respiratory Viruses.

Authors:  Charles J Russell; Julia L Hurwitz
Journal:  Viruses       Date:  2021-05-29       Impact factor: 5.048

10.  Kinetics of Respiratory Syncytial Virus (RSV) Memphis Strain 37 (M37) Infection in the Respiratory Tract of Newborn Lambs as an RSV Infection Model for Human Infants.

Authors:  Alejandro Larios Mora; Laurent Detalle; Albert Van Geelen; Michael S Davis; Thomas Stohr; Jack M Gallup; Mark R Ackermann
Journal:  PLoS One       Date:  2015-12-07       Impact factor: 3.240

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.