Alan M O'Neill1, Kate A Worthing2, Nikhil Kulkarni1, Fengwu Li1, Teruaki Nakatsuji1, Dominic McGrosso3,4, Robert H Mills3,4, Gayathri Kalla5, Joyce Y Cheng1, Jacqueline M Norris6, Kit Pogliano5, Joe Pogliano5, David J Gonzalez3,4, Richard L Gallo1. 1. Department of Dermatology, University of California, San Diego, San Diego, United States. 2. College of Veterinary Medicine, University of Arizona, Oro Valley, United States. 3. Department of Pharmacology, University of California, San Diego, San Diego, United States. 4. Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, San Diego, United States. 5. Division of Biological Sciences, University of California, San Diego, San Diego, United States. 6. Sydney School of Veterinary Science, University of Sydney, Sydney, Australia.
Abstract
Methicillin-resistant Staphylococcus pseudintermedius (MRSP) is an important emerging zoonotic pathogen that causes severe skin infections. To combat infections from drug-resistant bacteria, the transplantation of commensal antimicrobial bacteria as a therapeutic has shown clinical promise. We screened a collection of diverse staphylococcus species from domestic dogs and cats for antimicrobial activity against MRSP. A unique strain (S. felis C4) was isolated from feline skin that inhibited MRSP and multiple gram-positive pathogens. Whole genome sequencing and mass spectrometry revealed several secreted antimicrobials including a thiopeptide bacteriocin micrococcin P1 and phenol-soluble modulin beta (PSMβ) peptides that exhibited antimicrobial and anti-inflammatory activity. Fluorescence and electron microscopy revealed that S. felis antimicrobials inhibited translation and disrupted bacterial but not eukaryotic cell membranes. Competition experiments in mice showed that S. felis significantly reduced MRSP skin colonization and an antimicrobial extract from S. felis significantly reduced necrotic skin injury from MRSP infection. These findings indicate a feline commensal bacterium that could be utilized in bacteriotherapy against difficult-to-treat animal and human skin infections.
Methicillin-resistant Staphylococcus pseudintermedius (MRSP) is an important emerging zoonotic pathogen that causes severe skin infections. To combat infections from drug-resistant bacteria, the transplantation of commensal antimicrobial bacteria as a therapeutic has shown clinical promise. We screened a collection of diverse staphylococcus species from domestic dogs and cats for antimicrobial activity against MRSP. A unique strain (S. felis C4) was isolated from feline skin that inhibited MRSP and multiple gram-positive pathogens. Whole genome sequencing and mass spectrometry revealed several secreted antimicrobials including a thiopeptide bacteriocin micrococcin P1 and phenol-soluble modulin beta (PSMβ) peptides that exhibited antimicrobial and anti-inflammatory activity. Fluorescence and electron microscopy revealed that S. felis antimicrobials inhibited translation and disrupted bacterial but not eukaryotic cell membranes. Competition experiments in mice showed that S. felis significantly reduced MRSP skin colonization and an antimicrobial extract from S. felis significantly reduced necrotic skin injury from MRSP infection. These findings indicate a feline commensal bacterium that could be utilized in bacteriotherapy against difficult-to-treat animal and human skin infections.
Skin is colonized by hundreds of diverse bacterial species that exist within a complex and dynamic chemical landscape. These chemical interactions can play important roles in skin health, immune education and protection against pathogen colonization and infection (Sanford and Gallo, 2013). The composition of the skin microbial community of humans and animals varies extensively, in part due to different skin habitats, that is increased hair density in animals, as well as more subtle differences in the chemical and biological conditions of the skin (Grice and Segre, 2011; Ross et al., 2018). Overall, the human microbial skin community is distinct from and significantly less diverse than that of both wild and domestic animals (Ross et al., 2018). Human skin is generally dominated by few taxa present at high abundance for example cutibacteria, streptococci, and staphylococci, whereas canine skin harbors a more equally distributed and diverse group of taxa (Song et al., 2013). Naturally, close contact between humans and animals can be a source for microbial transmission (Frana et al., 2013; Lai et al., 2017). Although it remains to be determined if shared taxa are stable over time, there are reports that exposure to pets early in life can be protective against atopic disease in later life (Mandhane et al., 2009).In contrast, there are also many documented cases of human staphylococcal infection from epidemiological exposure to dogs (Somayaji et al., 2016). Companion animals can act as reservoirs for methicillin-resistant S. aureus (MRSA) and more commonly, S. pseudintermedius (MRSP), with both species sharing many common invasion and virulence factors (Garbacz et al., 2013). The zoonotic significance of S. pseudintermedius may have been previously underestimated because it was frequently misidentified as S. aureus in human wound infections (Börjesson et al., 2015). More advanced diagnostic techniques such as matrix-assisted laser desorption/ionization-time of flight (MALDI-TOF) mass spectrometry have led to increased detection of human S. pseudintermedius infections (Ference et al., 2019). Colonization of S. pseudintermedius is a contributing factor in canine atopic dermatitis (AD). Interestingly, the prevalence of AD in humans and AD in dogs are similar (10–15% in US) and present with remarkably similar immunological and clinical manifestations (Marsella and Girolomoni, 2009; Silverberg, 2019). Likewise, several studies have reported a decrease in the microbiome diversity of AD and increased colonization of S aureus in humans and S. pseudintermedius in dogs (Fazakerley et al., 2009; Nakatsuji and Gallo, 2019; Older et al., 2020). In human AD, S. aureus was identified in higher relative abundances during disease flares (Kong et al., 2012). Similarly, the relative abundance of S. pseudintermedius was also shown to increase with disease flares in canine AD (Bradley et al., 2016). Common treatment modalities exist for both diseases. Dilute bleach baths are a common antiseptic treatment for AD, with the goal of reducing the carriage of staphylococci (Banovic et al., 2018; Chopra et al., 2017). However, its effectiveness as an antibacterial agent is controversial (Sawada et al., 2019).An alternative and promising approach is not to disrupt but to re-establish the community of microbes on the skin that promote health. To do this our group and others have identified naturally occurring commensal species on healthy human skin that express antimicrobial activity against pathogens. A recent successful example of this approach is the discovery and use of commensal staphylococcus strains that produce lantibiotics that when applied to skin of patients with AD reduced S. aureus counts and improved clinical outcome (Nakatsuji et al., 2021a; Nakatsuji et al., 2021b). Other studies have also identified antimicrobial activity in some staphylococcus strains belonging to species of S. lugdunensis (Zipperer et al., 2016), S. epidermidis (Cogen et al., 2010), and S. capitis (O’Neill et al., 2020). In contrast, very little is known regarding the antimicrobial activity of staphylococci derived from the animal commensal microbiome and their clinical potential against skin infection. Here, we identified the strain S. felis C4, a potent antimicrobial isolate from feline skin that inhibited the growth of MRSP in vitro and in vivo. S. felis C4 produced a thiopeptide bacteriocin and several α-helical amphipathic peptides with antimicrobial and anti-inflammatory activity. This discovery represents a potential new bacteriotherapeutic for human and animal skin diseases associated with S. pseudintermedius colonization and infection.
Results
A screen of animal-derived staphylococcus isolates identifies a feline skin commensal bacterium with broad-spectrum antimicrobial activity
We sought to determine whether commensal staphylococci collected from the skin, nasal, oral and perineal sites of companion dogs and cats exhibit antimicrobial activity against methicillin-resistant S. pseudintermedius (MRSP) ST71 (Figure 1AMa et al., 2020; Worthing et al., 2018b). Fifty-eight staphylococcus isolates across the coagulase-positive (CoPS) and coagulase-negative (CoNS) groups were screened, including validated antimicrobial strains of human origin, S. hominis A9 (Nakatsuji et al., 2017) and S. capitis E12 (O’Neill et al., 2020) and a non-active S. aureus 113 negative control strain (Figure 1B). The animal test isolates were screened for antimicrobial activity by live co-culture on agar plates or in the presence of sterile conditioned supernatant, as illustrated in Figure 1A. Amongst all test isolates, five strains demonstrated greater than 80 % inhibition of S. pseudintermedius growth (dashed line) across all three different dilutions of supernatant (1:1, 1:4, 1:8) (Figure 1C). Surprisingly, these strains exhibited greater potency compared to the positive control S. hominis A9 supernatant (indicated by black circle), which inhibited growth of S. pseudintermedius in a 1:1 dilution, but not at 1:4 or lower. Amongst the five positive hits, three were identified as S. felis and two S. pseudintermedius. In the second independent antimicrobial assay, all five isolates including positive control S. hominis A9, produced an observable zone of inhibition against S. pseudintermedius during live co-culture on agar (Figure 1D). The two feline S. felis species (C4, N26 labelled with white arrows) produced the largest inhibitory zones, extending 3.0–3.3 mm outward from the edge of the growing colony. The S. felis C4 strain was chosen for further analysis, as it demonstrated potent activity and was isolated from healthy skin. To investigate the significance and selectivity of the S. felis antimicrobial supernatant, we tested its capacity to inhibit the growth of other clinically relevant, gram-positive and gram-negative pathogens (of which several belong to the clinically-relevant ESKAPE group). Of the four gram-negative strains tested, only moderate inhibition was demonstrated after 18 hr incubation with 80–100% of the S. felis C4 supernatant (Figure 1E). In contrast, bacterial culture in the presence of just 1–5% of S. felis C4 supernatant was sufficient to inhibit >80% growth of all four gram-positive organisms, including S. pseudintermedius, E. faecium, B. subtilis, and S. aureus.
Figure 1.
Screening and discovery of a feline skin commensal bacterium that inhibits drug-resistant gram-positive pathogens.
(A) Illustration of the selection and screening strategy of animal-derived staphylococci against the growth of methicillin-resistant S. pseudintermedius (MRSP) ST71 in liquid culture and agar co-culture assays. (B) The panel of 58 feline and canine isolates selected for antimicrobial testing, as well as human-derived S. hominis A9 and S. capitis E12 positive control antimicrobial strains and the non-antimicrobial S. aureus 113 negative control. (C) Inhibition of S. pseudintermedius ST71 growth by OD600, relative to TSB control at 100%, after 18 h incubation in 50%, 25%, or 12.5 % (1:1, 1:4, 1:8 ratio) sterile conditioned supernatant from all staphylococci isolates. Greater than 80 % inhibition of growth was considered antimicrobial (AM+). (D) Images of the agar co-culture assay showing zone of inhibition (black circle surrounding colony) produced by all staphylococci test isolates against S. pseudintermedius ST71, including S. felis C4, N26, V13 (S. f C4, S. f N26, S. f V13), S. pseudintermedius N13 and Q13 (S. p N13 and S. p Q13), and positive control S. hominis A9 (S. h A9, all indicated by arrows). (E) Inhibition of bacterial growth by OD600, normalized to TSB alone at 100%, against select gram-positive and gram-negative pathogens after 18 h incubation (48 h incubation for E. faecium) in the presence of increasing amounts of sterile conditioned supernatant from S. felis C4 overnight growth. Error bars indicate SEM. Representative of three separate experiments.
(A) Supernatant of indicated antimicrobial S. felis strains (S. f C4, N26, V13 were incubated with) were incubated with 75 % ammonium sulfate (AS) and the resulting precipitate was inoculated onto agar containing S. pseudintermedius ST71, to determine antimicrobial activity. (B) Supernatant of S. felis C4, positive-control S. hominis A9, or negative-control S. felis ATCC 49168 was extracted in 75 % AS or 25 % n-butanol and activity of the precipitate and non-precipitate fractions were assayed against S. pseudintermedius ST71. (C) Supernatant of S. felis C4 (S. f C4), S. hominis A9 (S. h A9), S. capitis E12 (S. c E12) or TSB alone, were maintained at room temperature (RT) for 1 week or boiled at 95 °C, for 30 min and activity determined by inoculation directly onto agar containing S. pseudintermedius ST71. (D) Total protein silver stain of S. felis C4 supernatant before precipitation or after precipitation in 75 % AS or 25 % butanol. (E) Minimum inhibitory concentration (MIC) table of the S. felis C4 extract against multiple isolates of S. aureus and S. pseudintermedius as well as several common commensal CoNS.
(A) Decrease in crystal violet staining of a 4 h preformed S. pseudintermedius ST71 biofilm during 8 h incubation with 100% S. felis C4 sterile supernatant. (B) Decrease in crystal violet staining of a 4 h preformed S. pseudintermedius ST71 biofilm after 24 h incubation with serially diluted S. felis C4 sterile supernatant (100%) or S. felis C4 extract (1 mg/ml). Right inset is a representative image of crystal violet staining after incubation with 100% S. felis C4 supernatant. (A–B) Error bars indicate SEM. Representative of two separate experiments. A two-tailed, unpaired Student’s t test was performed. p values: *p < 0.05; **p < 0.01; ***p < 0.001.
Screening and discovery of a feline skin commensal bacterium that inhibits drug-resistant gram-positive pathogens.
(A) Illustration of the selection and screening strategy of animal-derived staphylococci against the growth of methicillin-resistant S. pseudintermedius (MRSP) ST71 in liquid culture and agar co-culture assays. (B) The panel of 58 feline and canine isolates selected for antimicrobial testing, as well as human-derived S. hominis A9 and S. capitis E12 positive control antimicrobial strains and the non-antimicrobial S. aureus 113 negative control. (C) Inhibition of S. pseudintermedius ST71 growth by OD600, relative to TSB control at 100%, after 18 h incubation in 50%, 25%, or 12.5 % (1:1, 1:4, 1:8 ratio) sterile conditioned supernatant from all staphylococci isolates. Greater than 80 % inhibition of growth was considered antimicrobial (AM+). (D) Images of the agar co-culture assay showing zone of inhibition (black circle surrounding colony) produced by all staphylococci test isolates against S. pseudintermedius ST71, including S. felis C4, N26, V13 (S. f C4, S. f N26, S. f V13), S. pseudintermedius N13 and Q13 (S. p N13 and S. p Q13), and positive control S. hominis A9 (S. h A9, all indicated by arrows). (E) Inhibition of bacterial growth by OD600, normalized to TSB alone at 100%, against select gram-positive and gram-negative pathogens after 18 h incubation (48 h incubation for E. faecium) in the presence of increasing amounts of sterile conditioned supernatant from S. felis C4 overnight growth. Error bars indicate SEM. Representative of three separate experiments.
Generation of a partially purified antimicrobial extract from S. felis C4.
(A) Supernatant of indicated antimicrobial S. felis strains (S. f C4, N26, V13 were incubated with) were incubated with 75 % ammonium sulfate (AS) and the resulting precipitate was inoculated onto agar containing S. pseudintermedius ST71, to determine antimicrobial activity. (B) Supernatant of S. felis C4, positive-control S. hominis A9, or negative-control S. felis ATCC 49168 was extracted in 75 % AS or 25 % n-butanol and activity of the precipitate and non-precipitate fractions were assayed against S. pseudintermedius ST71. (C) Supernatant of S. felis C4 (S. f C4), S. hominis A9 (S. h A9), S. capitis E12 (S. c E12) or TSB alone, were maintained at room temperature (RT) for 1 week or boiled at 95 °C, for 30 min and activity determined by inoculation directly onto agar containing S. pseudintermedius ST71. (D) Total protein silver stain of S. felis C4 supernatant before precipitation or after precipitation in 75 % AS or 25 % butanol. (E) Minimum inhibitory concentration (MIC) table of the S. felis C4 extract against multiple isolates of S. aureus and S. pseudintermedius as well as several common commensal CoNS.
S. felis C4 supernatant and extract disrupt S. pseudintermedius biofilm.
(A) Decrease in crystal violet staining of a 4 h preformed S. pseudintermedius ST71 biofilm during 8 h incubation with 100% S. felis C4 sterile supernatant. (B) Decrease in crystal violet staining of a 4 h preformed S. pseudintermedius ST71 biofilm after 24 h incubation with serially diluted S. felis C4 sterile supernatant (100%) or S. felis C4 extract (1 mg/ml). Right inset is a representative image of crystal violet staining after incubation with 100% S. felis C4 supernatant. (A–B) Error bars indicate SEM. Representative of two separate experiments. A two-tailed, unpaired Student’s t test was performed. p values: *p < 0.05; **p < 0.01; ***p < 0.001.Of the three antimicrobial S. felis isolates, only the C4 supernatant retained activity after precipitation with 75 % ammonium sulfate (AS) (Figure 1—figure supplement 1A). Moreover, 75 % AS was highly effective in precipitating the antimicrobial factor(s) from the C4 supernatant since no activity could be visualized in the non-precipitate fraction (Figure 1—figure supplement 1B). This effect was also achieved with a simpler extraction by n-butanol. The antimicrobial butanol extract remained active up to 1 week at room temperature (RT) and was stable after boiling (Figure 1—figure supplement 1C). As expected, the butanol extraction provided a partially purified and enriched antimicrobial fraction compared to that of the crude supernatant and AS precipitation (Figure 1—figure supplement 1D). Therefore, this S. felis C4 extract obtained via n-butanol extraction was then adopted for further experiments. The S. felis extract was found to be effective against multiple clinical isolates of S. aureus and S. pseudintermedius with a MIC range of 0.4–6.25 μg/ml (Figure 1—figure supplement 1E). In contrast, some CoNS strains, including S. hominis and S. lugdunensis were less sensitive and had a higher MIC of 12.5 μg/ml.
Figure 1—figure supplement 1.
Generation of a partially purified antimicrobial extract from S. felis C4.
(A) Supernatant of indicated antimicrobial S. felis strains (S. f C4, N26, V13 were incubated with) were incubated with 75 % ammonium sulfate (AS) and the resulting precipitate was inoculated onto agar containing S. pseudintermedius ST71, to determine antimicrobial activity. (B) Supernatant of S. felis C4, positive-control S. hominis A9, or negative-control S. felis ATCC 49168 was extracted in 75 % AS or 25 % n-butanol and activity of the precipitate and non-precipitate fractions were assayed against S. pseudintermedius ST71. (C) Supernatant of S. felis C4 (S. f C4), S. hominis A9 (S. h A9), S. capitis E12 (S. c E12) or TSB alone, were maintained at room temperature (RT) for 1 week or boiled at 95 °C, for 30 min and activity determined by inoculation directly onto agar containing S. pseudintermedius ST71. (D) Total protein silver stain of S. felis C4 supernatant before precipitation or after precipitation in 75 % AS or 25 % butanol. (E) Minimum inhibitory concentration (MIC) table of the S. felis C4 extract against multiple isolates of S. aureus and S. pseudintermedius as well as several common commensal CoNS.
We next evaluated the activity of S. felis C4 extract to disrupt bacterial biofilms. Biofilm formation is considered an important determinant of staphylococci virulence and is associated with increased skin colonization and severity of disease (Di Domenico et al., 2018; Kwiecinski et al., 2015). Reports have shown that most clinically-derived S. pseudintermedius strains are biofilm producers (Singh et al., 2013). A 4 hr preformed biofilm of pseudintermedius ST71 showed a significant decrease in crystal violet (CV) staining over time, when incubated with 100 % conditioned supernatant of S. felis C4, indicating biofilm disruption and degradation (Figure 1—figure supplement 2A). The S. felis C4 extract had anti-biofilm activity similar to crude conditioned supernatant, with biofilm mass reduced by 48 % at 250 μg/ml and 58 % at 500 μg/ml (Figure 1—figure supplement 2B).
Figure 1—figure supplement 2.
S. felis C4 supernatant and extract disrupt S. pseudintermedius biofilm.
(A) Decrease in crystal violet staining of a 4 h preformed S. pseudintermedius ST71 biofilm during 8 h incubation with 100% S. felis C4 sterile supernatant. (B) Decrease in crystal violet staining of a 4 h preformed S. pseudintermedius ST71 biofilm after 24 h incubation with serially diluted S. felis C4 sterile supernatant (100%) or S. felis C4 extract (1 mg/ml). Right inset is a representative image of crystal violet staining after incubation with 100% S. felis C4 supernatant. (A–B) Error bars indicate SEM. Representative of two separate experiments. A two-tailed, unpaired Student’s t test was performed. p values: *p < 0.05; **p < 0.01; ***p < 0.001.
Purification and identification of PSMβ peptides as antimicrobial products of S. felis C4
To determine the nature of the antimicrobial product produced by S. felis C4, sterile culture supernatant was purified by HPLC. This yielded two major peaks that eluted at 44% and 47% acetonitrile (Figure 2A). Anti-S. pseudintermedius activity was predominantly associated with fraction 32 which eluted at 47 % acetonitrile (Figure 2B). SDS PAGE and protein silver staining of the active and inactive fractions revealed a unique band of roughly 5 kDa in size in the active fraction 32 (Figure 2C). To determine if this small protein was responsible for antimicrobial activity, gel slices of the fraction 32 lane corresponding to small, medium and larger proteins ( ≤ 5 kDa, 5–20 kDa and 20–50 kDa, respectively) were excised and extracted by acetone precipitation as previously described (Botelho et al., 2010; Zhang et al., 2015). Only the ≤5 kDa band demonstrated antimicrobial activity after incubation with S. pseudintermedius (Figure 2D), thereby suggesting the likely candidate to be a small peptide. Mass spectrometry (MS) analysis of the top eight hits in the active and non-active HPLC fractions identified several putative small antimicrobial peptides (AMP), representing the phenol soluble modulin beta (PSMβ1–3) and gamma (PSMγ, aka delta-hemolysin) families and a peptide of unknown function containing the EF-HAND domain, common amongst some antimicrobial Ca2+ binding proteins, such as S100A8/S100A9 (Chazin, 2011; Figure 2E). Whole genome analysis of the S. felis C4 strain confirmed the presence of three PSMβ-encoding genes (Figure 2F). Based on sequence similarities to mammalian cationic AMPs such as cathelicidin LL-37 the PSMβ and EF-HAND domain peptides were predicted to have α-helical amphipathic structure (Figure 2G). Synthetic N-formylated versions of all three S. felis C4 PSMβ1–3 and the EF-hand domain containing peptide were then generated and added to primary cell cultures of normal human keratinocytes (NHEK) for 24 hr to determine the level of cytotoxicity as measured by lactate dehydrogenase (LDH) release. The positive control cytotoxic PSMγ induced maximal cell death with 100 % LDH release at 62.5 ug/ml, yet at this concentration none of the PSMβ peptides nor the crude S. felis extract exceeded 20 % LDH release (Figure 2H), suggesting that S. felis C4 PSMβs are not cytotoxic.
Figure 2.
HPLC purification yields an antimicrobial fraction from S. felis C4 supernatant.
(A) Reverse-phase high-performance liquid chromatography (HPLC) elution profile from sterile supernatant of S. felis C4 strain loaded onto a C8 column. (B) Inset image of antimicrobial activity exhibited by fraction 32 against S. pseudintermedius ST71 corresponding to the indicated peak. (C) Silver stain of total protein content in the different fractions indicated. (D) Radial diffusion assay of antimicrobial activity of the AM + fraction 32 after extraction and acetone precipitation of proteins within different sized silver stain gel fragments. (E) Mass spectrometry (MS) table of the top eight peptide hits obtained from HPLC fractions that were active (fraction 32) or inactive (26, 30, 36) against S. pseudintermedius ST71. (F) ClustalW multiple amino acid sequence alignment of all three S. felis C4 genetically-encoded PSMβ peptides with predicted net charge at pH 7.4 (Prot pi) and amino acid sequence of a EF-hand domain-containing peptide with unknown function. (G) Alpha helical wheel plots of S. felis C4 PSMβ1–3 and EF-HAND domain peptide, indicating conserved α-helical, amphipathic-like structures with indicated hydrophobic yellow residues confined to one side (indicated by arrow) and gray hydrophilic residues on the opposing side. (H) LDH release in NHEKs after 24 h treatment with increasing concentrations of S. felis C4 extract, S. felis C4 EF-HAND synthetic peptide, S. felis formylated synthetic PSMβ1, PSMβ2, PSMβ3, or positive control cytotoxic PSMγ from S. epidermidis. Percentage (%) cytotoxicity measured by maximum LDH release into supernatant collected after untreated cell freeze thaw.
HPLC purification yields an antimicrobial fraction from S. felis C4 supernatant.
(A) Reverse-phase high-performance liquid chromatography (HPLC) elution profile from sterile supernatant of S. felis C4 strain loaded onto a C8 column. (B) Inset image of antimicrobial activity exhibited by fraction 32 against S. pseudintermedius ST71 corresponding to the indicated peak. (C) Silver stain of total protein content in the different fractions indicated. (D) Radial diffusion assay of antimicrobial activity of the AM + fraction 32 after extraction and acetone precipitation of proteins within different sized silver stain gel fragments. (E) Mass spectrometry (MS) table of the top eight peptide hits obtained from HPLC fractions that were active (fraction 32) or inactive (26, 30, 36) against S. pseudintermedius ST71. (F) ClustalW multiple amino acid sequence alignment of all three S. felis C4 genetically-encoded PSMβ peptides with predicted net charge at pH 7.4 (Prot pi) and amino acid sequence of a EF-hand domain-containing peptide with unknown function. (G) Alpha helical wheel plots of S. felis C4 PSMβ1–3 and EF-HAND domain peptide, indicating conserved α-helical, amphipathic-like structures with indicated hydrophobic yellow residues confined to one side (indicated by arrow) and gray hydrophilic residues on the opposing side. (H) LDH release in NHEKs after 24 h treatment with increasing concentrations of S. felis C4 extract, S. felis C4 EF-HAND synthetic peptide, S. felis formylated synthetic PSMβ1, PSMβ2, PSMβ3, or positive control cytotoxic PSMγ from S. epidermidis. Percentage (%) cytotoxicity measured by maximum LDH release into supernatant collected after untreated cell freeze thaw.
S. felis C4 extract and PSMβ peptides exhibit anti-inflammatory activity by suppressing TLR-mediated inflammation
Unlike the well-characterized cytolytic and inflammatory activities of PSMα, a defined role for PSMβ in mediating host interactions has been largely unexplored (Da et al., 2017). To investigate the potential effects of S. felis C4 on the host immune response, we stimulated cells with various TLR agonists in the presence or absence of the extract or the individual PSMs and measured inflammatory gene expression. NHEKs were treated with S. felis PSMβ2, PSMβ3, extract, DMSO control alone, or each in combination with the TLR2 agonist MALP-2 (200 ng/μl) or the TLR3 agonist Poly I:C (0.4 μg/ml) for 4 hr. Neither PSMβ nor the extract resulted in any detectable increase in gene expression, whereas MALP-2 significantly increased the expression of hBD-2, and Poly I:C significantly increased CXCL10 and IL-6 expression (Figure 3A–C). Interestingly, these TLR-mediated responses were significantly reduced during co-treatment with S. felis C4 PSMβ or extract. This result was confirmed by ELISA, showing that PSMβ2 had a significant effect on suppressing CXCL10 secretion in NHEKs after 24 hr co-treatment (Figure 3D). To determine if this interaction is specific for epithelial cells, we also stimulated human THP-1 macrophage-like cells with MALP-2, or the TLR4 agonist LPS and found that IL-6 and TNFα expression was decreased during co-treatment with S. felis C4 PSMβ2 (Figure 3—figure supplement 1). The addition of S. felis C4 PSMβ2 to NHEK activated by poly I:C demonstrated that PSMβ2 inhibited phosphorylation of TBK1 and IRF3 at 15 min post-stimulation with the peptide (Figure 3E). This inhibition of inflammatory target gene and kinase activity was further evaluated by the analysis of changes in global gene expression using RNA-Seq analysis of NHEKs stimulated with Poly I:C, with and without PSMβ2 at 4 hr and 24 h. Gene ontology (GO) analyses revealed the significant down-regulation of several gene clusters associated with ‘immune effector process’ and ‘type I IFN signaling’ at 4 h during co-treatment of PSMβ2 and Poly I:C (Figure 3F). A heatmap of selected genes within the ‘Immune response’ GO term at 4 h post-treatment further highlighted the suppressive effect, and also importantly showed that PSMβ2 treatment alone did not induce an immunological response in NHEKs (Figure 3G). However, when NHEKs were treated with PSMβ2 in the absence of an inflammatory stimulus, we identified the downregulation of genes within GO terms such as “cytokine-mediated signaling” and “pathogenic E. coli infection” (Figure 3—figure supplement 2), suggesting that exposure to PSMβ2 primes cells to dampen potential inflammatory mediators in response to TLR ligands. This contrasted with PSMβ2-upregulated genes which were mostly associated with biosynthetic pathways including lipid and amino acid metabolism (data not shown).
Figure 3.
Antimicrobial S. felis C4 extract and PSMβ suppress TLR-mediated inflammation.
mRNA transcript abundance of hBD2 (A), IL-6 (B) and CXCL10 (C) as measured by qPCR in NHEKs stimulated with or without TLR2/6 agonist MALP-2 (M-2) (200 ng/ml) or TLR3 agonist Poly I:C (PI:C) (0.4 μg/ml) in the presence or absence of S. felis C4 extract, PSMβ2 or PSMβ3 (10 μg/ml) or DMSO control (0.1%) at 4 hr post-treatment. (D) Quantification of CXCL10 protein by ELISA from the supernatant of NHEKs stimulated with MALP-2 or Poly I:C in the presence or absence of S. felis extract, PSMβ2, PSMβ3 or DMSO control 24 hr post-treatment. (A–D) Error bars indicate SEM. One-way ANOVA with multiple corrections (Tukey’s correction) was performed. p values: * p < 0.05; ** p < 0.01; *** p < 0.001. (E) Time-course of the TLR3 signaling cascade by immunoblot of phosphorylated TBK1 (P-TBK1) and IRF-3 (P-IRF-3) proteins after stimulation of NHEKs with Poly I:C (PI:C), PSMβ2 (β2), or co-treatment with Poly I:C and PSMβ2 (PI:C+β2). (F) Gene ontology (GO) pathway analysis of genes downregulated in NHEKs after 4 hr co-treatment with Poly I:C and PSMβ2 versus treatment with Poly I:C alone. (G) Hierarchical clustering and Heatmap visualization of selected genes from GO enriched ‘immune response’ pathway (1.5-fold change) 4 hr post-treatment with DMSO, PSMβ2 or Poly I:C alone or with Poly I:C and PSMβ2 cotreatment. (H) Growth of S. pseudintermedius ST71 (OD600 nm) after 18 hr incubation with increasing concentrations of S. felis C4 extract, formylated peptides PSMβ1, PSMβ2, PSMβ3, EFHAND domain-containing peptide or non-formylated PSMβ2. Error bars indicate SEM. Representative of two independent experiments.
Transcript abundance of inflammatory cytokines IL-6 and TNFα in THP-1 cells stimulated with or without TLR2/6 agonist MALP-2 (200 ng/ml) or TLR4 agonist LPS (1 μg/ml) in the presence or absence of S. felis C4 extract, PSMβ2 or PSMβ3 (10 μg/ml) or DMSO control (0.1%) 4 hr post-treatment. Error bars indicate SEM. One-way ANOVA with multiple corrections (Tukey’s correction) was performed. p values: * p < 0.05; **, p < 0.01; *** p < 0.001.
GO pathway analysis of genes down-regulated in NHEKs at 24 hr post treatment with PSMβ2 versus DMSO control.
Growth of S. pseudintermedius ST71 (OD600), normalized to TSB alone at 100% at 18 hr post-treatment with N-formylated and non-N-formylated (no N-f) PSMβ peptides alone or in combination. Error bars indicated SEM.
Figure 3—figure supplement 1.
S. felis C4 PSMβ2 reduces TLR2- and TLR4-stimulated transcripts in THP-1 macrophages.
Transcript abundance of inflammatory cytokines IL-6 and TNFα in THP-1 cells stimulated with or without TLR2/6 agonist MALP-2 (200 ng/ml) or TLR4 agonist LPS (1 μg/ml) in the presence or absence of S. felis C4 extract, PSMβ2 or PSMβ3 (10 μg/ml) or DMSO control (0.1%) 4 hr post-treatment. Error bars indicate SEM. One-way ANOVA with multiple corrections (Tukey’s correction) was performed. p values: * p < 0.05; **, p < 0.01; *** p < 0.001.
Figure 3—figure supplement 2.
S. felis C4 PSMβ2 downregulates transcripts associated with cytokine signaling.
GO pathway analysis of genes down-regulated in NHEKs at 24 hr post treatment with PSMβ2 versus DMSO control.
Antimicrobial S. felis C4 extract and PSMβ suppress TLR-mediated inflammation.
mRNA transcript abundance of hBD2 (A), IL-6 (B) and CXCL10 (C) as measured by qPCR in NHEKs stimulated with or without TLR2/6 agonist MALP-2 (M-2) (200 ng/ml) or TLR3 agonist Poly I:C (PI:C) (0.4 μg/ml) in the presence or absence of S. felis C4 extract, PSMβ2 or PSMβ3 (10 μg/ml) or DMSO control (0.1%) at 4 hr post-treatment. (D) Quantification of CXCL10 protein by ELISA from the supernatant of NHEKs stimulated with MALP-2 or Poly I:C in the presence or absence of S. felis extract, PSMβ2, PSMβ3 or DMSO control 24 hr post-treatment. (A–D) Error bars indicate SEM. One-way ANOVA with multiple corrections (Tukey’s correction) was performed. p values: * p < 0.05; ** p < 0.01; *** p < 0.001. (E) Time-course of the TLR3 signaling cascade by immunoblot of phosphorylated TBK1 (P-TBK1) and IRF-3 (P-IRF-3) proteins after stimulation of NHEKs with Poly I:C (PI:C), PSMβ2 (β2), or co-treatment with Poly I:C and PSMβ2 (PI:C+β2). (F) Gene ontology (GO) pathway analysis of genes downregulated in NHEKs after 4 hr co-treatment with Poly I:C and PSMβ2 versus treatment with Poly I:C alone. (G) Hierarchical clustering and Heatmap visualization of selected genes from GO enriched ‘immune response’ pathway (1.5-fold change) 4 hr post-treatment with DMSO, PSMβ2 or Poly I:C alone or with Poly I:C and PSMβ2 cotreatment. (H) Growth of S. pseudintermedius ST71 (OD600 nm) after 18 hr incubation with increasing concentrations of S. felis C4 extract, formylated peptides PSMβ1, PSMβ2, PSMβ3, EFHAND domain-containing peptide or non-formylated PSMβ2. Error bars indicate SEM. Representative of two independent experiments.
S. felis C4 PSMβ2 reduces TLR2- and TLR4-stimulated transcripts in THP-1 macrophages.
Transcript abundance of inflammatory cytokines IL-6 and TNFα in THP-1 cells stimulated with or without TLR2/6 agonist MALP-2 (200 ng/ml) or TLR4 agonist LPS (1 μg/ml) in the presence or absence of S. felis C4 extract, PSMβ2 or PSMβ3 (10 μg/ml) or DMSO control (0.1%) 4 hr post-treatment. Error bars indicate SEM. One-way ANOVA with multiple corrections (Tukey’s correction) was performed. p values: * p < 0.05; **, p < 0.01; *** p < 0.001.
S. felis C4 PSMβ2 downregulates transcripts associated with cytokine signaling.
GO pathway analysis of genes down-regulated in NHEKs at 24 hr post treatment with PSMβ2 versus DMSO control.
PSMβ do not exhibit synergistic antimicrobial activity.
Growth of S. pseudintermedius ST71 (OD600), normalized to TSB alone at 100% at 18 hr post-treatment with N-formylated and non-N-formylated (no N-f) PSMβ peptides alone or in combination. Error bars indicated SEM.The antimicrobial activity of all three synthetic S. felis C4 PSMβ (PSMβ1–3) peptides in inhibiting S. pseudintermedius was observed to occur at a concentration of 50 μg/ml and the synthetic EF-HAND domain-containing peptide did not inhibit bacterial growth at concentrations up to 200 μg/ml (Figure 3H). In contrast, the native extract prepared from S. felis supernatant was found to be more potent than the synthetic PSM when added individually (Figure 3H) or in combination (Figure 3—figure supplement 3). A non-N-formylated version of PSMB2 exhibited similar activity to the N-formylated PSMβ2 version (Figure 3H). This disparity in the potency of the synthetic peptides compared to the native extract suggested that another antimicrobial molecule is produced by S. felis C4 that was not detected in the prior analyses.
Figure 3—figure supplement 3.
PSMβ do not exhibit synergistic antimicrobial activity.
Growth of S. pseudintermedius ST71 (OD600), normalized to TSB alone at 100% at 18 hr post-treatment with N-formylated and non-N-formylated (no N-f) PSMβ peptides alone or in combination. Error bars indicated SEM.
To investigate this, we conducted further genome analysis using the web server anti-SMASH to identify the potential presence of secondary metabolites encoded from biosynthetic gene clusters (BCG) (Weber et al., 2015). Interrogation of the S. felis C4 genome revealed a BCG with similarity to micrococcin P1 from Macrococcus caseolyticus (Figure 4A). Micrococcin P1 is a macrocyclic antibiotic that inhibits ribosome translation in gram-positive bacteria (Figure 4B
Carnio et al., 2000; Ciufolini and Lefranc, 2010). To determine if micrococcin P1 could be present within the S. felis C4 extract, we compared the C8 HPLC elution profile of synthetic micrococcin P1 to the native S. felis C4 extract and identified that the synthetic peptide eluted as a single major peak at 59 % acetonitrile in fractions 27 and 28 (Figure 4C). These fractions were active against S. pseudintermedius ST71 by agar radial diffusion (Figure 4C inset). Purification by HPLC of the S. felis C4 extract revealed a similar major peak that eluted at 59 % acetonitrile in fractions 27 and 28 (Figure 4D) and this also was active against S. pseudintermedius ST71 (Figure 4D inset). Mass spectrometry analysis of this elution fraction from S. felis C4 extract showed a peptide with mass of 1,144 daltons which was identical to synthetic micrococcin P1 (Figure 4E and Figure 4—figure supplement 1). Furthermore, both synthetic micrococcin P1 and the S. felis C4 antimicrobial activity could be extracted with butanol (Figure 4F). These observations strongly suggested that S. felis produces a peptide similar to micrococcin P1 and this peptide together with the previously identified PSMs contributed to the highly potent antimicrobial activity of S. felis C4.
Figure 4.
Identification of a micrococcin P1-like antimicrobial in S. felis C4 extract.
(A) Prediction of a biosynthetic gene cluster (BCG) in the S. felis C4 genome that has predicted similarity to a micrococcin P1 thiopeptide-encoding BCG. (B) Micrococcin P1 chemical structure downloaded from PubChem. (C) HPLC chromatogram of pure micrococcin P1 showing a single major peak eluted at 59 % acetonitrile into fractions 27 and 28. Inset image shows antimicrobial activity of fractions 27 and 28 against S. pseudintermedius ST71. (D) HPLC chromatogram of S. felis C4 extract showing a single major peak eluted at 59 % acetonitrile into fractions 27 and 28. Inset image shows antimicrobial activity of fractions 27 and 28 against S. pseudintermedius ST71. (E) Mass spectrometry chromatogram of similar masses and charge states generated from the synthetic peptide micrococcin P1 (top panel), HPLC fractions 27 and 28 from micrococcin P1 (middle panel) and HPLC fractions 27 and 28 from S. felis C4 extract (bottom panel). (F) Antimicrobial activity of negative control TSB, S. felis C4 supernatant and micrococcin P1 (before or after extraction with n-butanol) against S. pseudintermedius ST71 (OD600 nm) after 18 hr. Representative of two independent butanol extractions and antimicrobial assays.
Mass spectra fragmentation patterns generated from C8 HPLC active fractions of micrococcin P1 (left panels) and S. felis C4 extract (right panels). Spectral fingerprinting indicates both samples contain molecules of a similar mass (1144 daltons) to the expected molecular weight of micrococcin P1.
Figure 4—figure supplement 1.
Spectral fingerprint of micrococcin P1 from HPLC eluted fractions.
Mass spectra fragmentation patterns generated from C8 HPLC active fractions of micrococcin P1 (left panels) and S. felis C4 extract (right panels). Spectral fingerprinting indicates both samples contain molecules of a similar mass (1144 daltons) to the expected molecular weight of micrococcin P1.
Identification of a micrococcin P1-like antimicrobial in S. felis C4 extract.
(A) Prediction of a biosynthetic gene cluster (BCG) in the S. felis C4 genome that has predicted similarity to a micrococcin P1 thiopeptide-encoding BCG. (B) Micrococcin P1 chemical structure downloaded from PubChem. (C) HPLC chromatogram of pure micrococcin P1 showing a single major peak eluted at 59 % acetonitrile into fractions 27 and 28. Inset image shows antimicrobial activity of fractions 27 and 28 against S. pseudintermedius ST71. (D) HPLC chromatogram of S. felis C4 extract showing a single major peak eluted at 59 % acetonitrile into fractions 27 and 28. Inset image shows antimicrobial activity of fractions 27 and 28 against S. pseudintermedius ST71. (E) Mass spectrometry chromatogram of similar masses and charge states generated from the synthetic peptide micrococcin P1 (top panel), HPLC fractions 27 and 28 from micrococcin P1 (middle panel) and HPLC fractions 27 and 28 from S. felis C4 extract (bottom panel). (F) Antimicrobial activity of negative control TSB, S. felis C4 supernatant and micrococcin P1 (before or after extraction with n-butanol) against S. pseudintermedius ST71 (OD600 nm) after 18 hr. Representative of two independent butanol extractions and antimicrobial assays.
Spectral fingerprint of micrococcin P1 from HPLC eluted fractions.
Mass spectra fragmentation patterns generated from C8 HPLC active fractions of micrococcin P1 (left panels) and S. felis C4 extract (right panels). Spectral fingerprinting indicates both samples contain molecules of a similar mass (1144 daltons) to the expected molecular weight of micrococcin P1.
Antimicrobial S. felis C4 inhibits bacterial translation and disrupts the membrane
Next, we sought to better understand how the antimicrobial action of S. felis C4 negatively affects bacterial physiology. Given the selective nature of the S. felis C4 supernatant against gram-positives (Figure 1E), we speculated that S. felis C4 activity may target and compromise the bacterial membrane and/or cell wall. To address this question, we utilized bacterial cytological profiling (BCP) to distinguish between the different cellular pathways targeted by antimicrobials (Nonejuie et al., 2013). B. subtilis cells exposed to 1 X MIC of the S. felis C4 extract and micrococcin P1 showed greater elongation compared to DMSO control and nucleoids that were highly condensed into toroidal structures, a characteristic of compounds that block translation, such as tetracycline (Figure 5A). Nucleoids were also highly condensed in micrococcin P1-treated cells and to a lesser extent in PSMβ2-treated cells. To examine the ultrastructural profile of staphylococci, we conducted transmission electron microscopy (TEM) imaging on sectioned S. pseudintermedius ST71 cells that were exposed to sub-MIC (0.8 μg/ml), MIC (1.5 μg/ml), or 5 X MIC (25 μg/ml) amounts of S. felis C4 extract or DMSO control (Figure 5B). TEM observations upon control DMSO treatment showed normal, uniform spherical cocci physiology and septum formation indicating active replication. In contrast, short exposure to the extract showed evidence of cell wall thickening, membrane invagination, and major perturbations in the structure and rigidity of the cell membrane (Figure 5B, lower zoom inset panels). Moreover, treatment with the extract showed evidence of greater chromosomal compaction compared to control, evidenced by the increased (electron) density of the nucleoid (highlighted yellow arrows). This observation is consistent with the cytological profile of toroidal structures in B. subtilis by BCP, indicating a similar mechanism of action in staphylococci. Additionally, exposure of S. pseudintermedius ST71 to increasing concentrations of the S. felis extract, resulted in a dose-dependent increase in reactive oxygen species (ROS) (Figure 5C) together with a concomitant decrease in the intracellular ATP levels (Figure 5D). Furthermore, evidence to support an additional membrane-active component was provided by flow cytometry analysis of bacterial cells positively stained with the membrane impermeable dye propidium iodide (PI). Greater than 20 % of S. pseudintermedius cells were PI-positive after 4 h exposure to 1 X-4X MIC of S. felis extract (Figure 5E). Lastly, S. felis C4 was shown to potentiate the effects of antibiotics against S. pseudintermedius ST71. The MIC values of gentamicin, rifampicin, and chloramphenicol were decreased in the presence of sub inhibitory 0.25 X MIC of S. felis extract compared to TSB control alone (Figure 5F). Remarkably, growth of erythromycin-resistant S. pseudintermedius ST71 in the presence of subMIC S. felis C4 extract restored sensitivity to erythromycin from MIC >100 μg/ml – MIC = 0.2 μg/ml.
Figure 5.
S. felis C4 antimicrobials target the bacterial cell membrane inhibit protein translation.
(A) Cytological profiles of B. subtilis PY79 upon treatment with 1 X MIC of S. felis C4 extract, tetracycline, PSMβ2, micrococcin P1, nisin, cycloserine, CCCP (carbonyl cyanide m-chlorophenylhydrazine) and DMSO control. Fluorescent microscopy images were taken 2 hr post-treatment, except for cycloserine, nisin and CCCP which were at 30 m post-treatment. The cell membrane was stained red with FM4-64, DNA-stained blue with DAPI, or green with SYTOX when the integrity of the membrane was compromised. Scale bar = 2 μm. (B) TEM images of S. pseudintermedius ST71 after 1 hr treatment with S. felis C4 extract or DMSO control at the indicated concentrations. Yellow arrows highlight areas of condensed DNA. Lower image panels represent higher magnification of regions highlighted by dashed black boxes. Scale = 250 nm. (C) Total ROS accumulation in S. pseudintermedius ST71 after 1 hr treatment in increasing concentrations of S. felis C4 extract. Error bars indicate SEM. (D) Total intracellular ATP accumulation in S. pseudintermedius ST71 after 1 hr treatment in increasing concentrations of S. felis C4 extract. Error bars indicate SEM. (C–D) representative of two separate experiments. (E) Flow cytometric LIVE/DEAD viability assay and quantification of SYTO9-positive S. pseudintermedius ST71 that were propidium iodide-positive (PI) or PI-negative at 4 hr post-treatment with increasing concentrations of S. felis C4 extract. Representative of two independent experiments. (F) Growth of S. pseudintermedius ST71 (OD600 nm) in TSB or TSB supplemented with a sub inhibitory 0.25 X MIC (0.4 μg/ml) of S. felis C4 extract after 18 hr incubation with increasing concentrations of rifampicin, gentamicin, erythromycin or cloramphenicol. Representative of three independent experiments.
S. felis C4 antimicrobials target the bacterial cell membrane inhibit protein translation.
(A) Cytological profiles of B. subtilis PY79 upon treatment with 1 X MIC of S. felis C4 extract, tetracycline, PSMβ2, micrococcin P1, nisin, cycloserine, CCCP (carbonyl cyanide m-chlorophenylhydrazine) and DMSO control. Fluorescent microscopy images were taken 2 hr post-treatment, except for cycloserine, nisin and CCCP which were at 30 m post-treatment. The cell membrane was stained red with FM4-64, DNA-stained blue with DAPI, or green with SYTOX when the integrity of the membrane was compromised. Scale bar = 2 μm. (B) TEM images of S. pseudintermedius ST71 after 1 hr treatment with S. felis C4 extract or DMSO control at the indicated concentrations. Yellow arrows highlight areas of condensed DNA. Lower image panels represent higher magnification of regions highlighted by dashed black boxes. Scale = 250 nm. (C) Total ROS accumulation in S. pseudintermedius ST71 after 1 hr treatment in increasing concentrations of S. felis C4 extract. Error bars indicate SEM. (D) Total intracellular ATP accumulation in S. pseudintermedius ST71 after 1 hr treatment in increasing concentrations of S. felis C4 extract. Error bars indicate SEM. (C–D) representative of two separate experiments. (E) Flow cytometric LIVE/DEAD viability assay and quantification of SYTO9-positive S. pseudintermedius ST71 that were propidium iodide-positive (PI) or PI-negative at 4 hr post-treatment with increasing concentrations of S. felis C4 extract. Representative of two independent experiments. (F) Growth of S. pseudintermedius ST71 (OD600 nm) in TSB or TSB supplemented with a sub inhibitory 0.25 X MIC (0.4 μg/ml) of S. felis C4 extract after 18 hr incubation with increasing concentrations of rifampicin, gentamicin, erythromycin or cloramphenicol. Representative of three independent experiments.
S. felis C4 inhibits S. pseudintermedius skin colonization and infection in mice
We next sought to investigate the potential of S. felis C4 and its antimicrobial products as a therapy against S. pseudintermedius colonization and infection on an animal model. Since S. felis C4 is a commensal bacterium that was isolated from healthy feline skin, we speculated it should be safe and well tolerated on mammalian skin. S. felis C4 was sensitive to several common antibiotics (Figure 6A) and as such represents a suitable strain for further investigation as a bacteriotherapy. We therefore assessed the skin tolerability of a 3 day topical application of S. felis C4 on SKH1 hairless mice. Whereas S. pseudintermedius and the non-antimicrobial S. felis ATCC 49168 showed evidence of disease as observed by scaling and redness on back skin, S. felis C4 did not promote any adverse reaction (Figure 6B).
Figure 6.
Live bacteriotherapeutic intervention with S. felis C4 protects against S. pseudintermedius colonization in mice.
(A) Minimum inhibitory concentrations (MIC) of the indicated antibiotics against S. felis C4. (B) Representative images of the dorsal skin of 8–10 week-old SKH1 mice 3 days post-challenge with live S. felis C4, S. pseudintermedius ST71 (S. pseud ST71) or S. felis ATCC (49168), inoculated at the indicated amounts. n = 2, per treatment group. (C–E) 5 × 107 CFU/cm2 of S. pseudintermedius ST71 was applied onto the back skin of C57BL/6 mice for 48 hr and challenged with TSB, S. felis C4 extract (1 mg) or live S. felis C4 (5 × 107 CFU/cm2) for 72 hr. Post-treatment, mouse back skin was photographed (C) and swabbed to enumerate S. pseudintermedius ST71 CFU on selective Baird-Parker egg yolk tellurite agar (D) or total staphylococci CFU on selective mannitol-salt agar plates (E). n = 3 for TSB and n = 4 for extract and S. felis C4. Error bars indicate SEM. One-way ANOVA with multiple comparisons (Dunnett’s correction) was performed. p values: *p < 0.05; (F–G) At day 0, 1 × 107 CFU of S. pseudintermedius ST71 was intradermally injected into the back skin of 8–10 week-old C57BL/6 mice and at 1 hr post-infection two inoculations of S. felis C4 extract (250 μg) or PBS/25 % DMSO control were injected adjacent to the infection site. (F) Representative images of S. pseudintermedius ST71-induced dermonecrosis over time after receiving control PBS/DMSO or S. felis C4 extract. (G) Quantification of lesion size (mm2) over time as measured by L x W of lesions. n = 4 for DMSO/PBS and n = 5 for extract. Error bars indicate SEM. A two-tailed, unpaired Student’s t-test was performed. p values: *p < 0.05; **p < 0.01; ***p < 0.001.
Live bacteriotherapeutic intervention with S. felis C4 protects against S. pseudintermedius colonization in mice.
(A) Minimum inhibitory concentrations (MIC) of the indicated antibiotics against S. felis C4. (B) Representative images of the dorsal skin of 8–10 week-old SKH1 mice 3 days post-challenge with live S. felis C4, S. pseudintermedius ST71 (S. pseud ST71) or S. felis ATCC (49168), inoculated at the indicated amounts. n = 2, per treatment group. (C–E) 5 × 107 CFU/cm2 of S. pseudintermedius ST71 was applied onto the back skin of C57BL/6 mice for 48 hr and challenged with TSB, S. felis C4 extract (1 mg) or live S. felis C4 (5 × 107 CFU/cm2) for 72 hr. Post-treatment, mouse back skin was photographed (C) and swabbed to enumerate S. pseudintermedius ST71 CFU on selective Baird-Parker egg yolk tellurite agar (D) or total staphylococci CFU on selective mannitol-salt agar plates (E). n = 3 for TSB and n = 4 for extract and S. felis C4. Error bars indicate SEM. One-way ANOVA with multiple comparisons (Dunnett’s correction) was performed. p values: *p < 0.05; (F–G) At day 0, 1 × 107 CFU of S. pseudintermedius ST71 was intradermally injected into the back skin of 8–10 week-old C57BL/6 mice and at 1 hr post-infection two inoculations of S. felis C4 extract (250 μg) or PBS/25 % DMSO control were injected adjacent to the infection site. (F) Representative images of S. pseudintermedius ST71-induced dermonecrosis over time after receiving control PBS/DMSO or S. felis C4 extract. (G) Quantification of lesion size (mm2) over time as measured by L x W of lesions. n = 4 for DMSO/PBS and n = 5 for extract. Error bars indicate SEM. A two-tailed, unpaired Student’s t-test was performed. p values: *p < 0.05; **p < 0.01; ***p < 0.001.To test the antimicrobial activity of S. felis C4 on skin, we first applied 5 × 107 CFU/cm2
S. pseudintermedius directly onto mouse back skin, 48 hr later we then applied an equal density of S. felis C4 or 1 mg of the S. felis C4 extract to the same site. Both treatments were repeated daily for three days. The skin showed a reduction in scaling and redness post-treatment with S. felis C4 or extract compared to control (Figure 6C). Enumeration of S. pseudintermedius ST71 CFUs after plating onto selective agar revealed a significant 2.9 log decrease in CFU after extract application and a 3.3 log decrease after live S. felis C4 application (Figure 6D). Enumeration of total staphylococci CFUs after plating onto selective agar confirmed that the extract treatment significantly reduced bacterial colonization (Figure 6E). In contrast, total staphylococci CFU counts after the S. felis C4 application were more similar to the control group, suggesting that the S. felis bacteria successfully colonized and outcompeted S. pseudintermedius ST71 on the skin (Figure 6E). To further test the S. felis C4 extract as an anti-MRSP intervention, we also evaluated its efficacy in limiting deep tissue infection by S. pseudintermedius injected into the dermis. One hour after an intradermal injection of 1 × 107 CFU S. pseudintermedius ST71, two intradermal inoculations of 250 μg of S. felis C4 extract were administered adjacent to the infection site. Infection was monitored by observations of skin necrotic lesion size over a 14-day period. Compared to controls, the extract-treated mice exhibited slower lesion progression from day 1 to day 2, and significantly better protection from S. pseudintermedius skin disease from day four onwards (Figure 6F and G). These results demonstrate the in vivo efficacy and clinical potential for S. felis C4 as a bacteriotherapy against S. pseudintermedius skin colonization and infection.
Discussion
S. pseudintermedius is one of the most common pathogens isolated from the skin of dogs and is becoming increasingly prevalent on humans. The incidence of severe and recurrent infections in animals and humans caused by methicillin-resistant S. pseudintermedius is associated with a predominant clone belonging to the multi-locus sequence type ST71 (Darlow et al., 2017; Perreten et al., 2010; Riegel et al., 2011; Robb et al., 2017; Stegmann et al., 2010; Weese et al., 2009). ST71 isolates exhibit resistance to many classes of antibiotics and represent a considerable therapeutic challenge. In the current study, high-throughput antimicrobial screening of a collection of diverse animal-derived staphylococci led to the discovery of S. felis C4. This strain secretes antimicrobials that inhibit the growth of several drug-resistant gram-positive pathogens by disrupting the cell membrane and inhibiting protein translation. Although S. felis remains poorly characterized in the literature, it is the most frequent species of staphylococci isolated from cats and is susceptible to most antimicrobials (Worthing et al., 2018b). In this study, 23 S. felis isolates were screened but only three showed reproducible antimicrobial activity in liquid and agar co-culture, suggesting an uncommon intraspecies trait. Importantly, we demonstrated that topical application of the live S. felis C4 organism outcompeted MRSP colonization in vivo, likely by the active secretion of its antimicrobials on the skin surface. Indeed, topical application of the sterile antimicrobial extract was similarly effective in reducing CFU counts on mouse skin and significantly reduced the size of necrotic infected lesions. These positive in vivo findings build upon other reports of the utilization of commensal bacteria as biotherapeutic products to treat skin diseases.There are now several reports of the discovery and characterisation of distinct antimicrobial-producing strains within common human bacterial skin species, including S. epidermidis (Cogen et al., 2010) S. hominis (Nakatsuji et al., 2017), S. lugdunensis (Zipperer et al., 2016), S. capitis (O’Neill et al., 2020) and recently Cutibacterium acnes (Claesen et al., 2020). Unfortunately, the frequency and abundance of such antimicrobial isolates are found to be significantly reduced during human AD (Nakatsuji et al., 2017). Indeed, this phenomenon of a relative absence of protective commensal strains could also influence canine AD, which shares many of the clinical features of human AD and a corresponding predisposition to S. pseudintermedius colonization.In the treatment of AD, it has been reported that topical application of a 5 % lysate from the gram-negative bacterium Vitreoscilla filiformis can be effective in human and mouse AD models (Gueniche et al., 2008). Another group reported improved outcomes in mice and on humans when gram-negative bacterium from soil called Roseomonas mucosa was applied to skin (Myles et al., 2016), although subsequent controlled clinical trials have not confirmed the effectiveness of this approach. A major caveat to these studies is the use of gram-negative bacteria with unclear mechanism of action and which do not survive well on the skin surface. Isolation of potentially protective bacteria from taxa that have evolved the capacity to survive on the skin will maximize the capacity to attack pathogen targets. For example, in a randomized, double-blind, placebo-controlled trial S. aureus colonization of AD patient skin was significantly reduced after application of a human commensal S. hominis strain (Nakatsuji et al., 2021b; Nakatsuji et al., 2021a). This anti-S. aureus activity was mediated by several secreted antibiotics unique to S. hominis A9. The current work suggests S. felis C4 also produces several antimicrobial peptides that could be useful in animal or human applications.Mass spectrometry analysis of the semi-purified S. felis C4 extract identified several peptide antimicrobials including amphipathic, α-helical PSMβ and a thiopeptide similar to micrococcin P1. Thiopeptides constitute a family of ribosomally synthesized and posttranslationally modified peptides (RiPPs) (Ciufolini and Lefranc, 2010). The BGC encoding micrococcin P1 has been previously reported to reside on a 24 kb plasmid (Bennallack et al., 2014). Likewise, the BCG for micrococcin P1 resided on a 23 kb contig in S. felis C4 with several plasmid associated genes present. Micrococcin P1 is known to be active predominantly against gram-positive bacteria, targeting the L11 binding domain of the 23 S ribosomal RNA, thereby inhibiting translation (Chan and Burrows, 2020). A similar mode of action was observed from the cytological and ultrastructural profiles of bacteria exposed to S. felis C4 extract, resulting in condensed nuclei and toroid shaped chromosomes, indicative of stalled translation. The multi-step, complex biosynthesis of micrococcin P1 and its relatively poor physicochemical properties have hampered its development into an effective anti-infective. As a result other groups have sought to develop a micrococcin P1 nanoparticle formula to circumvent its poor pharmacokinetics (Liu et al., 2020). Another group has recently reported the total laboratory synthesis of micrococcin P1 through a scalable thiazole forming sequence that produced synthetic micrococcin that was spectroscopically and functionally indistinguishable from the natural product (Christy et al., 2020). Here, we show that micrococcin P1 can also be extracted from bacterial culture supernatant using n-butanol. This extract was not found to be cytotoxic at concentrations that were antimicrobial and effectively inhibited growth of MRSP in vivo by direct topical application. The antimicrobial activity, antibiotic sensitivity and tolerability of S. felis C4 suggests it may be suitable for bacteriotherapy.Small α-helical AMPs, which include mammalian cathelicidin (active LL-37) (Nakatsuji and Gallo, 2012) as well as bacterial PSMs (Cogen et al., 2010; Zeng et al., 2019), are also attractive candidates as anti-infectives. The family of phenol-soluble modulins which include PSMα, PSMβ, PSMγ, and PSMε, are a class of small, immunomodulatory AMPs found in many staphylococci species. PSMα and PSMγ are classic cytolytic toxins but PSMβ do not exhibit cytotoxic activity against eukaryotic membranes despite a strong affinity to bind and lyse POPC vesicles, which mimic biological membranes (Duong et al., 2012). As a result, the biological function of PSMβ has remained unclear (Cheung et al., 2014). However, several recent studies have reported the antimicrobial activity of PSMβ (Kumar et al., 2017; O’Neill et al., 2020). Here, MS detected several PSMβ peptides that were highly enriched in an antimicrobial HPLC fraction from S. felis C4 supernatant. Due to their identical size, attempts to purify the individual PSMs by HPLC were unsuccessful. Instead, their activity against MRSP was validated using synthetic versions of the peptides, but they exhibited less potency than the extract. One potential explanation is that compared to the smaller PSMs α and γ (20–25 amino acids), that consist of a single α-helix, PSMβ are much larger (43–44 amino acids) and contain three α-helices. Solution structures of PSMβ from S. aureus revealed that two of the α-helices fold to form a ‘V-shape’, producing a hydrophobic core that is similar to other bacteriocins (Towle et al., 2016). As such, it remains plausible that the synthetic PSMβ peptide versions did not fold correctly and that this negatively affected their antibacterial activity. Future research efforts will attempt to develop and characterize truncated and mutated versions of S. felis PSMs with the goal of enhancing antimicrobial activity for a more simplistic but potentially more powerful therapeutic (Zeng et al., 2019). Nevertheless, both fluorescence and electron microscopy of bacteria exposed to the extract showed drastic perturbations of the bacterial cell membrane and cell wall thickening, which is consistent with the membrane-targeting actions of amphipathic AMPs. The concomitant accumulation of bacterial ROS and decrease in ATP production are also consistent with bacterial membrane disruption and increased permeability (Song et al., 2020). Overall, the ultrastructural response and killing of bacteria in response to S. felis C4 suggests both PSMs and micrococcin made by this strain are active and produce a highly potent antimicrobial commensal microbe that helps protect the host from gram-positive pathogens.In addition to their protection against pathogen colonization, skin commensals play important roles in promoting skin health and immune homeostasis. Although PSMs are common amongst staphylococci, pathogenic S. aureus exhibits a preference for PSMα production over PSMβ. In contrast, commensal staphylococci production of PSMβ is prioritized over the more toxic PSMα and PSMγ versions, a feature suspected to be an evolutionary adaptation to stably colonize skin (Otto, 2009; Wang et al., 2007). Naturally, S. felis C4 PSMβ and extract treatment of NHEKs yielded minimal evidence of cytotoxicity, whereas PSMγ induced extensive cytotoxicity. These smaller PSMs are well characterised toxins that trigger pro-inflammatory responses (Nakamura et al., 2013; Williams et al., 2019). Whereas the larger PSMβ reportedly does not elicit pro-inflammatory activity in vitro – a finding that was supported by our data, little is known regarding other potential host responses to PSMβ exposure (Cheung et al., 2014). We speculated whether PSMβ might exhibit anti-inflammatory activities, and in the present context that activity would be therapeutically beneficial. Indeed, when both NHEKs and THP-1 macrophages were treated with S. felis PSMs or extract in the presence of TLR agonists, cytokine induction was reduced but most evidently by PSMβ2. RNA-Seq analysis of NHEKs revealed global suppression of inflammatory pathways typically activated by TLR3, in the presence of PSMβ2.Taken together, here we report that S. felis C4 has low cytotoxicity and broad-spectrum antimicrobial activity and anti-inflammatory activity and is therefore an attractive biotherapeutic candidate for treatment of skin disease.
Materials and methods
Bacterial strains and growth conditions
The bacterial strains used in this study were all grown overnight, with the exception of E. faecium which was grown for 48 hr, in 3 % Tryptic Soy Broth (TSB) with shaking at 250 rpm in a 37 °C incubator or otherwise grown on agar at 37 °C under static conditions.
Sample collection
Animal-derived staphylococci samples came from two previously described collections: the first collection consisted of clinical isolates of skin and soft tissue infection from Australian dogs and cats (Worthing et al., 2018a), and the second collection was comprised of staphylococci isolated from the nose, mouth and perineum of healthy dogs and cats in Australia (Ma et al., 2020). All samples had previously been identified by matrix assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF), as previously described (Worthing et al., 2018b), and the ST71 MRSP isolate had been characterized by whole genome sequencing (Worthing et al., 2018a). Two human derived antimicrobial skin commensal isolates were used as positive controls: S. hominis A9 (Nakatsuji et al., 2017) and S. capitis E12 (O’Neill et al., 2020) and a non-antimicrobial S. aureus 113 isolate served as a negative control.
In vitro antimicrobial screen
For the initial staphylococci screen, single clone-derived cultures of animal-derived staphylococci were used as competitor isolates against the growth of methicillin-resistant S. pseudintermedius ST71. Each pure culture, including positive and negative control strains, were first streaked onto 3 % TSB agar plates and a single colony was transferred to 1 ml of TSB in a deep 96 well plate (Thermo). The CoNS plate was sealed with sterile Aeraseal film (Sigma, St. Louis, MO) and cultured at 37 °C overnight with shaking at 250 rpm. Bacterial growth was evaluated by measuring OD600 with only bacteria that grew to a density (OD600 >6.0) used for subsequent analysis. To measure antimicrobial activity in the secreted supernatant, the animal-derived staphylococci supernatant from overnight cultures were harvested and centrifuged through a 96-well 0.2 μm sterile filter plate (Corning). Next, 1 × 105 CFU of S. pseudintermedius ST71 was inoculated into 150 μl of TSB media containing 50 %, 20% or 12.5 % sterile supernatant and grown on a plate shaker for 18 h at 30 °C. To measure antimicrobial activity from the live agar co-culture assays (radial diffusion), 20 μl of overnight S. pseudintermedius ST71 culture was first inoculated into 45 °C molten TSB and immobilized after pouring and cooling into square petri dishes with grids. Overnight cultures of animal-derived staphylococci were centrifuged to pellet the bacteria, washed 2 X with PBS and resuspended in fresh TSB. The culture (10 μl) was inoculated onto a 13 mm grid of the S. pseudintermedius agar plates and cultured overnight at 30 °C. The resulting zones of inhibition from antimicrobial isolates were imaged using the camera feature on an iPhone 12.
Extraction and purification of antimicrobials from bacterial supernatant
Supernatant from overnight cultures of selected human and animal-derived staphylococci were first sterilized by filtration through a low-protein binding 0.22 μm Millipore filter. Activity was precipitated by ammonium sulfate (75 % saturation) for 1 hr, under constant rotation followed by centrifugation at 4,000 x g for 45 min and re-suspension of the pellet in dH2O. To test stability, the precipitate was boiled at 95 °C for 30 m or stored in a sterile eppendorf tube at room temperate for 1 week. Antimicrobial activity was measured by radial diffusion assay. Sterile supernatant of S. felis strains were also subject to n-butanol extraction and purification as previously described (Joo and Otto, 2014). Briefly, in each tube 10 ml of butanol was added to 30 ml of supernatant and incubated at 37 °C for 2 h under constant rotation. The tubes were then set aside for several mins until the butanol phase settled. After centrifugation at 2000 x g for 5 min, the upper butanol phase was collected and lyophilized in a SpeedVac vacuum concentrator. The lyophilized extract was resuspended and concentrated to 10 mg/ml in DMSO. Protein concentration was determined by Pierce BCA Protein Assay Kit.
Determination of minimum inhibitory concentration (MIC)
MIC values were determined using a broth micro dilution method. Bacterial cells were grown to mid-late log phase, to an OD600 nm value of roughly 1.0 for each bacterial strain and then normalized to 1 × 107 CFU/mL. The PSM peptides or butanol extracts were dissolved in DMSO to a stock concentration of 10 mg/ml. The stock concentrations of antibiotics that were water-soluble were prepared with H2O or 100 % ethanol if water-insoluble. The 1 × 107 CFU/ml bacterial cultures (10 μl) were aliquoted into 96-well microtiter plates and mixed with 95 μL of media with or without twofold dilutions of the conditioned supernatant, PSM peptides, butanol extracts or antibiotics and incubated for 16–18 hr at 30 °C with shaking at 250 rpm. Growth inhibition was determined by measuring the OD600 nm readings of each well using a microplate reader (SpectraMax iD3, Molecular Devices). The MIC of each bacterial strain was determined by the lowest peptide concentration that inhibited more than 80 % bacterial growth.
Crystal violet staining for biofilm disruption
Overnight culture of S. pseudintermedius ST71 was diluted in fresh TSB to 1 × 107 CFU/ml by OD600 reading. A total of 100 μl of bacteria was transferred to a flat-bottom 96 well plate and incubated at 37 °C without shaking for 4 hr to initiate biofilm formation. Next, the supernatants were removed by washing the plates three times with 200 μl of dH2O. Subsequently, 150 μl of the S. felis C4 supernatant, sterile extract or TSB control was added at various concentrations to the biofilm for periods between 2 and 24 hr. After incubation, the supernatant was gently removed, and the biofilm was gently washed three times with dH2O followed by air drying. Next, 150 μl of 0.1 % crystal violet (CV) solution was added to all wells containing biofilm. After 20 min of incubation with CV dye, the excess CV was removed and each well was gently washed twice with dH2O. Fixed CV dye was released from the biofilm by 70 % ethanol, and absorbance was measured at 595 nm.
Bacterial cytological profiling (BCP)
Prior to BCP, MIC of all the antimicrobial compounds to be tested were generated first. MICs for B. subtilis PY79 were conducted in 96-well plates. Cultures were taken from glycerol stocks and plated on LB plates for 24 hr at 30 °C. On the day of the experiment, single colonies were transferred into 3 mL liquid LB media and rolled until they reached early exponential phase (OD600 0.12–0.15). In 96-well plates, antibiotics were serially diluted down twofold across the plate. One μl of cells was added to 100 μL of LB+ antibiotic. Plates were incubated for 24 hr in a 30 °C plate shaker. Plates were then read in plate reader using an OD 600 nm spectrophotometer at T0 and T24. MIC was determined by the concentration of antibiotic at which the T24 OD600 value was 10 % or less than the control cell density. BCP was performed as described previously (Lamsa et al., 2012; Nonejuie et al., 2013; Peters et al., 2018). Briefly, early exponential phase B. subtilis PY79 was incubated with 0.5 x, 1 x, or 5 x MIC concentrations of antibiotics and rolled at 30 °C for 2 hr. Samples were taken at 30 m and 2 hr, and then dye mix was added to each for each strain. The dye mix contained 30 μg mL−1 FM 4–64, 20 μg mL−1 DAPI, and 2.5 μM Sytox Green in 1× Tbase. Six μL of cells were mixed with 1.5 μL of dye mix, and then 6 μL of that mixture was added to agarose pads (1 % agarose, 20 % LB). Cells were then imaged on an Applied Precision DV Elite optical sectioning microscope with a Photometrics Cool-SNAP-HQ2 camera, and images were deconvolved using SoftWoRx v5.5.1. Deconvolved images were then converted into TIFFs using Fiji, and then adjusted for clarity in Photoshop, producing the final images.
HPLC purification and peptide synthesis
First step HPLC purification was carried out with 1 mg of S. felis C4 supernatant loaded onto a Capcell Pak C8 column (5 mm, 300 A°, 4.6 mm 250 mm) (Shiseido, Tokyo, Japan) using a linear acetonitrile gradient from 10% to 60% in 0.1 % (v/v) trifluoroacetic acid (TFA) at a flow rate of 1.0 ml/min. The resulting fractions were lyophilized, then resuspended in water, and antimicrobial activity assessed by liquid culture assay. Up to five sequential purifications were carried out with each antimicrobial fraction pooled together for the second HPLC purification. A linear gradient of acetonitrile from 25% to 50% was used for the second purification. The eluted fractions were tested for antimicrobial activity by liquid culture and agar radial diffusion assays and the active and nonactive fractions were submitted for mass spectrometry analysis. For the purification of micrococcin P1 peptide and S. felis extract by HPLC, 200 μg of micrococcin P1 or 1 mg of S. felis C4 extract were loaded onto the C18 column using a linear acetonitrile gradient from 5% to 80% in 0.1 % TFA. The active fractions were pooled and submitted for mass spectrometry analysis to identify the presence of micrococcin P1 in the S. felis C4 extract. Synthetic peptides were synthesized with or without N-terminal formulation to at least 80 % purity by commercial vendors (LifeTein LLC, Somerset, NJ) and (Biomatik LLC, Delaware (PSMβ1)). Sequences of the peptides are as follows:PSMβ1: Formyl-MSGLIDAIKTTVEAGLNGEWADMGLGIAEIVAKGIEAISGFFGPSMβ2: Formyl- MSDLINAIKTTVEAGLNGEWTDMGFGIADIVAKGIDVILGFFGPSMβ2: Non-Formyl- MSDLINAIKTTVEAGLNGEWTDMGFGIADIVAKGIDVILGFFGPSMβ3: Formyl- MADLINAIKTTVEAGLNGEWTDMGFGIADIVAKGIDVISGFFGPSMγ: Formyl- MAADIISTIGDLVKWIIDTVNKFKKEF-HAND: Non-Formyl- MSKLTRVIVTSIMTVGFLTATLGLTAGNADAKLEGNGTLSQKQYQRLASQQF
Silver stain and acetone precipitation of antimicrobial fractions
Twenty μg of protein from sources including the antimicrobial HPLC fractions, butanol extracts and crude supernatant were loaded onto a Novex 16 % Tricine gel and subjected to SDS-PAGE. Silver staining and de-staining of the protein gels were performed according to the manufacturer’s instructions (Thermo Pierce Silver Stain Kit). A previously published protocol for acetone extraction of AMPs from SDS gels was used (Burgess, 2009). Briefly, a sterile razor blade was used to excise gel slices according to protein size. The gel slices were cut into small pieces and immersed in dH20 for 4 hr, with regular vortexing to elute proteins. The eluted protein was mixed with four volumes of ice-cold acetone for 1 hr at –20 °C. The samples were centrifuged at 16,000 x g for 15 min at 4 °C. The supernatant was removed and lyophilized (acetone-soluble fraction) and the resulting pellet air dried briefly and resuspended in dH20 (acetone-insoluble fraction). The antimicrobial activity of both fractions was tested by radial diffusion agar assay against S. pseudintermedius ST71.
NHEK culture
NHEKs (ThermoFisher) were cultured in EpiLife medium containing 60 μM CaCl2 (ThermoFisher) supplemented with 1 X human keratinocyte growth supplement (ThermoFisher) and 1 X Antibiotic Antimycotic (Millipore Sigma) at 37 °C, 5 % CO2. All experiments performed on NHEKs were between passages 3 and 5 with cells at 70–80% confluency. For synthetic PSM treatments, the peptides (10–1000 μg/ml) were added to the NHEKs for 4 hr or 24 hr in dimethyl sulfoxide (DMSO).
Immunoblot
NHEK cells were treated with Poly I:C (0.4 μg/ml), PSMβ2 (10 μg/ml) or Poly I:C and PSMβ2 combined for 15 min, 30 min, or 45 min and cells lysed in complete RIPA buffer supplemented with 1 X protease and phosphatase inhibitor cocktail (ThermoFisher). The lysate was centrifuged at 4 °C, at 13,000 rpm for 20 min and the total cytoplasmic supernatant fraction was kept at –80 °C, until future use. The total protein amount was quantified for each treatment using the Pierce BCA Protein Assay Kit according to manufacturer’s instructions. Fifteen µg of total protein was reduced with β-mercaptoethanol, boiled for 5 min loaded onto a 4–20% Mini-PROTEAN TGX gel (Bio-Rad). After electrophoresis, the gel was transferred onto a polyvinylidene difluoride (PVDF) membrane. The membrane was blocked for 1 hr in Intercept (PBS) Blocking Buffer (Licor) then incubated and probed overnight at 4 °C with the following primary antibodies: P-TBK1/NAK (D52C2), TBK1/NAK (D1B4), P-IRF-3 (S396), IRF-3 (D83B9), COX IV (3E11) in Intercept Blocking Buffer supplemented with 0.05 % Tween 20. The membranes were washed for 3 X for 10 min in PBS/Tween and incubated with IRDye conjugated anti-rabbit and anti-mouse secondary antibodies (IRDye800CW and IRDye680RD; Licor, USA) in Intercept Blocking Buffer/Tween for 1 hr at room temperature, followed by 4 X washing in PBS/Tween. Images of the membranes were acquired on an Odyssey DLx Imaging System (Licor, USA).
Mass spectrometry
Four fractions of interest (ranging from 10 to 20 μg/mL) were dried under vacuum and resuspended in 15 μL of 5 % acetonitrile with 5 % formic acid. Next, individual LC-MS experiments were conducted on 6 μL of each sample through 85 min of data acquisition on an Orbitrap Fusion (Thermo Fisher Scientific) mass spectrometer with an in-line Easy-nLC 1000 (Thermo Fisher Scientific). A home-pulled and packed 30 cm column was triple-packed with 0.5 cm, 0.5 cm and 30 cm of 5 μm C4, 3 μm C18, and 1.8 μm C18 respectively and heated to 60 °C for use as the analytical column. Peptides were first loaded at 500 bar which was followed by a chromatography gradient ranging from 6% to 25% acetonitrile over 70 min followed by a 5 min gradient to 100 % acetonitrile, which was held for 10 min. Electrospray ionization was performed by applying 2000 V through a stainless-steel T-junction connecting the analytical column and Easy-nLC system. Each sample was followed by four washes starting with a gradient from 3% to 100% acetonitrile over 15 min with an additional 10 min at 100 % acetonitrile. An m/z range of 375–1500 was scanned for peptides with charge states between 2 and 6. Centroided data was used for quantitation of peaks. Acquisition was run in a data-dependent positive ion mode. Raw spectra were searched in Proteome Discoverer Version 2.1 and PEAKS Studio X (Ma et al., 2003) against 6-frame translated databases based of a uniprot reference database for Staphylococcus felis ATCC 49168 (Uniprot proteome UP000243559, accessed 06/26/2019) as well as in-house sequencing of S. felis C4 and de-novo algorithm of PEAKS Studio X. Data were searched using the Sequest algorithm (Eng et al., 1994) using a reverse database approach to control peptide and protein false discoveries to 1 % (Elias and Gygi, 2007). No enzyme was specified in the search and a minimum peptide length was set to six amino acids. Search parameters included a precursor mass tolerance of 50 ppm and fragment mass tolerance of 0.6 Da and variable oxidation for modifications.
Whole genome sequencing and analysis of the S. felis C4 strain
DNA was extracted from S. felis C4 using the UltraClean Microbial DNA Isolation Kit (MoBio) according to the manufacturer’s instructions. The library was prepared using Nextera DNA Flex library preparation kit according to the manufacturer’s instructions (Illumina, San Diego, CA). The library was diluted to 1.0 nM, then sequenced for 300 cycles using the Illumina NovaSeq system to generate 150 bp paired-end reads with 794 x coverage that was reduced to 100 x coverage for read mapping. Fastq files from S. felis C4 were trimmed using Trimmomatic (Bolger et al., 2014), then assembled using SPAdes Genome Assembler v.3.14.1. The S. felis C4 genome was annotated using the RAST tool kit via the Pathosystems Resource Integration Center (PATRIC) database (Wattam et al., 2014). Genes encoding PSMβ were identified by BLASTn and secondary metabolite biosynthesis gene clusters by anti-SMASH bacterial version (Weber et al., 2015).
ATP determination
The intracellular ATP levels of S. pseudintermedius ST71 treated with S. felis C4 butanol extract were measured following the manufacturer’s instructions (ReadiUse Rapid Luminometric ATP Assay Kit). Briefly, an overnight S. pseudintermedius ST71 culture was sub-cultured to an OD of 0.5 at 37 °C. The bacteria were pelleted, washed with fresh TSB and incubated with various concentrations (0–320 μg/ml) of S. felis C4 butanol extract for 1 hr. The bacterial cultures were centrifuged at 10,000 x g for 5 min at 4 °C. The bacterial pellet was lysed by lysozyme and centrifuged. The bacterial supernatant was mixed with an equal volume of detecting solution in a 96-well plate and incubated at room temperature for 20 min. ATP luminescence was read using a SpectraMax iD3 (Molecular Devices).
Reactive oxygen species (ROS) measurement
The levels of reactive oxygen species (ROS) in S. pseudintermedius ST71 that was treated with S. felis C4 butanol extract were measured with 2′,7′-dichlorofluorescein diacetate (DCFDA) following the manufacturer’s instructions (DCFDA/H2DCFDA Abcam cellular ROS assay kit). Briefly, an overnight culture of S. pseudintermedius ST71 was sub-cultured to an OD of 0.5 at 37 °C. The bacteria were pelleted and re-suspended in fresh TSB. DCFDA was added to a final concentration of 20 μM to the bacterial culture incubated with various concentrations of extract (0–320 μg/ml) at 37 °C for 1 hr. Fluorescence intensity was immediately measured at an excitation wavelength of 488 nm and an emission wavelength of 525 nm using a SpectraMax iD3 (Molecular Devices).
Bacterial viability assay
Dead or damaged bacteria induced by S. felis C4 extract were evaluated using the LIVE/DEAD BacLight Bacterial Viability Kit, according to manufacturer’s instructions (Invitrogen, catalogue no. L7012). An overnight S. pseudintermedius ST71 culture was washed with fresh TSB and OD adjusted to 0.5 under treatment with increasing concentrations of extract (0, 0.8, 1.0, 1.6, 3.1, 12.5 μg/ml). After incubation for 4 hr, the bacteria were harvested, washed and resuspended in 1 X PBS. Equal volumes of SYTO9 and propidium iodide (PI) were mixed and 3 μl was added to each sample to a final volume of 1 ml and incubated at room temperature in the dark for 15 min. Flow cytometry measurements were taken on a BioRad ZE5 Cell Analyzer with forward and side scatter parameters for detecting bacteria that were non-stained. Total bacteria were gated by dual stained but SYTO9-positive only population. The percentage dead or membrane-compromised bacteria were detected and recorded by the population that were SYTO9- and PI-positive. Analysis was performed using FlowJo V10 software (BD Biosciences).
Transmission electron microscopy
S. pseudintermedius ST71 cell pellets were immersed in modified Karnovsky’s fixative (2 % glutaraldehyde and 2 % paraformaldehyde in 0.10 M sodium cacodylate buffer, pH 7.4) for at least 4 hr and further postfixed in 1 % osmium tetroxide in 0.1 M cacodylate buffer for 1 hr on ice. The cells were stained all at once with 2 % uranyl acetate for 1 hr on ice, then dehydrated in a graded series of ethanol (50–100%) while remaining on ice. The cells were washed with 100 % ethanol and washed twice with acetone (10 min each) and embedded with Durcupan. Sections were cut at 60 nm on a Leica UCT ultramicrotome and picked up on 300 mesh copper grids. Sections were post-stained with 2 % uranyl acetate for 5 min and Sato’s lead stain for 1 min. Grids were viewed using a JEOL JEM-1400Plus (JEOL, Peabody, MA) transmission electron microscope and photographed using a Gatan OneView 4 K digital camera (Gatan, Pleasanton, CA).
Mouse skin colonization and infection with S. pseudintermedius
mouse skin colonization
All experiments involving live animal work were performed in accordance with the approval of the University of California, San Diego Institutional Animal Care and Use Guidelines (protocol no. S09074). For mouse skin challenge experiments involving S. felis strains and S. pseudintermedius ST71, the dorsal skin of hairless age-matched 8–10 week-old SKH1 mice (n = 2, per treatment) were scrubbed with alcohol wipes and 5 × 106/cm2 or 5 × 107/cm2 CFU of overnight cultured S. felis C4, S. felis ATCC 49168 or S. pseudintermedius ST71 was inoculated onto 1 × 1 cm sterile gauze pads, which were placed onto the dorsal skin and secured with wound dressing film (Tegaderm [3 M]) for 72 h. For the experiments involving the live S. felis C4 bacteria and the extract topical treatment, the dorsal skin of age-matched 8–10 week-old C57BL/6 mice (n = 4, per treatment) were shaved and depilated by using Nair cream followed by removal with alcohol wipes. The skin was allowed to recover from hair removal for at least 24 h before the application of bacteria. Prior to bacterial challenge, the dorsal skin was tape-stripped and S pseudintermedius ST71 agar disks (3 % TSB, 2 % agar; diameter 8 mm) containing 5 × 107 CFU was applied to the skin for 48 h, as previously described (Nakatsuji et al., 2016). The dorsal skin and agar disk were covered with Tegaderm and a bandage was applied to hold the agar disk (or gauze later) in place for the duration of the treatment. The bandage, Tegaderm and agar disk were removed and 5 × 107/cm2 CFU of overnight cultured S. felis C4 (washed 2X in TSB), or 100 μl of extract (10 mg/ml) or 3 % TSB control, was inoculated onto 2 × 2 cm sterile gauze pads and applied to the infected site every 24 hr for 72 hr. After the treatment of mouse skin with live bacteria or extract, the dressing film and gauze pad were removed, and surface bacteria were collected using a swab soaked in TSB-glycerol solution. The swab head was then placed in 1 mL of TSB-glycerol solution, vortexed (30 s), serial-diluted, and plated onto Baird Parker agar plates supplemented with egg yolk tellurite for enumeration of coagulase-positive staphylococci (Carter, 1960) or mannitol salt agar plates for enumeration of all surface staphylococci (Parisi and Hamory, 1986).
Mouse infection model
The day prior to bacterial infection, the dorsal skin of age-matched 8–10 week old C57BL/6 mice (n = 5, per treatment) was shaved and depilated by using Nair cream followed by removal with alcohol wipes. A 50 μl inoculum suspension containing 1 × 107 CFU of late log phase S. pseudintermedius ST71 in PBS was intradermally injected into the dorsal skin using 0.3 mL/31-gauge insulin syringe (BD, Franklin Lakes, NJ). At 1 hr post-infection, a 50 μl suspension of the S. felis C4 extract (250 μg, at a concentration of 5 mg/ml in 25 % DMSO) or a control suspension of 1 X PBS in 25 % DMSO was injected twice in two separate skin sites directly adjacent to the bacterial injection site. Body weights of the mice were measured before and after infection every day for 14 days. To determine lesion size, a ruler was positioned adjacent to the mouse skin lesions and digital photos were taken daily with a Kodak PIXPRO Astro Zoom AZ421 and analyzed via ImageJ software (National Institutes of Health Research Services Branch, Bethesda, MD, USA). Lesion size in mm2 was measured by calculating the length x width.
Quantitative real-time PCR
mRNA transcript abundance was measured by qPCR in NHEKs stimulated with or without TLR2/6 agonist MALP-2 (200 ng/ml) or TLR3 agonist Poly I:C (0.4 μg/ml) in the presence or absence of S. felis C4 extract, PSMβ2 or PSMβ3 (10 μg/ml) or DMSO control (0.1%) at 4 hr post-treatment. RNA was extracted from NHEK cells using Pure Link RNA isolation kit (Thermo Fisher) according to manufacturer’s instructions. RNA was quantified on a Nanodrop 2000/200c spectrophotometer (Thermo Fisher, USA). Purified RNA (1 μg) was used to synthesize cDNA using the iScript cDNA Synthesis Kit (Bio-Rad, USA). Pre-Developed SYBR-Green gene expression assays (Integrated DNA Technologies, USA) were used to evaluate mRNA transcript levels.
RNA sequencing
NHEK cells were treated with DMSO (0.1%) control, PSMβ2 (10 μg/ml), Poly I:C (0.4 μg/ml) or PSMβ2 and Poly I:C combined, all in triplicate wells, for 4 hr or 24 hr in and RNA was extracted using the PureLink RNA mini kit and triplicate samples were pooled together for each treatment. Isolated RNA was submitted to the UCSD IGM Genomics Center for RNA-sequencing performed on a high-output run V4 platform (Illumina, USA) with a single read 100 cycle runs. Data alignment was performed using Partek Flow genomic analysis software (Partek, USA) with Tophat2 (version 2.0.8) Gene ontology (GO) enrichment analysis was performed on differentially regulated genes ( ≥ 1.5-fold) using DAVID 6.8 or Metascape (Zhou et al., 2019).
Statistical analysis
Significant differences between the means of the different treatments were evaluated using GraphPad Prism version 7.03 (GraphPad Software, Inc, La Jolla, CA). Either unpaired, two-tailed Student’s t test or one-way analysis of variance (ANOVA) followed by Dunnett’s or Tukey’s multiple comparisons test were used for statistical analysis and indicated in the respective figure legends. Differences were considered statistically significant with a p value of < 0.05.In the interests of transparency, eLife publishes the most substantive revision requests and the accompanying author responses.Acceptance summary:You provide here characterization of how a skin commensal from cats produces phenol soluble modulin β (PSM-B) antimicrobial peptides with activities against gram positive organisms and particularly Staphylococcus in vitro and in an in vivo murine model of skin infection. The antimicrobial agents appear to target the cell envelope of the pathogen while also showing anti-inflammatory effect on keratocytes. Thus, your work constitutes a proof of principle of a new potential topical therapeutic option against skin Staphylococcus infections.Decision letter after peer review:Thank you for submitting your article "Antimicrobials from a feline commensal bacterium inhibit skin infection by drug-resistant S. pseudintermedius" for consideration by eLife. Your article has been reviewed by 3 peer reviewers, and the evaluation has been overseen by a Reviewing Editor and Y M Dennis Lo as the Senior Editor. The following individual involved in review of your submission has agreed to reveal their identity: Andrew M Edwards (Reviewer #1).The reviewers have discussed their reviews with one another, and the Reviewing Editor has drafted this to help you prepare a revised submission.Essential revisions:A few points need addressing before the study can be considered for publication:– It is not clear how much PSM-B is in the extract used in the mouse studies. The MIC of the extract was 8 ug/ml but purified PSM-B did not significantly inhibit bacterial growth until 25-50 ug/ml. This disparity suggests that something else in the extract might be responsible for the antibacterial activity of the extract. There is a possibility that the active molecule(s) have not been fully identified.(1) The MIC for each peptide is provided (50 ug/ml), but since these are produced as a mixture by S. felis please test whether they show synergistic activity. This would explain why the MIC of the native supernatant extract was much lower.(2) Use PSM-B alone in in vivo experiments to convincingly test if it is the active fraction of the C4 extract or delete the corresponding gene and show loss of competitive activity or overexpress it from a non-competitive strain and show gain of function.– The characterization of the activity of the extract as an anti-membrane molecule needs strengthening. Please provide new data for Figure 3 B-D with a time course (t0 to t1hour) and more controls including cell wall, translation, and membrane targeting antibiotics such as daptomycin and CCCP as a chemical inducing membrane permeability and collapse of ATP levels. Show percentages of dead stain + cells as measured by Flow Cytometry.– In order to strengthen the conclusion that PSM-B have no activity on NHEKs, provide cytotoxicity measures for higher concentrations than 100ug/ml which is the first concentration at which bacterial growth is totally blocked.Reviewer #1 (Recommendations for the authors):The authors set out to identify bacteria that could outcompete Staphylococcus pseudointermedius, a leading cause of skin infection and exacerbation of atopic dermatitis in companion animals and increasingly in humans. Antibiotic resistance, the off-target effects of antibiotic use and poor efficacy of topical approaches necessitates the development of better therapeutics for combatting this pathogen.The authors used appropriate methods to identify and characterise competitive bacteria, followed by determination of the underlying mechanism of competition. The authors then show that a strain of S. felis could succesfully be used to treat skin infection caused by S. pseudointermedius. The aims were achieved and the conclusions are justified by the results.Strengths: The approaches used, with key findings typically supported by more than one method. For example, the use of synthetic peptides to confirm data from spent culture supernatant. The findings are very compelling, with good efficacy shown in relevant animal models.Weakness: activity is shown against a single S. pseudointermedius strain, albeit one that is representative of the predominant lineage.The use of bacteria as therapeutics is developing rapidly as a field and this work makes a very useful contribution. If this can be shown to be useful in animals it will provide a strong platform for larger development for human use. The approach described is fairly standard, but useful to know that it worked.Reviewer #2 (Recommendations for the authors):The manuscript by O'Neill et al., describes how a skin commensal isolated from cats, S. felis produces an antimicrobial that is active against S. aureus. Importantly, use of S. felis or an extract containing the antimicrobial was capable of improving the outcome of a mouse skin and soft tissue infection. The researchers identified PSM-B as the molecule predominantly responsible for the anti-Staphylococcal activity and interestingly describe an additional anti-inflammatory activity associated with the molecule. Novel antimicrobials against S. aureus are desperately needed and the identification of bacterial species that can outcompete or inhibit S. aureus as well as the identification of specific molecules with low toxicity and anti-Staphylococcal activity is of major importance. The paper is well written, clear and concise. The experiments appear to have been carefully carried out.I have some concerns as follows:1. It is not clear how much PSM-B is in the extract used in the mouse studies. The data presented do not convincingly show that the in vivo activity is truly orchestrated by PSM-Bs. The MIC of the extract was 8 ug/ml but purified PSM-B did not completely inhibit bacterial growth until 100 ug/ml. This disparity suggests that something else in the extract was responsible for the antibacterial activity or is an essential component. With this in mind, there is a possibility of a critical gap in this manuscript, where the most impressive activity is shown in figure 2, using extracts and bacterial producers and then a leap is made to PSM-Bs as the driver of this activity. I do not think the data supports this, meaning the active molecule(s) have not been identified, which significantly reduces the impact of this work.2. The membrane activity is not fully supported. The assays measuring ROS and loss of ATP could be easily associated with a plethora of antibiotics.3. Although the authors describe the antimicrobial activity of PSM-B and the lack of toxicity, I worry the authors are over-interpreting their data here. In figure 4 A and B, you only see full inhibition of bacterial growth at the same concentration where cytotoxicity becomes apparent. The authors did not examine any higher concentration. As these assays are very different, with one measuring ability of bacteria to proliferate and the other measuring release of lactate dehydrogenase from eukaryotic cells, it's possible that PSM-Bs have similar activity against both bacterial and eukaryotic membranes, which would severely limit their utility.Reviewer #3 (Recommendations for the authors):The authors assessed the effect of 85 staphylococcal carriage isolates from dogs and cats on a currently successful, multidrug-resistant canine skin and soft-tissue pathogen, MRSP ST71 through a large number of in vitro and in vivo (mouse skin) assays. One particular Staphylococcus felis isolate (C4) was identified in co-culture/agar inhibition experiments. Subsequently, the ability of this isolate (or its extract containing antimicrobial peptides) to inhibit MRSP was tested on mice skin. Electronmicroscopy was used to demonstrate a cell membrane-disrupting effect. Antimicrobial peptides were purified from the extract and tested again for their inhibitory effect. Lastly, immune-responses were tested in various assays, including human keratinocytes.The current presentation of the manuscript makes it highly challenging to read at the moment but study contains a substantial amount of findings that might eventually lead to further development of new alternatives for antimicrobial treatment of skin infections.Essential revisions:A few points need addressing before the study can be considered for publication:– It is not clear how much PSM-B is in the extract used in the mouse studies. The MIC of the extract was 8 ug/ml but purified PSM-B did not significantly inhibit bacterial growth until 25-50 ug/ml. This disparity suggests that something else in the extract might be responsible for the antibacterial activity of the extract. There is a possibility that the active molecule(s) have not been fully identified.We thank the reviewers for highlighting this discrepancy and we have conducted a series of additional experiments to explain why the extract has higher potency. A genetic analysis of S. felis C4 identified a biosynthetic gene cluster with similarity to an antimicrobial thiopeptide encoding micrococcin P1. The presence of micrococcin P1 in the S. felis extract was confirmed by HPLC and mass spectrometry (Figure 4 and Figure 4—figure supplement 1). We believe the presence of micrococcin P1 explains the discrepancy in killing as a synthetic micrococcin π exhibited a similar MIC range compared to the S. felis extract and was shown to precipitate into butanol. We have also performed additional MOA studies on the S. felis C4 extract and demonstrated a bacterial cytological profile with striking similarities to cells treated with micrococcin P1 (Figure 5). As a result of this extensive new data, we now provide a substantially revised manuscript that describes this additional, potent antimicrobial produced by S. felis C4.(1) The MIC for each peptide is provided (50 ug/ml), but since these are produced as a mixture by S. felis please test whether they show synergistic activity. This would explain why the MIC of the native supernatant extract was much lower.We thank the reviewers for this excellent suggestion. We conducted the experiment and found no evidence of a synergistic activity of the PSMs in combinations versus the same concentration of PSMs alone. We provide this new data as an additional supplementary figure (Figure 3—figure supplement 3) in the manuscript. In addition, during our initial investigations into why the PSMs were not providing MICs similar to the extract, we speculated that the N-terminal formylation of the starting methionine may negatively impact activity in vitro. Studies of PSMs produced by S. aureus have revealed the presence of native peptides with or without the N-formylation. For that reason we also generated a non-formylated synthetic PSMB2 and tested its bioactivity. Overall, there was no significant difference in the presence or absence of N-formylation in the inhibition of MRSP growth or in terms of synergistic activity (Figure 3—figure supplement 3). We have now added that data point back into the original Figure 4A, which is now presented as Figure 3H in our current revised version.2) Use PSM-B alone in in vivo experiments to convincingly test if it is the active fraction of the C4 extract or delete the corresponding gene and show loss of competitive activity or overexpress it from a non-competitive strain and show gain of function.We thank the reviewers for this excellent suggestion. We made extensive efforts to genetically manipulate S. felis C4 but found it to be unamenable to transformation with the current tools used for staphylococci mutagenesis. We used empty vectors pJB38 and pKOR1 that had worked well in our lab previously, generating successful transformants in strains belonging to S. epidermidis and S. hominus. Some of the conditions we optimized include:1. Preparation of highly pure and concentrated plasmid preps in DC10b E. coli2. Fresh versus frozen competent S. felis C4 cells3. Electroporation with different concentrations of S. felis C4 at early or mid exponential growth4. Electroporation of S. felis C4 with different amounts of plasmid DNA (.1 – 10 ug)5. 1900kV, 2100kV and 2300kV electroporation with different amounts of plasmid DNA in 1mm or 2mm cuvettes6. 45-55 deg heat shock followed by electroporation to inactivate host restriction modification system in S. felis C4 as performed by Lofblom et al., 2006. J. Applied Microbiology.7. Post electroporation recovery in 500mM sucrose for different time periods (1h-3h). Lastly, we show a representative image of our transformation experiments. Whilst we were able to successfully generate plasmid transformants with the positive control S. epidermidis 1457 strain (left image of ). We were never able to successfully recover transformants for the S. felis C4 strain.Due to the failure to mutate the PSM-encoding genes in S. felis C4, we investigated if we could recapitulate our in vivo data that showed the S. felis C4 extract improved MRSP infection using purified PSM peptides. We followed the same process as before and injected 500 μg of PSM adjacent to the infected skin lesion and measured lesion size over time. Unfortunately, the PSMs did not result in a significant reduction in lesion size. This is not surprising given the higher MIC values for PSM versus the S. felis extract. However, in light of our new data identifying the presence of micrococcin P1 in the extract, we speculate a beneficial effect or applying micrococcin to infected skin wounds. It has been reported in the literature that micrococcin P1 can reduce MRSA bacterial burden in infected mouse skin (Liu et al., 2020. Microbiome).– The characterization of the activity of the extract as an anti-membrane molecule needs strengthening. Please provide new data for Figure 3 B-D with a time course (t0 to t1hour) and more controls including cell wall, translation, and membrane targeting antibiotics such as daptomycin and CCCP as a chemical inducing membrane permeability and collapse of ATP levels. Show percentages of dead stain + cells as measured by Flow Cytometry.We have now provided detailed mechanism of action studies for the S. felis C4 by employing a powerful approach called bacterial cytological profiling (BCP). This approach generates a cytological profile of bacteria treated with different classes of antibiotics that target distinct cellular pathways. Our new data (Figure 5A) shows that cells treated with S. felis C4 extract or tetracycline reveal the presence of condensed nucleoids with toroidal structures, indicating a target of protein translation. Moreover, our panel EM images (now Figure 5B) had previously highlighted evidence of condensed chromosomes, in addition to the substantial alteration in the cell membrane, validating the findings from BCP. As suggested by the reviewers we performed time course experiments to measure the levels of ATP with additional antibiotic controls. However, in light of our more powerful BCP approach, which already includes antibiotic controls with different MoA, we opted to leave the ATP and ROS dose-response experiment in the main figure. Nevertheless, we now include results from the LIVE/DEAD assay providing the percentages of PI-positive cells from flow cytometry and removed the previous representative microscopy images.– In order to strengthen the conclusion that PSM-B have no activity on NHEKs, provide cytotoxicity measures for higher concentrations than 100ug/ml which is the first concentration at which bacterial growth is totally blocked.This data is now provided in Figure 2H.
Authors: Kaitlyn M Towle; Christopher T Lohans; Mark Miskolzie; Jeella Z Acedo; Marco J van Belkum; John C Vederas Journal: Biochemistry Date: 2016-08-15 Impact factor: 3.162
Authors: Ian A Myles; Kelli W Williams; Jensen D Reckhow; Momodou L Jammeh; Nathan B Pincus; Inka Sastalla; Danial Saleem; Kelly D Stone; Sandip K Datta Journal: JCI Insight Date: 2016-07-07
Authors: A Gueniche; B Knaudt; E Schuck; T Volz; P Bastien; R Martin; M Röcken; L Breton; T Biedermann Journal: Br J Dermatol Date: 2008-09-15 Impact factor: 9.302
Authors: Kate Worthing; Stanley Pang; Darren J Trott; Sam Abraham; Geoffrey W Coombs; David Jordan; Liam McIntyre; Mark R Davies; Jacqueline Norris Journal: Vet Microbiol Date: 2018-07-06 Impact factor: 3.293
Authors: Alan M O'Neill; Kate A Worthing; Nikhil Kulkarni; Fengwu Li; Teruaki Nakatsuji; Dominic McGrosso; Robert H Mills; Gayathri Kalla; Joyce Y Cheng; Jacqueline M Norris; Kit Pogliano; Joe Pogliano; David J Gonzalez; Richard L Gallo Journal: Elife Date: 2021-10-19 Impact factor: 8.140