Literature DB >> 32134941

Biochemical, genetic and transcriptional characterization of multibacteriocin production by the anti-pneumococcal dairy strain Streptococcus infantarius LP90.

Cristina Campanero1, Estefanía Muñoz-Atienza1, Dzung B Diep2, Javier Feito1, Sara Arbulu1, Rosa Del Campo3, Ingolf F Nes2, Pablo E Hernández1, Carmen Herranz1, Luis M Cintas1.   

Abstract

Streptococcus pneumoniae infections are one of the major causes of morbility and mortality worldwide. Although vaccination and antibiotherapy constitute fundamental and complementary strategies against pneumococcal infections, they present some limitations including the increase in non-vaccine serotypes and the emergence of multidrug-resistances, respectively. Ribosomally-synthesized antimicrobial peptides (i.e. bacteriocins) produced by Lactic Acid Bacteria (LAB) may represent an alternative or complementary strategy to antibiotics for the control of pneumococal infections. We tested the antimicrobial activity of 37 bacteriocinogenic LAB, isolated from food and other sources, against clinical S. pneumoniae strains. Streptococcus infantarius subsp. infantarius LP90, isolated from Venezuelan water-buffalo milk, was selected because of its broad and strong anti-pneumococcal spectrum. The in vitro safety assessment of S. infantarius LP90 revealed that it may be considered avirulent. The analysis of a 19,539-bp cluster showed the presence of 29 putative open reading frames (ORFs), including the genes encoding 8 new class II-bacteriocins, as well as the proteins involved in their secretion, immunity and regulation. Transcriptional analyses evidenced that the induction factor (IF) structural gene, the bacteriocin/IF transporter genes, the bacteriocin structural genes and most of the bacteriocin immunity genes were transcribed. MALDI-TOF analyses of peptides purified using different multichromatographic procedures revealed that the dairy strain S. infantarius LP90 produces at least 6 bacteriocins, including infantaricin A1, a novel anti-pneumococcal two-peptide bacteriocin.

Entities:  

Year:  2020        PMID: 32134941      PMCID: PMC7058333          DOI: 10.1371/journal.pone.0229417

Source DB:  PubMed          Journal:  PLoS One        ISSN: 1932-6203            Impact factor:   3.240


Introduction

Streptococcus pneumoniae, regarded as one of the most important human pathogens, is the etiological agent of diseases such as acute otitis media, sinusitis and pneumonia, as well as of potentially life-threatening invasive infections, such as bacteremia and meningitis, which constitute major causes of morbility and mortality worldwide [1]. The development of vaccines could alleviate the problems related to the spreading of the most virulent strains. Nevertheless, several studies have revealed some drawbacks including the parallel increase of non-vaccine serotypes [2]. Although antibiotherapy constitutes a complementary strategy to vaccination, treatments with antibiotics may lead to dysbiosis and the spreading of antibiotic-resistant bacteria. The concerns about the worldwide emergence of antibiotic resistant S. pneumoniae strains, mainly against β-lactams and macrolides, and the raise of clinical isolates showing multidrug-resistance have increased [3]. Researchers are urged to discover and develop alternative or complementary strategies to antibiotherapy based on novel modes of action, such as bacteriocins produced by Lactic Acid Bacteria (LAB) [4]. Bacteriocins are ribosomally-synthesized antimicrobial peptides or proteins active against a wide variety of Gram-positive and, to a lesser extent, Gram-negative bacteria [5]. This work describes for the first time bacteriocin production by Streptococcus infantarius. The biochemical, genetic and transcriptional characterization of multibacteriocin production by the dairy strain S. infantarius LP90 revealed that it produces at least 6 bacteriocins, including infantaricin A1, a novel anti-pneumococcal two-peptide bacteriocin which could be used as an alternative or complementary strategy to antibiotics for the treatment of human infections caused by S. pneumoniae, for which vaccination and antibiotic programs may be non-fully effective.

Materials and methods

Bacterial strains, growth media and culture conditions

The 37 bacteriocinogenic LAB and the 23 clinical S. pneumoniae strains used as indicators are listed in S1 Table. LAB were grown in de Man, Rogosa and Sharpe (MRS) broth (Oxoid Ltd., Basingstoke, United Kingdom) at 30°C for 16 h. S. pneumoniae colonies were obtained on Columbia agar with horse blood (5%, w/v) (BioMérieux, Marcy l’Etoile, France) at 37°C overnight. Subsequently, colonies were transferred to Brain Heart Infusion (BHI) broth (Oxoid), and cultures were incubated at 37°C for approximately 6 h (OD600 of 0.5).

Detection of antimicrobial activity

Direct antimicrobial activity assay

The direct antimicrobial activity of the 37 bacteriocinogenic LAB was screened by a stab-on-agar test (SOAT) [6] against 9 S. pneumoniae strains (S2 Table). Briefly, the bacteriocinogenic strains were stabbed onto MRS agar (1.5% w/v) and incubated at 30°C for 5 h, and then 40 ml of BHI soft (0.8%, w/v) agar (Oxoid) containing about 1×105 cfu/ml of the indicator strain was poured over the plates. After incubation, at 37°C for 12 h, the plates were checked for inhibition zones around the colonies. Antimicrobial activity was quantified by measuring the diameter of the inhibition halo (mm), considering as positive results only diameters higher than 3 mm.

Extracellular antimicrobial activity assay

The extracellular antimicrobial activity activity of the 37 bacteriocinogenic LAB was determined by an agar well-diffusion test (ADT) [6] against 23. S. pneumoniae strains (S2 Table). Firstly, the cell-free culture supernatants (CFS) from the 37 bacteriocinogenic LAB grown in MRS broth at 30°C until the stationary phase (OD600 of ca. 1.0) were obtained by centrifugation at 12,000 × g at 4°C for 10 min. After adjusting their pH to 6.2 with 1M NaOH, they were filter-sterilized through 0.22 μm-pore-size filters (Millipore Corporation, Bedford, Massachusetts, USA), and stored at –20°C until use. Then, BHI soft agar (80 ml) were inoculated with approximately 1×105 cfu/ml of the S. pneumoniae indicator strains and poured into a Petri dish. After cooling, wells (6-mm diameter) were made in the agar, and 50 μl of CFS were added. After incubation of the plates at 37°C for 12 h, the antimicrobial activity was quantified by measuring the diameter (mm) of the inhibition zones around the wells, and the bacteriocinogenic strains showing the highest antimicrobial activity were selected for further evaluation. These strains were grown in MRS broth at 30 and 37°C for 16 h and their CFSs obtained at 6, 10, 12, and 16 h were tested for antimicrobial activity by an ADT against 7 S. pneumoniae strains. CFSs showing the highest antimicrobial activity were challenged against the same strains by a microtiter plate assay (MPA) [7]. Each well of the microtiter plate contained 50 μl of two-fold serial dilutions (in BHI broth) of CFS and 150 μl of a diluted (in BHI broth) fresh overnight culture of the indicator (approx., 4×105 cfu/ml). After aerobic incubation of the plates at 37°C for 12 h, growth inhibition was measured spectrophotometrically at 620 nm with a microtiter plate reader (Labsystems iEMS Reader MF, Labsystems, Helsinki, Finland). CFSs were heated at 100°C for 10 min and treated with proteinase K (AppliChem GmbH, Darmstadt, Germany) (10 mg/ml) at 37°C for 1 h.

Taxonomic identification of Streptococcus sp. LP90

Streptococcus sp. LP90 was taxonomically identified by DNA sequencing of a PCR-amplified internal fragment of the manganese-dependent superoxide dismutase gene (sodA) using the primers d1 (5’-CCITAYICITAYGAYGCIYTIGARCC-3’) and d2 (5’-ARRTARTAIGCRTGYTCCCAIACRTC-3’) obtained from Sigma-Genosys Ltd. (Cambridge, United Kingdom) [8]. PCR mixtures were subjected to thermal cycling under the following conditions: initial denaturation (97°C for 3 min) followed by 35 cycles of denaturation (94°C for 30 sec), annealing (50°C for 2 min), and elongation (72°C for 1 min 30 sec), and a final 12-min extension at 72°C, in an Eppendorf Mastercycler DNA thermal cycler (Eppendorf, Hamburg, Germany). The amplified PCR products were resolved by electrophoresis through agarose (2%, w/v) (Pronadisa, Madrid, Spain) gels stained with GelRed Nucleic Acid Gel Stain (Biotium, USA), and analyzed with the Gel Doc 1000 documentation system (Bio-Rad, Madrid, Spain). The molecular size marker used was HyperLadder II (Bioline London, United Kingdom). The PCR products were purified using the NucleoSpin Extract II (Macherey-Nagel, Düren, Germany) and sequenced at the Genomics Service of Parque Científico-UCM (Madrid, Spain). The nucleotide BLAST software (NCBI [http://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastn&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome]) was used for nucleotide similarity search.

Safety assessment of S. infantarius LP90

Antimicrobial susceptibility testing

The minimum inhibitory concentration (MIC) of 16 antibiotics against S. infantarius LP90 was determined using Lact-1 and Lact-2 VetMIC microplates (National Veterinary Institute, Uppsala, Sweden) [9]. The antibiotics evaluated were ampicillin, penicillin, vancomycin, erythromycin, virginiamycin, tetracycline, clindamycin, chloramphenicol, kanamycin, gentamycin, streptomycin, neomycin, linezolid, rifampicin, ciprofloxacin, and trimethoprim. Individual colonies of S. infantarius LP90 were suspended in a sterile glass tube containing 5 ml of saline solution (0.85% NaCl, w/v) to a turbidity of 1 in the McFarland scale (approx., 3×108 cfu/ml) and further diluted 1,000-fold in susceptibility test medium (LSM medium) (Iso-Sensitest [IST]: MRS, 9:1) (Oxoid). Then, 100 μl of the diluted S. infantarius LP90 suspension was added to each microplate well, which was sealed with a transparent covering tape and incubated at 37°C for 18 h. After incubation, MICs were defined as the lowest concentration of the antibiotic that inhibited bacterial growth. Due to the lack of breakpoints for S. infantarius, the results were interpreted according to those established for Streptococcus thermophilus by the European Food Safety Authority (EFSA) [10]. S. thermophilus CECT801 was used as control.

Phenotypic detection of virulence factors

Production of gelatinase, β-hemolysin and protease activity were determined on Todd Hewitt agar containing gelatine (3%, w/v) (Oxoid), Columbia agar supplemented with horse blood (5%, w/v), and Tryptone Soya agar (TSA) supplemented with skim milk (1.5%, w/v) (Oxoid), respectively. E. faecalis P4 and E. faecalis P36 [11] were used as positive controls. S. infantarius LP90 was grown in MRS broth at 37°C in aerobic conditions for 16 h and then inoculated into MRS agar to obtain single colonies that were streaked onto the culture media cited above. After incubation at 37°C for 24 h, the plates containing gelatine were placed at 4°C for 5 h to facilitate the detection of zones of turbidity (indicating hydrolysis) around the colonies. The production of β-hemolysin and protease activity were detected by the presence of clear zones around the colonies.

PCR-detection of genes encoding virulence factors

The presence of streptococcal and enterococcal virulence factor genes in S. infantarius LP90 was determined using the primer pairs listed in S3 Table. PCR mixtures were subjected to an initial cycle of denaturation (97°C for 2 min), followed by 35 cycles of denaturation (94°C for 45 sec), annealing (at an appropriate temperature [S3 Table] for 30 sec), and elongation (72°C for 30 to 180 s), ending with a final extension step at 72°C for 7 min. PCR products were resolved and analyzed as described above. The molecular size markers used were HyperLadder II (Bioline London, United Kingdom) and 1 Kb Plus DNA ladder (Invitrogen).

Screening of histidine, tyrosine and ornithine decarboxylase activities in differential growth medium

Histidine, tyrosine and ornithine decarboxylase activities were evaluated using the improved decarboxylase differential growth medium [12]. S. infantarius LP90 was subcultured 5 times in MRS broth containing 0.1% (w/v) of the corresponding amino acid precursor (histidine, tyrosine or ornithine to check for HDC, TDC and ODC activities, respectively) (Sigma-Aldrich) and 0.005% (w/v) of pyridoxal-5-phosphate at 30°C overnight. Subsequently, cultures were streaked in duplicate on decarboxylase differential growth medium agar plates with or without (negative control) the corresponding amino acid precursor, and incubated at 37°C for 4 days under aerobic and anaerobic conditions. Biogenic amine production was detected by a color change from yellow to violet in the decarboxylase medium. Lactobacillus brevis CECT4121 was used as positive control for tyramine, and as negative control for histamine and putrescine. Likewise, Lactobacillus sp. ATCC30a was used as positive control for histamine and putrescine, and as negative control for tyramine [13].

PCR-detection of histidine, tyrosine and ornithine decarboxylase genes

Total DNA from S. infantarius LP90 was subjected to PCR-amplification to detect histidine, tyrosine and ornithine decarboxylase genes (hdc, tdc and odc, respectively) using the primers CL1/JV17HC [14], TD2/TD5 [15] and 3/16 [16], respectively. Lb. brevis CECT4121 was used as positive control for tdc, and as negative control for hdc and odc. Lactobacillus sp. ATCC30a was used as positive control for hdc and odc, and as negative control for tdc. PCR mixtures prepared as described above were subjected to an initial cycle of denaturation (94–97°C for 2 to 4 min), followed by 35 cycles of denaturation (94–95°C for 45 to 60 s), annealing (48–52°C for 30 sec), and elongation (72°C for 60 to 180 s), ending with a final extension step at 72°C for 7 min. PCR products were resolved and analyzed as described above.

Degradation of mucin

The ability to degrade gastric mucin was determined as previously described [17]. Mucin from porcine stomach type III (Sigma-Aldrich) and agar were added to medium B (minimal anaerobic culture medium) without glucose at concentrations of 0.5 and 1.5% (w/v), respectively. A volume of 10 μl of an overnight liquid culture of S. infantarius LP90 was inoculated onto the surface of medium B. The plates were incubated anaerobically at 37°C for 72 h, stained with amido black (0.1%, w/v) (Merck) in 3.5 M acetic acid (Merck) for 30 min, and then washed with 1.2 M acetic acid. A discolored zone around the spotted culture was considered as a positive result. A fresh fecal slurry from a healthy adult horse was used as positive control.

Deconjugation of bile salts

The ability to deconjugate bile salts was determined as previously described [18]. For this purpose, plates were prepared by adding sodium salts of taurocholate (TC) and taurodeoxycholate (TDC) (0.5%, w/v) (Sigma-Aldrich) to MRS agar supplemented with L-cysteine (0.05%, w/v) (Merck). A volume of 10μl of an overnight culture of S. infantarius LP90 was spotted onto the MRS agar plates supplemented with the bile salts, and the plates were incubated anaerobically at 37°C for 72 h. The presence of precipitated bile acid around the spotted cultures was considered as a positive result. A fresh fecal slurry from a healthy adult horse was used as positive control.

Determination of other enzymatic activities

The APIZYM kit (BioMérieux) was used to determine the presence of the following enzymatic activities in S. infantarius LP90: esterase (C4), esterase lipase (C8), trypsin, α-chymotrypsin, leucine arylamidase, valine arylamidase, cystine arylamidase, acid phosphatase, naphthol-AS-BI phosphohydrolase, alkakine phosphatase, α-galactosidase, β-galactosidase, α-glucosidase, β-glucosidase, N-acetyl-β-glucosaminidase, β-glucuronidase, α-mannosidase, and α-fucosidase. Cells from an overnight S. infantarius LP90 culture were harvested by centrifugation at 12,000 × g for 2 min, resuspended in 2 ml of API Suspension Medium (BioMérieux) and adjusted to a turbidity of 5–6 in the McFarland scale (approx., 1.5–1.9×109 cfu/ml). Aliquots of 65 μl of the suspensions were added to each of the 20 reaction cupules in the APIZYM strip. The strips were incubated at 37°C for 4.5 h and the reactions were developed by the addition of one drop of each of the APIZYM reagents A and B.

PCR-detection of streptococcal and enterococcal bacteriocin structural genes in S. infantarius LP90

The presence of streptococcal and enterococcal bacteriocin structural genes in S. infantarius LP90 was determined by PCR using the primer pairs listed in S4 Table. PCR mixtures were subjected to an initial cycle of denaturation (97°C for 2 min), followed by 35 cycles of denaturation (94°C for 45 sec), annealing (at an appropriate temperature for 30 sec) and elongation (72°C for 30 to 1 min 45 sec), ending with a final extension step at 72°C for 7 min. PCR products were resolved and analyzed as described above.

Purification, mass spectrometry and amino acid sequencing of the bacteriocins secreted by S. infantarius LP90

Bacteriocins secreted by S. infantarius LP90 were purified using modifications of the multi-chromatographic procedure described by Cintas et al. [6]. An overnight preculture of this strain was used to inoculate three 1 liter MRS broth bottles which were incubated at 37°C under aerobic conditions for 12 h. After the cells were removed by centrifugation, the proteins present in the CFSs were subjected to precipitation with ammonium sulphate (50% [w/v] [Merck, Farma y Química S. A., Barcelona, Spain]). The solution was then stirred at 4°C for 3 h and subsequently centrifuged (12,000 × g at 4°C for 30 min). The pellet and floating materials obtained after centrifugation were mixed and solubilized in 200 ml of 20 mM sodium phosphate buffer (pH 6.0) and desalted by gel filtration (PD-10 columns; GE Healthcare Life Sciences, Barcelona, Spain). From this point, each of the three concentrated and desalted CFSs was subjected to a different procedure: (i) cation-exchange (HiPrep 16/10 SP XL, GE Healthcare) and reversed-phase (PepRPC HR 5/5, GE Healthcare) chromatographies, both performed in a Fast Protein Liquid Chromatography system (ÄKTA-FPLC) (GE Healthcare) (procedure P1); (ii) anion-exchange (CM Sepharose Fast Flow, GE Healthcare) and hydrophobic-interaction (Octyl Sepharose CL-4B, Sigma-Aldrich) batch chromatographies, followed by reversed-phase chromatography in a ÄKTA-FPLC system (procedure P2), and (iii) cation-exchange (SP Sepharose Fast Flow, GE Healthcare) and hydrophobic-interaction batch chromatographies (procedure P3). The antimicrobial activity of the fractions was determined by an MPA against S. pneumoniae 66405 and Pediococcus damnosus CECT4797. Purified peptides were subjected to mass spectrometry analysis in a Matrix-Assisted Laser Desorption Ionization-Time Of Flight Voyager-DE STR mass spectrometer (MALDI-TOF MS) (PerSeptive Biosystems, Foster City, California, USA) at the Mass Spectrum Service of Parque Científico-UCM. N-terminal amino acid sequencing of the purified anti-pneumococcal peptide was performed by Edman degradation using an ABI 494 Protein Sequencing System (Applied Biosystems, Foster City, California USA) at the Protein Chemistry Service of the Centro de Investigaciones Biológicas (CIB, Consejo Superior de Investigaciones Científicas, Madrid, Spain). The protein BLAST software (National Center for Biotechnological Information [NCBI], US National Library of Medicine, http://blast.ncbi.nlm.nih.gov) was used for amino acid similarity search. The N-terminal extensions of the putative antimicrobial peptides and the transmembrane segments of their putative immunity proteins were identified by the ExPASy (https://www.expasy.org/proteomics) and SOSUI (http://harrier.nagahama-i-bio.ac.jp/sosui) programs, respectively.

Nucleotide sequencing of a multibacteriocinogenic gene cluster from S. infantarius LP90

Total DNA from S. infantarius LP90 was isolated using the Wizard Genomic DNA Purification kit (Promega). Specific oligonucleotide primers (Sigma-Genosys Ltd) designed according to the nucleotide sequence of S. infantarius ATCC BAA-102 (Genbank accession no. ABJK02000019) and to that of S. infantarius LP90 progressively determined by chromosome walking were used to obtain the sequence of the multibacteriocinogenic cluster. PCR mixtures were subjected to an initial cycle of denaturation (94°C for 2 min), followed by 35 cycles of denaturation (94°C for 15 sec), annealing (at an appropriate temperature for 30 sec), and elongation (68°C for 30 sec to 1 min), ending with a final extension step at 68°C for 7 min. The resulting products were resolved and analyzed as described above. The PCR-generated fragments were purified with the Nucleospin Extract II kit and sequenced at the Genomics Service of Parque Científico-UCM. Nucleotide sequence analysis was performed using the ORF-finder (NCBI) and the BLAST tools for the prediction of ORFs and similarity searches, respectively. The identification of rho-independent transcription terminators was performed using the ARNold finding terminator tool (Institut de Génétique et Microbiologie, Université Paris-Sud11 [http://rna.igmors.u-psud.fr/toolbox/arnold]). The 19,539 bp sequence obtained was deposited in GenBank under accession no. KJ475434.

Transcriptional analysis of a multibacteriocinogenic cluster from S. infantarius LP90

Total RNA was isolated from exponentially growing S. infantarius LP90 cultures (OD600 of 0.6–0.9) using the RNeasy Mini kit (Qiagen, Hilden, Germany), according to the procedure recommended by the manufacturer. The isolated RNA was treated with RNase-free DNase I (Qiagen) to thoroughly remove residual DNA. One-step reverse transcription (RT)-PCR was performed using the Access RT-PCR System (Promega) with DNase-treated RNA as template for cDNA synthesis. Specific oligonucleotide primers, obtained from Sigma-Genosys Ltd., were designed according to the localization of promoter and transcription termination regions found in the nucleotide sequence of S. infantarius LP90 (19,539 bp) [region I (coordinates 1–3,878), sub-region IIa (coordinates 3,886–6,776), sub-region IIb (coordinates 6,829–7,877), sub-region IIc (coordinates 7,891–9,746), sub-region IId (coordinates 9,764–11,195), sub-region IIe (coordinates 11,212–11,953), and region III (coordinates 15,197–17,625). PCR amplifications using DNase-treated RNA as template were also performed as negative control. RT-PCR and PCR amplifications were carried out as recommended by the manufacturer (Promega). The resulting products were resolved and analyzed as described above.

Results

Antimicrobial activity of bacteriocinogenic LAB against clinical S. pneumoniae strains

The 37 bacteriocinogenic LAB, isolated in previously reported works (S1 Table), displayed a broad direct antimicrobial activity spectrum, inhibiting the growth of most of the 9 tested clinical S. pneumoniae strains (S2 Table). Thirty-one strains (84.2%) exhibited extracellular antimicrobial activity against, at least, one of the 23 tested clinical S. pneumoniae strains. The 6 bacteriocinogenic LAB showing the broadest spectrum and strongest extracellular antimicrobial activity were Streptococcus sp. LP90, L. lactis BB24, E. faecalis DBH18, E. faecium BNM58, L. garvieae DCC43 and E. faecium L50. The anti-pneumococcal activity of these strains withstood heat treatment at 100°C for 1 h and was sensitive to proteinase K, indicating the proteinaceous nature of these antimicrobial compounds (i.e., bacteriocins). These bacteriocinogenic strains were grown in MRS broth at 30 and 37°C for 16 h to ascertain the best conditions for maximum bacteriocin production (results not shown). Streptococcus sp. LP90 grown at 37°C for 12 h displayed the strongest extracellular antimicrobial activity and the broadest anti-pneumococcal spectrum inhibiting the growth of the 7 S. pneumoniae strains used as indicators (results not shown). This strain was taxonomically identified as Streptococcus infantarius subsp. infantarius and selected for further studies. S. infantarius LP90 was sensitive to all the tested antibiotics for which a breakpoint has been established by EFSA (Table 1). S. infantarius LP90 showed no hemolysin, gelatinase and protease activities (S1 Fig). None of the tested genes encoding streptococcal and enterococcal virulence factors were detected in this strain (results not shown). Histidine, tyrosine and ornithine decarboxylase activities (S2 Fig) and the respective genes hdc, tdc and odc were not detected in S. infantarius LP90 (results not shown). Only the peptidase activities leucine and cystine arylamidases were found (results not shown). Mucine degradation and bile salt deconjugation abilities were not detected in S. infantarius LP90 (S3 Fig).
Table 1

Antibiotic susceptibility of S. infantarius LP90.

AntibioticMICs (μg/ml)bFEEDAP BPs valuesc, dSusceptibility/ Resistanced
Mechanism of action/ Family Test range (μg/ml)
Cell wall synthesis inhibitors
    PenicillinsAmpicillin0.03–160,122S
Penicillin0.03–16≤0.06NavNa
    GlycopeptidesVancomycin0.25–1280,504S
Protein synthesis inhibitors
    MacrolidesErythromycin0.016–80,122S
    StreptograminsVirginiamycin0.016–8≤0.25NavNa
    TetracyclinesTetracycline0.12–640,254S
    LincosamidesClindamycin0.03–160,062S
    AmphenicolsChloramphenicol0.12–642,004S
    AminoglycosidesKanamycin2–102464,0064S
Gentamycin0.5–2562,0032S
Streptomycin0.5–25632,0064S
Neomycin0.5–256≤8.00NavNa
    OxazolidinoneLinezolid0.25–16≤1.00NavNa
Nucleic acid synthesis inhibitors
    RifamycinsRifampicin0.12–64≤0.50NavNa
    FluoroquinolonesCiprofloxacin0.25–128≤2.00NavNa
    TrimethoprimTrimethoprim0.12–64≤32.00NavNa

aAntibiotic susceptibility determined by a broth microdilution test. MICs were defined as the lowest concentration of the antibiotic at which no growth was detected.

bMICs determined by a VetMIC test

cBreakpoints (BPs) for S. thermophilus proposed by EFSA [10]. BPs for penicillin, virginiamycin, neomycin, linezolid, rifampicin, ciprofloxacin, and trimethoprim are not available (Nav).

dBased on the EFSA [10] BPs, S. infantarius LP90 was categorized as susceptible (S) or resistant (R) to the corresponding antibiotic. Na, not applicable.

aAntibiotic susceptibility determined by a broth microdilution test. MICs were defined as the lowest concentration of the antibiotic at which no growth was detected. bMICs determined by a VetMIC test cBreakpoints (BPs) for S. thermophilus proposed by EFSA [10]. BPs for penicillin, virginiamycin, neomycin, linezolid, rifampicin, ciprofloxacin, and trimethoprim are not available (Nav). dBased on the EFSA [10] BPs, S. infantarius LP90 was categorized as susceptible (S) or resistant (R) to the corresponding antibiotic. Na, not applicable. None of the tested streptococcal and enterococcal bacteriocin genes were amplified by PCR in this bacteriocinogenic strain (results not shown).

Purification, mass spectrometry and amino acid sequencing of the anti-pneumococcal bacteriocin secreted by S. infantarius LP90

Purification of the anti-pneumococcal bacteriocin produced by S. infantarius LP90 revealed a single well-separated absorbance peak with antimicrobial activity which eluted at 32% (v/v) 2-propanol in aqueous 0.1% (v/v) TFA (results not shown). The purity and molecular mass of the purified bacteriocin was determined by MALDI-TOF MS, which revealed a major peptide with a molecular mass of 3,963 Da (Fig 1). An N-terminal amino acid sequence of 19 residues of this peptide was obtained by Edman degradation (Fig 2). This anti-pneumococcal bacteriocin, which was termed infantaricin A1 (InfA1), is highly similar (74% of identity) to a “bacteriocin-type signal sequence” from S. infantarius subsp. infantarius ATCCBAA-102 deposited in the Genbank database (accession no. EDT47634.1) (Fig 2).
Fig 1

Mass spectrometry analysis of the purified anti-pneumococcal bacteriocin infantaricin A1 secreted by S. infantarius LP90.

Fig 2

Alignment of the partial N-terminal sequence of infantaricin A1 and the bacteriocin-type signal sequence from S. infantarius subsp. infantarius ATCCBAA-102.

Identical residues are shaded in grey. “X” indicates an unidentified residue.

Alignment of the partial N-terminal sequence of infantaricin A1 and the bacteriocin-type signal sequence from S. infantarius subsp. infantarius ATCCBAA-102.

Identical residues are shaded in grey. “X” indicates an unidentified residue.

Nucleotide sequence and organization of a multibacteriocinogenic gene cluster from S. infantarius LP90

The 19,539-bp sequence of S. infantarius LP90 (accession no. KJ475434) shows a 99% identity to a nucleotide sequence of S. infantarius ATCCBAA-102, and includes 29 putative ORFs (orf1-orf29) (Table 2 and Fig 3) located on the same DNA strand (except orf1, orf2, and orf29) and preceded by putative ribosome binding sites (RBSs), except orf14 and orf21. These ORFs can be grouped into three functional regions (Fig 3): (i) region I (orf1-orf2), related to bacteriocin/IF secretion and organized in one operon; (ii) region II (orf3-orf26) involved in bacteriocin synthesis and immunity and organized in seven operons (sub-divided into six sub-regions, IIa to IIf), and (iii) region III (orf27-orf29), related to regulation of the bacteriocin production and organized in two operons. The region II (sub-regions IIa, IIc, and IId) includes 13 genes likely encoding bacteriocins according to their homology to known bacteriocins (Table 2), physico-chemical characteristics (Table 3) and the presence of N-terminal extensions of the GG-type of 15–30 amino acid residues (results not shown). The proteins encoded by orf9, orf10, orf25 and orf26 contain six, three, three and two transmembrane segments, respectively, and orf11 and orf16 seem to encode soluble proteins (results not shown).
Table 2

Predicted Open Reading Frames (ORFs) in the 19,539-bp fragment of genome from S. infantarius LP90 and the closest relationships of the deduced proteins.

ORFGeneProtein
Position in nucleotide sequenceNameLength (amino acids)Molecular mass (kDa)pIClosest relationshipa (number of amino acid; E-value, level of amino acid identity/level of amino acid similarity; microorganism) (Accession no.)
5'3'
ORF11.563169orf146451.45.90Bacteriocin secretion accesory protein (464; 0.0, 99%/99%; S. gallolyticus)
(WP_074658230.1)
ORF23.7221.574orf271580.16.70Peptide cleavage/export ABC transporter ATP (715; 0.0, 99%/99%; S. infantarius)
(WP_043878344.1)
ORF33.9974.254orf3 (infC2)858.24.60Bacteriocin BlpJ (85; 1e-15, 98%/98%; S. infantarius ATCC BAA-102) (EDT47628.1)
ORF44.2724.466orf4 (infC1)646.04.50Class IIb bacteriocin, lactobinA/cerein7B family (71; 2e-21, 100%/100%; S. infantarius subsp. infantarius ATCC BAA-102) (EDT47629.1)
ORF54.6624.889orf5 (infB2)757.24.00Bacteriocin BlpJ (85; 1e-05, 83%/86%; S. infantarius ATCC BAA-102)
(EDT47628.1)
ORF64.8735.079orf6 (infB1)686.94.30Class IIb bacteriocin, lactobin A/cerein 7B family (68; 1e-23, 99%/98%; Streptococcus caballi) (WP_040807669.1)
ORF75.5485.706orf7 (infA2)525.59.80Hypothetical protein (52; 7e-28; 100%/100%; S. infantarius ATCC BAA-102)
(EDT47633.1)
ORF85.7345.886orf8 (infA1)515.87.70Bacteriocin (54; 2e-08, 53%/70%; Streptococcus thoraltensis) (WP_018380431.1)
ORF95.9296.604orf922425.29.30CAAX amino terminal protease family membrane protein (224; 3e-129, 100%/100%; S. infantarius) (SUN69110.1)
ORF106.9447.246orf1010011.49.20Putative bacteriocin self-immunity protein (100; 1e-55, 100%/100%; S. infantarius)
(SUN69109.1)
ORF117,5407.842orf1110011.67.90Enterocin A immunity protein (100; 8e-64, 100%/100%; S. infantarius)
(SUN69108.1)
ORF128,0008.233orf12 (infD1)777.54.90Bacteriocin-like peptide BlpJ (77; 1e-45, 100%/100%; S. infantarius)
(SUN69107.1)
ORF138.2538.441orf13 (infD2)626.04.70Class IIb bacteriocin, lactobin A/cerein 7B family (41; 0.075, 100%/100%;
S. infantarius ATCC BAA-102) (EDT47640.1)
ORF148.7218.936orf14718.49.10Hypothetical protein (71; 4e-12, 94%/98%; S. gallolyticus subsp. gallolyticus TX20005)
(EFM28808.1)
ORF159.1919.409orf15 (infE)727.74.90Bacteriocin piscicolin-126 (72; 5e-41, 93%/95%; Streptococcus equinusATCC 700338) (EFM26697.1)
ORF169.4099.705orf169811.39.40Bacteriocin immunity protein (98; 9e-62, 99%/100%;
S. infantarius CJ18) (AEZ63022.1)
ORF179.87410.107orf17 (infF)777.87.70Bacteriocin BlpK (77; 2e-29, 100%/100%; S. gallolyticus) (ALT80184.1)
ORF1810.11210.282orf18566.89.80Hypothetical protein (65; 2e-21, 98%/100%; S. caballi) (WP_018364974.1)
ORF1910.29710.497orf19 (infG1)666.56.00Bacteriocin class II (66; 2e-18, 98%/98%; S. infantarius CJ18)
(AEZ63021.1)
ORF2010.52310.705orf20 (infG2)605.84.30Bacteriocin class II (60; 9e-14, 100%/100%; S. infantarius CJ18)
(AEZ63020.1)
ORF2110.67710.829orf21505.99.52Hypothetical protein (48; 6e-21, 88%/93%; S. gallolyticusTX20005) (EFM28809.1)
ORF2210.85411.069orf22718.38.80Hypothetical protein (71; 2e-15, 100%/100%; S. gallolyticus) (SEF21267.1)
ORF2311.32311.553orf 23 (infH)768.05.64Bacteriocin class II with double-glycine leader peptide (76;6e-49,100%/100%; S. infantarius) (SUN69099.1)
ORF2411.64211.951orf2410312.09.30Hypothetical protein (103; 9e-69, 98%/99%; S. equinus) (EFM26700.1)
ORF2512.36712,720orf2511713.08.79Immunity protein BlpL (134; 6e-62,99%/99%; S. infantarius CJ18)
(AEZ63016.1)
ORF2612.90113.947orf2634837.64.16LPXTG cell wall anchor domain-containing protein (348; 0.0, 100%/100%;
S. infantarius) (WP_006531888.1)
ORF2715.30416.029orf2724127.95.25DNA-binding response regulator (241; 2e-177, 99%/100%; Streptococcus sp.)
(HAK39972.1)
ORF2816.04217.351orf2843951.45.85Histidine kinase (439; 0.0, 99%/99%; Streptococcus sp.)
(HAK39971.1)
ORF2917.52117.373orf29212.66.90Protein of the ComC family (49; 5e-28, 100%/100%; S. infantarius CJ18)
(AEZ63012.1)

aResults of the similarity searches conducted on October of 2019.

Fig 3

Physical map showing the genetic organization of a 19,539-bp multibacteriocinogenic cluster present in S. infantarius LP90.

Putative ORFs are represented by wide arrows indicating the direction of transcription. Small flags and loop symbols indicate putative promoters and rho-independent transcription termination regions, respectively. Horizontal arrows below the genes refer to the transcriptional and co-transcriptional units as determined by RT-PCR. Dashed arrows refer to genes not transcribed or not co-transcribed.

Table 3

Hypothetical bacteriocins encoded by S. infantarius LP90.

GeneProtein
ORFNameNameLengthSizepIAmino acid sequence 
   (aa)(Da)  
orf3infC2InfC2625.6808.05YSAIDCRNAMLTGIASGIIAGGTGAGLATLGVGGLAGAFVGAHIGAIGGGLTCVGGMIGNKF
orf4infC1InfC1423.7028.05KGNLGSAIGGCIGGVILAAATGPLTGGAAALVCVGSGLSAYL 
orf5infB2InfB2524.6818.03YSAGACLTDIGLGMVGGGAAGVAGGVAGIALGVALGQIGGNVRCITSYVGGK 
orf6infB1InfB1434.0094.37VNWGVAAGYCVAGALIGAAGGAISAGVGCLVSGLQEVSDGLFK 
orf7infA2InfA2293.00010.40DNITKGAYKLGKATRQAAKAIGKAVGKLF 
orf8infA1InfA1303.3578.76DDLYKLVNQGFGAICSFIDGFNGKKYRGKC 
orf12infD1InfD1544.9888.05NKCVNAIFGGALTGAGSGFVGGMATLGVTSIPGAFVGAHFGAIAGGLYCVGASL
orf13infD2InfD2433.9028.03GKVGAAVGGCLGGMLLAWAGGPVTATGYAVVCGTAGAAAAYFN
orf15infEInfE495.1628.79KTIYYGNGLYCNANKCWVNWSQTATTIANNSVINGLTGGNAGWHSGGIA
orf17infFInfF545.2909.70GCNWKGAAATVAVGAVGGAIKGAVTTYSWQGAALKAVGYGIKAGVAYGVTCRWT
orf19infG1InfG1434.03310.10KSKEGRNMGCILGTAGMAGAGFLVAGPAGAAALGGATALRVCR
orf20infG2InfG2423.7648.90KVSPTCAALVAASIYGGLAVAGPAGVGLAMAVGGAAAGSFCR
orf23infHInfH535.4398.90GMEWIGDVLGAIGNAAHPVNPRQVVDQLNGKYPRRGPVRSCPPGGTGGTPNAC 

Physical map showing the genetic organization of a 19,539-bp multibacteriocinogenic cluster present in S. infantarius LP90.

Putative ORFs are represented by wide arrows indicating the direction of transcription. Small flags and loop symbols indicate putative promoters and rho-independent transcription termination regions, respectively. Horizontal arrows below the genes refer to the transcriptional and co-transcriptional units as determined by RT-PCR. Dashed arrows refer to genes not transcribed or not co-transcribed. aResults of the similarity searches conducted on October of 2019. mRNA transcripts of the expected sizes were detected in the following regions (Fig 3): (i) region I (putative transcript T1, PT1) (orf1-orf2); (ii) region II, sub-region IIa (PT2, orf3-orf9), sub-region IIb (PT3, orf10-orf11), sub-region IIc ([PT4, orf12-orf14] and [PT5, orf15-orf16]), sub-region IId (PT6, orf17-orf22), and sub-region IIe (PT7, orf23-orf24), and (iii) region III (PT10, orf29). No RT-PCR amplicons were detected at sub-region IIf (PT8) (orf25 and orf26) and region III (PT9) (orf27-orf28). The following regions were found to be co-transcribed: (i) sub-regions IIa and IIb (PT2-3, orf3-orf11); (ii) sub-regions IIb and IIc (PT3-4, orf10-orf14); (iii) sub-region IIc (PT4-5, orf12-orf16), and (iv) sub-regions IId and IIe (PT6-7, orf17-orf24). No co-transcriptional unit was found between sub-regions IIc and IId (PT5-6, orf15-orf22).

Purification and mass spectrometry of the non-anti-pneumococcal bacteriocins secreted by S. infantarius LP90

Bacteriocin purification based on cation-exchange and RP-FPLC chromatographies (procedure P1)

RP-FPLC resulted in one well-separated absorbance peak eluting at 30% (v/v) 2-propanol in aqueous TFA (0.1%, v/v) (results not shown) showing antimicrobial activity against P. damnosus CECT4797. MALDI-TOF MS of this fraction revealed three major peaks of 4,714; 3,354 and 2,359 Da (Fig 4).
Fig 4

Mass spectrometry analysis of the antimicrobial peptides obtained from S. infantarius LP90 using the purification procedure P1.

Bacteriocin purification based on anion-exchange and hydrophobic interaction batch chromatographies followed by RP-FPLC (procedure P2)

RP-FPLC resulted in three peaks (fractions A, B and C) eluting at 34, 36 and 38% (v/v) 2-propanol in aqueous TFA (0.1%, v/v), respectively (results not shown), showing antimicrobial activity against P. damnosus CECT4797. MALDI-TOF MS revealed predominant peaks of 4,718; 3,968 and 4,067 Da in fractions A (Fig 5A), fraction B (Fig 5B) and fraction C (Fig 5C), respectively.
Fig 5

Mass spectrometry analysis of the antimicrobial peptides obtained from S. infantarius LP90 using the purification procedure P2.

a. Molecular mass of the peak eluting at 34% (v/v) 2-propanol in aqueous TFA (0.1%, v/v). b. Molecular mass of the peak eluting at 36% (v/v) 2-propanol in aqueous TFA (0.1%, v/v). c. Molecular mass of the peak eluting at 38% (v/v) 2-propanol in aqueous TFA (0.1%, v/v). The predominant peak is pointed out with an arrow.

Mass spectrometry analysis of the antimicrobial peptides obtained from S. infantarius LP90 using the purification procedure P2.

a. Molecular mass of the peak eluting at 34% (v/v) 2-propanol in aqueous TFA (0.1%, v/v). b. Molecular mass of the peak eluting at 36% (v/v) 2-propanol in aqueous TFA (0.1%, v/v). c. Molecular mass of the peak eluting at 38% (v/v) 2-propanol in aqueous TFA (0.1%, v/v). The predominant peak is pointed out with an arrow.

Partial bacteriocin purification based on cation-exchange and hydrophobic-interaction batch chromatographies (procedure P3)

MS-analysis of a crude fraction obtained after gel filtration, cation-exchange and hydrophobic-interaction batch chromatographies of the proteins present in a S. infantarius LP90 CFS resulted in several peaks with molecular masses included in the size range of bacteriocins (3.5–5.5 kDa), namely, 3,654; 3,709; 3,890; 4032; 4,718 and 5,439 Da (Fig 6A), and 3,963; 4,716 and 5,436 Da (Fig 6B).
Fig 6

Mass spectrometry analysis of the proteins obtained from S. infantarius LP90 using the purification procedure P3.

a. Molecular mass of the crude sample obtained after hydrophobic-interaction batch chromatography. b. Molecular mass of the precipitated sample (2-D Clean-Up Kit, Sigma-Aldrich) obtained after hydrophobic-interaction batch chromatography.

Mass spectrometry analysis of the proteins obtained from S. infantarius LP90 using the purification procedure P3.

a. Molecular mass of the crude sample obtained after hydrophobic-interaction batch chromatography. b. Molecular mass of the precipitated sample (2-D Clean-Up Kit, Sigma-Aldrich) obtained after hydrophobic-interaction batch chromatography.

Discussion

Treatment of S. pneumoniae infections represents a challenge because of the emergence of multidrug-resistant pneumococci [3]. LAB bacteriocins might constitute an alternative or complementary treatment to antibiotics [4]. From 37 bacteriocinogenic LAB isolated from food and other sources, S. infantarius subsp. infantarius LP90, obtained from Venezuelan water buffalo milk [19], displayed the broadest and strongest anti-pneumococcal spectrum. S. infantarius belongs to the Streptococcus bovis-Streptococcus equinus group, comprising commensal non-β haemolytic inhabitants of the gastrointestinal tract of animals and humans [20]. This species has been isolated from dairy products [21] where it seems to fulfil the function of S. thermophilus [22], frozen peas, faeces of infants and clinical samples from patients suffering from endocarditis [23]. S. infantarius LP90 does not encode the glucosyltransferase enzyme, which might constitute a virulence factor for humans and animals [21], or any of the previously described streptococcal and enterococcal virulence factors; moreover, it does not produce any of the tested biogenic amines, nor exhibits β-glucuronidase, mucinolytic or bile salt deconjugation activities. S. infantarius LP90 shows an antibiotic susceptibility profile similar to S. thermophilus, a species used as dairy starter culture [24]. Therefore, this strain can be considered as safe. Analysis of the 19,539-bp cluster from S. infantarius LP90 reveals that this is a multibacteriocinogenic producer whose bacteriocins would share the same secretion and regulation system. Region II contains 13 genes (orf3-orf8, orf12-orf13, orf15, orf17, orf19-orf20 and orf23) encoding bacteriocins (Table 2). These peptides have a relatively low size (<6 kDa) and a high pI (Table 3), which are characteristic of class I and II bacteriocins, and contain N-terminal extensions of the GG-type of 15–30 amino acid residues, which are typical of bacteriocins secreted by dedicated ABC transporters [25]. Ten out of these 13 bacteriocin structural genes might act synergistically (subclass IIb bacteriocins), as suggested by their tandem organization and high homology to other two-peptide bacteriocins, thus constituting the two-peptide bacteriocins InfC, InfB, InfA, InfD and InfG. On the other hand, InfE is a subclass IIa bacteriocin, while InfF and InfH are subclass IIe bacteriocins. Several loci displaying characteristics of class II bacteriocin genes have been identified in the genome of different Streptococcus spp. [26]. Moreover, the presence of a high number of bacteriocin genes, although lower than that found in this study, seems to be common in streptococci [26]. Region II also contains 4 genes displaying homology to bacteriocin immunity proteins, and 1 gene showing homology to CAAX amino-terminal proteases (Abi proteins), which have been shown to be involved in self-immunity against bacteriocins [27]. RT-PCR showed that bacteriocin/IF transporter genes (region I) and all the bacteriocin structural and immunity genes (region II), except orf25 and orf26, are transcribed. Amongst the bacteriocin regulation genes (region III), only orf29, which based on the sequence similarity analysis likely encodes an IF, was transcribed. The 3,963 and 3,354 Da peptides secreted by S. infantarius LP90 could be two independent peptides or, more likely, two InfA1 variants. InfA1 (3,963 Da) shows anti-pneumococcal activity but its molecular mass does not match with the predicted one (3,357 Da), while InfA1 with the predicted molecular mass (3,354 Da, Fig 4) does not show inhibitory activity against S. pneumoniae. From these observations, three hypotheses are proposed: (i) InfA1 (3,963 Da) is somehow modified or bounded to an unknown molecule which confers anti-pneumococcal activity; (ii) the amount of InfA1 (3,357 Da) produced by S. infantarius LP90 is not high enough to inhibit S. pneumoniae, while the amount of InfA1 (3,963 Da) would be higher and thus it would permit to detect its anti-pneumococcal activity (in this case, the hypothetical modification of InfA1 would not be positively involved in the anti-pneumococcal activity), and (iii) considering that InfA1 and InfA2 seem to constitute a two-peptide bacteriocin, InfA2 could be present in the same fraction as InfA1 (3,963 Da) in an amount necessary to confer anti-pneumococcal activity but not sufficient to be identified by MALDI-TOF MS. Similarly to InfA1 (3,963Da), InfA2 could have a modified molecular mass which would hinder its identification in this fraction. The use of different purification procedures allowed demonstration of the production of five more of the 13 putative bacteriocins encoded by S. infantarius LP90. MS-analyses showed peaks of 4,004 (Fig 5C); 3,709; 4,031; and 5,439 Da (Fig 6A), which approximately matched the predicted molecular sizes of InfB1, InfC1, InfG1,and InfH (Table 3). However, in the case of InfG1 two additional peaks with modified molecular masses (4,067 and 4,051 Da; Fig 5C) were also detected. Considering that InfG1 contains two methionine residues, the peak of 4,067 Da could be the result of the conversion of one Met to MetSO2 (addition of 32 Da) or the conversion of the two Met to methionine sulfoxide (MetSO) (addition of 16 Da each one). Likewise, the lower intensity peak with a molecular mass of 4,051 Da could also correspond to InfG1 due to the conversion of one Met to MetSO (addition of 16 Da). Moreover, peptides that could correspond to InfB2 were also detected (4,714 Da in Fig 4, and 4,718 Da in Figs 5A and 6A). The molecular mass of these purified peptides is approximately 32 Da higher than that of the predicted one, which might be due to a spontaneous modification of the methionine residue to methionine disulfide (MetSO2) (addition of 32 Da). Considering these results, we can not discard the possibility that other infantaricins be produced but not detected, especially considering that all their structural genes are transcribed. In this respect, some of the bacteriocins produced by S. infantarius LP90 could have undergone modifications which would preclude their identification by MALDI-TOF MS.

Conclusions

S. infantarius LP90, a safe dairy strain exerting anti-pneumococcal activity, harbours a 19,539-bp multibacteriocinogenic cluster consisting of 29 ORFs including the genes encoding 8 new class II-bacteriocins (InfA [InfA1-InfA2], InfB [InfB1-InfB2], InfC [InfC1-InfC2], InfD [InfD1-InfD2], InfE, InfF, InfG [InfG1-InfG2] and InfH), as well as the proteins involved in their secretion, immunity and transcriptional regulation. The anti-pneumococcal activity of S. infantarius LP90 is due, at least, to a modified InfA1 (3,963Da). In addition to InfA1, biologically active InfB1, InfB2, InfC1, InfG1 and InfH, which lack anti-pneumococcal activity, are also secreted by this strain. InfA1 (3,963Da) displays a broad anti-pneumococcal spectrum and other interesting characteristics and could be employed as an alternative or complementary strategy to antibiotics for the control of human infections caused by S. pneumoniae.

Phenotypic detection of virulence factors in S. infantarius LP90.

(A) β-hemolysin, (B) gelatinase and (C) protease activity; (1) and (2) S. infantarius LP90, (3) E. faecalis P4, and (4) E. faecalis P36 used as positive controls. (PPT) Click here for additional data file.

Biogenic amine production in S. infantarius LP90.

(A) Tyrosine, (B) histidine, and (B) ornithine decarboxylase activities. (1) S. infantarius LP90, (2) Lb. brevis CECT4121 used as positive control for tyrosine descarboxylase activity, and (3) Lactobacillus sp. ATTCC30a used as positive control for histidine and ornithine descarboxylase activities. (PPT) Click here for additional data file. Mucine degradation (A) and bile salt deconjugation (B) abilities in (1) and (2) S. infantarius LP90, and (3) fresh fecal slurry from a healthy adult horse as positive control. (PPT) Click here for additional data file.

RP-FPLC chromatography showing the peptides obtained from a S. infantarius LP90 CFS subjected to purification procedure P1.

Fractions 26 and 28 eluted at 30 and 32% (v/v) 2-propanol in aqueous TFA (0.1%, v/v), respectively. Red and black dashed lines indicate antimicrobial activity against S. pneumoniae 66405 and P. damnosus CECT4797, respectively. (PPT) Click here for additional data file.

RP-FPLC chromatography showing the peptides obtained from a S. infantarius LP90 CFS subjected to purification procedure P2.

Fractions 15, 17, and 18 eluted at 34, 36, and 38% (v/v) 2-propanol in aqueous TFA (0.1%, v/v), respectively. Red and black dashed lines indicate antimicrobial activity against S. pneumoniae 66405 and P. damnosus CECT4797, respectively. (PPT) Click here for additional data file.

Bacteriocinogenic LAB and indicator microorganisms used in this study.

(XLS) Click here for additional data file.

Antimicrobial activity of bacteriocinogenic LAB against S. pneumoniae clinical strains.

(XLS) Click here for additional data file.

Primers and PCR conditions for detection of virulence factor genes.

(XLS) Click here for additional data file.

Primers and PCR conditions for detection of bacteriocin structural genes.

(XLS) Click here for additional data file. 10 Dec 2019 PONE-D-19-30374 Biochemical, genetic and transcriptional characterization of multibacteriocin production by the anti-pneumococcal dairy strain Streptococcus infantarius LP90 PLOS ONE Dear Ass. Prof. Cintas, Thank you for submitting your manuscript to PLOS ONE. After careful consideration, we feel that it has merit but does not fully meet PLOS ONE’s publication criteria as it currently stands. Therefore, we invite you to submit a revised version of the manuscript that addresses the points raised during the review process. We noted that both reviewers want more details of experiments and /or suggest to include data which have not been shown in the manuscript pertaining to this study. We expect the authors to follow these suggestions and provide information asked by the reviewers.  Furthermore, make sure the figures are easy to understand (pay attention to comment about Figure 3). This could be achieved by 1) generation high resolution image and 2) by showing the images to other colleagues and see if they can understand and interpret the images without much difficulty. We would appreciate receiving your revised manuscript by Jan 24 2020 11:59PM. When you are ready to submit your revision, log on to https://www.editorialmanager.com/pone/ and select the 'Submissions Needing Revision' folder to locate your manuscript file. If you would like to make changes to your financial disclosure, please include your updated statement in your cover letter. To enhance the reproducibility of your results, we recommend that if applicable you deposit your laboratory protocols in protocols.io, where a protocol can be assigned its own identifier (DOI) such that it can be cited independently in the future. For instructions see: http://journals.plos.org/plosone/s/submission-guidelines#loc-laboratory-protocols Please include the following items when submitting your revised manuscript: A rebuttal letter that responds to each point raised by the academic editor and reviewer(s). This letter should be uploaded as separate file and labeled 'Response to Reviewers'. A marked-up copy of your manuscript that highlights changes made to the original version. This file should be uploaded as separate file and labeled 'Revised Manuscript with Track Changes'. An unmarked version of your revised paper without tracked changes. This file should be uploaded as separate file and labeled 'Manuscript'. Please note while forming your response, if your article is accepted, you may have the opportunity to make the peer review history publicly available. The record will include editor decision letters (with reviews) and your responses to reviewer comments. If eligible, we will contact you to opt in or out. We look forward to receiving your revised manuscript. Kind regards, Anirudh K. Singh, Ph.D Academic Editor PLOS ONE Journal Requirements: When submitting your revision, we need you to address these additional requirements. 1. Please ensure that your manuscript meets PLOS ONE's style requirements, including those for file naming. The PLOS ONE style templates can be found at http://www.journals.plos.org/plosone/s/file?id=wjVg/PLOSOne_formatting_sample_main_body.pdf and http://www.journals.plos.org/plosone/s/file?id=ba62/PLOSOne_formatting_sample_title_authors_affiliations.pdf [Note: HTML markup is below. Please do not edit.] Reviewers' comments: Reviewer's Responses to Questions Comments to the Author 1. Is the manuscript technically sound, and do the data support the conclusions? The manuscript must describe a technically sound piece of scientific research with data that supports the conclusions. Experiments must have been conducted rigorously, with appropriate controls, replication, and sample sizes. The conclusions must be drawn appropriately based on the data presented. Reviewer #1: Yes Reviewer #2: Yes ********** 2. Has the statistical analysis been performed appropriately and rigorously? Reviewer #1: N/A Reviewer #2: N/A ********** 3. Have the authors made all data underlying the findings in their manuscript fully available? The PLOS Data policy requires authors to make all data underlying the findings described in their manuscript fully available without restriction, with rare exception (please refer to the Data Availability Statement in the manuscript PDF file). The data should be provided as part of the manuscript or its supporting information, or deposited to a public repository. For example, in addition to summary statistics, the data points behind means, medians and variance measures should be available. If there are restrictions on publicly sharing data—e.g. participant privacy or use of data from a third party—those must be specified. Reviewer #1: Yes Reviewer #2: Yes ********** 4. Is the manuscript presented in an intelligible fashion and written in standard English? PLOS ONE does not copyedit accepted manuscripts, so the language in submitted articles must be clear, correct, and unambiguous. Any typographical or grammatical errors should be corrected at revision, so please note any specific errors here. Reviewer #1: Yes Reviewer #2: Yes ********** 5. Review Comments to the Author Please use the space provided to explain your answers to the questions above. You may also include additional comments for the author, including concerns about dual publication, research ethics, or publication ethics. (Please upload your review as an attachment if it exceeds 20,000 characters) Reviewer #1: The manuscript focus on biochemical, genetic and transcriptional characterization of bacteriocins production by Streptococcus infantarius LP90 strain isolated from Venezuelan water buffalo milk. The work is interesting, and the authors suggest that these bacteriocins may be applicable in human medicine as antimicrobials. -Line 80: OD600, 600 as subscript. -Lines 308-309: Could the authors explain which reference gene was used for RT PCR? And which method was applicated for the analysis? -Lines 331-339 and 342-343: It is necessary to write “not shown” several times? The authors can show positive results. -Line 440: Could authors show the three peaks obtained? -Supporting Information S4 Table. S. uberis strains yield Nisin U, Uberolisin and Ubericin A genes and S. uberis strains could be used as control strains. Reviewer #2: The authors describe the identification of several novel bacteriocins produced by S. infatarius LP90, including a bacteriocin with anti-pneumococcal activity. The authors present data to show that the strain LP90 is safe, and fully characterize the gene cluster encoding several potential bacteriocins. These results support the potential for using bacteriocins as alternatives or supplements to antibiotic treatment for combating human infections. The authors need to address the specific points listed on the attached document. ********** 6. PLOS authors have the option to publish the peer review history of their article (what does this mean?). If published, this will include your full peer review and any attached files. If you choose “no”, your identity will remain anonymous but your review may still be made public. Do you want your identity to be public for this peer review? For information about this choice, including consent withdrawal, please see our Privacy Policy. Reviewer #1: No Reviewer #2: No [NOTE: If reviewer comments were submitted as an attachment file, they will be attached to this email and accessible via the submission site. Please log into your account, locate the manuscript record, and check for the action link "View Attachments". If this link does not appear, there are no attachment files to be viewed.] While revising your submission, please upload your figure files to the Preflight Analysis and Conversion Engine (PACE) digital diagnostic tool, https://pacev2.apexcovantage.com/. PACE helps ensure that figures meet PLOS requirements. To use PACE, you must first register as a user. Registration is free. Then, login and navigate to the UPLOAD tab, where you will find detailed instructions on how to use the tool. If you encounter any issues or have any questions when using PACE, please email us at figures@plos.org. Please note that Supporting Information files do not need this step. Submitted filename: PLOS ONE 30374.docx Click here for additional data file. 13 Jan 2020 PLOS ONE: PONE-D-19-30374 Biochemical, genetic and transcriptional characterization of multibacteriocin production by the anti-pneumococcal dairy strain Streptococcus infantarius LP90 ACADEMIC EDITOR Dear Dr. Anirudh K. Singh, Thank you very much for your criticism and constructive comments on our manuscript. As you suggested, a higher resolution Figure 5 has been provided and this image was showed to some colleagues that understood and interpreted it without difficulty. Sincerely yours Ass. Prof. Luis M. Cintas Izarra REVIEWER #1: Dear Reviewer: Thank you very much for your criticism and constructive comments on our manuscript. Please, find below our point-to-point answers to your comments: 1. Line 80: OD600, 600 as subscript. Modified as suggested (lines 80, 95 and 300; pages 4, 5 and 13, respectively) 2. Lines 308-309: Could the authors explain which reference gene was used for RT PCR? And which method was applicated for the analysis? In all the RT-PCR analysis we obtained amplicons of the expected size, which was used as an internal control that the reactions were working properly. On the other hand, with regard to the method applied for the analysis, please note that a paragraph with this information has been included in the revised manuscript (lines 304-310, page 14). 3. Lines 331-339 and 342-343: It is necessary to write “not shown” several times? The authors can show positive results. As suggested, these results have been included in the revised manuscript as supplemental files (S1 Fig, S2 Fig and S3 Fig). 4. Line 440: Could authors show the three peaks obtained? We are not sure if you want to see only this chromatogram or also the other obtained with the purification procedure 1. Please note that both chromatograms have been included as supplemental files (S4 Fig and S5 Fig). 5. Supporting Information S4 Table. S. uberis strains yield Nisin U, Uberolisin and Ubericin A genes and S. uberis strains could be used as control strains. We acknowledge that S.uberis strains can be used as bacteriocin positive controls but, unfortunately, we could not have access to these strains. REVIEWER #2 Dear Reviewer: Thank you very much for your criticism and constructive comments on our manuscript. Please, find below our point-to-point answers to your comments: 1. Page 7: Table 1, showing susceptibility to antibiotics, is inserted within the Materials and Methods section, but it should be moved to Page 15 where these results are reported in the Results section. A list of the antibiotics used could be provided within the text of the Materials and Methods. A list of the antibiotics used has been introduced in the Materials and Methods section (lines 140-143, page 7). Table 1 has been deleted from “Material and Methods” and introduced in the Results section (line 343, page 15). 2. Page 15, line 315: It should be mentioned in the text if the 37 LAB screened were novel isolates from this study or a previously reported study. The sentence “isolated in previously reported works” has been introduced in the Results section (line 318, page 14).The references are in S1 Table. Why is reported that LAB inhibited most of the 9 S. pneumoniae strains screened, when 23 clinical isolates were tested (lines 316-318)? As stated in the Materials and Methods section, the direct antimicrobial activity of the 37 bacteriocinogenic LAB was screened by a stab-on-agar test (SOAT) against 9 S. pneumoniae strains (lines 83-84, page 4), while their extracellular antimicrobial activity was determined by an agar well-diffusion test (ADT) against 23. S. pneumoniae strains (lines 92-94, page 5). Was there something unique about these 9 strains, and which 9 strains are being referenced? These 9 strains were selected on the basis of their serotypes and antibiotic susceptibility patterns to assure heterogeneity. The information about which 9 strains were used as indicators in SOATs can be found in S2 Table. Line 327: How many strains were inhibited by LP90, which showed the broadest anti-pneumococcal spectrum? Please, note that this information has been included in the revised manuscript (lines 331-332; page 15). Line 342: It should be made clear that LP90 was screened for the presence of known bacteriocin genes by PCR, and none were identified. Please, note that this subject has been clarified in the revised manuscript (lines 346-347; page 16). 3. It should also be said if the streptococcal genes screened for included known bacteriocins from other S. infantarius strains. Bacteriocins have not been previously identified in the species S. infantarius. Please, note that this sentence has been included in S4 Table footnote (superscript b explanation). 4. Page 17: Nucleotide sequence of multibacteriocinogenic gene cluster: The labeling of genes are not clear in Figure 3, this image must be generated so the reader can see where the genes and operons are located within the gene cluster. It is difficult to follow the text without the corresponding map of the gene cluster. Please note that this figure has been modified to increase its resolution. 5. Line 432: Pediococcus must be spelled out for strain CECT4797. This is the first time this strain is referenced in the text, but it should include within the Materials and Methods section as well. As suggested, Pediococcus has been spelled in the Materials and Methods section (line 262, page 12). 6. Line 439-444: The fractions reported should be listed specifically with the image shown in Figure 5 (5a, 5b, 5c). The differences between each figure should also be explained with a figure legend. Listed as suggested (lines 443-453, page 24). Moreover, the differences between each figure have been explained in Figs 5 legends. Please, note that the predominant peaks are pointed with an arrow in the modified Figs 5. Two lower intensity peaks are reported for fractions B and C, but several other molecular weights are shown, why were these two peaks reported? This sentence has been deleted. Because the reported peaks have molecular masses which could be corresponded to modified (oxidized) bacteriocins as indicated in the Discussion section (lines 521-530, page 27 and 28). 7. Line 447: Within the text the different fractions shown in Figure 6 (a and b) should be specified. The different fractions shown in Figs 6a and b have been specified as suggested (lines 459-460, page 25). Please, note that the letter “a” has been added to Fig.6 (line 526, page 27; and line 536, page 28). 8. Line 477: Is it correct to say the potential bacteriocins “would share the same secretion and regulation system”? Is this based on the presence of similar signal peptides on bacteriocins, or just on the fact that they are co-located within the same gene cluster? The authors need to be clear when making conclusions within the Discussion. The bacteriocins are clustered and flanked by secretion and regulation genes, which supports that they would share the same secretion and regulation systems. Line 486-487: Which bacteriocins are potentially class IIa and IIe, since three bacteriocins are listed. This has been clarified in the revised manuscript (lines 496-497, page 26). 9. Line 496-501: What is shown that orf29 encoded an IF, or was this conclusion based on sequence similarity? This statement is based on sequence similarity. Please, note that this has been clarified in the revised manuscript (line 506-507, page 27). Are the molecular masses variants of InfA1 or could they be separate peptides? This section, describing the peptides with molecular masses of 3, 963; 3,354 and 3.357 Da, needs to be discussed more clearly. We agree that these two peptides could be separate peptides and have mentioned this possibility in the revised manuscript (lines 508-509, page 27). However, we do consider more likely the hypothesis we present in the manuscript. With regard to this, we would like to note that some bacteriocins require a non-peptidic moiety to exert antimicrobial activity. On the other hand we have done our best to modify the section describing the peptides with molecular masses of 3, 963 and 3,354 Da in order to make it more clear for the reader (lines 508-522, page 27). Submitted filename: PONE-D-19-30374 Response to Reviewers.docx Click here for additional data file. 6 Feb 2020 Biochemical, genetic and transcriptional characterization of multibacteriocin production by the anti-pneumococcal dairy strain Streptococcus infantarius LP90 PONE-D-19-30374R1 Dear Dr. Cintas, We are pleased to inform you that your manuscript has been judged scientifically suitable for publication and will be formally accepted for publication once it complies with all outstanding technical requirements. Within one week, you will receive an e-mail containing information on the amendments required prior to publication. When all required modifications have been addressed, you will receive a formal acceptance letter and your manuscript will proceed to our production department and be scheduled for publication. Shortly after the formal acceptance letter is sent, an invoice for payment will follow. To ensure an efficient production and billing process, please log into Editorial Manager at https://www.editorialmanager.com/pone/, click the "Update My Information" link at the top of the page, and update your user information. If you have any billing related questions, please contact our Author Billing department directly at authorbilling@plos.org. If your institution or institutions have a press office, please notify them about your upcoming paper to enable them to help maximize its impact. If they will be preparing press materials for this manuscript, you must inform our press team as soon as possible and no later than 48 hours after receiving the formal acceptance. Your manuscript will remain under strict press embargo until 2 pm Eastern Time on the date of publication. For more information, please contact onepress@plos.org. With kind regards, Anirudh K. Singh, Ph.D Academic Editor PLOS ONE Additional Editor Comments (optional): Reviewers' comments: Reviewer's Responses to Questions Comments to the Author 1. If the authors have adequately addressed your comments raised in a previous round of review and you feel that this manuscript is now acceptable for publication, you may indicate that here to bypass the “Comments to the Author” section, enter your conflict of interest statement in the “Confidential to Editor” section, and submit your "Accept" recommendation. Reviewer #1: All comments have been addressed ********** 2. Is the manuscript technically sound, and do the data support the conclusions? The manuscript must describe a technically sound piece of scientific research with data that supports the conclusions. Experiments must have been conducted rigorously, with appropriate controls, replication, and sample sizes. The conclusions must be drawn appropriately based on the data presented. Reviewer #1: Yes ********** 3. Has the statistical analysis been performed appropriately and rigorously? Reviewer #1: Yes ********** 4. Have the authors made all data underlying the findings in their manuscript fully available? The PLOS Data policy requires authors to make all data underlying the findings described in their manuscript fully available without restriction, with rare exception (please refer to the Data Availability Statement in the manuscript PDF file). The data should be provided as part of the manuscript or its supporting information, or deposited to a public repository. For example, in addition to summary statistics, the data points behind means, medians and variance measures should be available. If there are restrictions on publicly sharing data—e.g. participant privacy or use of data from a third party—those must be specified. Reviewer #1: Yes ********** 5. Is the manuscript presented in an intelligible fashion and written in standard English? PLOS ONE does not copyedit accepted manuscripts, so the language in submitted articles must be clear, correct, and unambiguous. Any typographical or grammatical errors should be corrected at revision, so please note any specific errors here. Reviewer #1: Yes ********** 6. Review Comments to the Author Please use the space provided to explain your answers to the questions above. You may also include additional comments for the author, including concerns about dual publication, research ethics, or publication ethics. (Please upload your review as an attachment if it exceeds 20,000 characters) Reviewer #1: The manuscript describes a novel anti-pneumococcal bacteriocin. All comments have been addressed to the manuscript and it is now ready for publication. ********** 7. PLOS authors have the option to publish the peer review history of their article (what does this mean?). If published, this will include your full peer review and any attached files. If you choose “no”, your identity will remain anonymous but your review may still be made public. Do you want your identity to be public for this peer review? For information about this choice, including consent withdrawal, please see our Privacy Policy. Reviewer #1: No 10 Feb 2020 PONE-D-19-30374R1 Biochemical, genetic and transcriptional characterization of multibacteriocin production by the anti-pneumococcal dairy strain Streptococcus infantarius LP90 Dear Dr. Cintas: I am pleased to inform you that your manuscript has been deemed suitable for publication in PLOS ONE. Congratulations! Your manuscript is now with our production department. If your institution or institutions have a press office, please notify them about your upcoming paper at this point, to enable them to help maximize its impact. If they will be preparing press materials for this manuscript, please inform our press team within the next 48 hours. Your manuscript will remain under strict press embargo until 2 pm Eastern Time on the date of publication. For more information please contact onepress@plos.org. For any other questions or concerns, please email plosone@plos.org. Thank you for submitting your work to PLOS ONE. With kind regards, PLOS ONE Editorial Office Staff on behalf of Dr. Anirudh K. Singh Academic Editor PLOS ONE
  22 in total

1.  Improved screening procedure for biogenic amine production by lactic acid bacteria.

Authors:  S Bover-Cid; W H Holzapfel
Journal:  Int J Food Microbiol       Date:  1999-12-01       Impact factor: 5.277

Review 2.  Global serotype distribution among Streptococcus pneumoniae isolates causing otitis media in children: potential implications for pneumococcal conjugate vaccines.

Authors:  Gail L Rodgers; Adriano Arguedas; Robert Cohen; Ron Dagan
Journal:  Vaccine       Date:  2009-04-25       Impact factor: 3.641

3.  Phenotypic and genetic evaluations of biogenic amine production by lactic acid bacteria isolated from fish and fish products.

Authors:  Estefanía Muñoz-Atienza; Gerardo Landeta; Blanca de las Rivas; Beatriz Gómez-Sala; Rosario Muñoz; Pablo E Hernández; Luis M Cintas; Carmen Herranz
Journal:  Int J Food Microbiol       Date:  2011-02-26       Impact factor: 5.277

4.  Laboratory surveillance of antimicrobial resistance and multidrug resistance among Streptococcus pneumoniae isolated in the Kinki region of Japan, 2001-2015.

Authors:  Hirofumi Toda; Kaori Satoh; Masaru Komatsu; Saori Fukuda; Tatsuya Nakamura; Takumi Jikimoto; Hisaaki Nishio; Katsutoshi Yamasaki; Takuya Maede; Tamaki Orita; Noriyuki Sueyoshi; Machiko Kita; Masahiro Toyokawa; Isao Nishi; Masahiro Akagi; Takefumi Higuchi; Tomomi Kofuku; Isako Nakai; Tamotsu Ono; Koichi Shimakawa; Yoshie Hikita; Kunihiko Moro; Kaneyuki Kida; Masanobu Oohama; Yasunao Wada; Toru Tobe; Toshinori Kamisako; Yuji Tanaka
Journal:  J Infect Chemother       Date:  2018-02-01       Impact factor: 2.211

5.  Complete genome sequence of the African dairy isolate Streptococcus infantarius subsp. infantarius strain CJ18.

Authors:  Christoph Jans; Rainer Follador; Christophe Lacroix; Leo Meile; Marc J A Stevens
Journal:  J Bacteriol       Date:  2012-04       Impact factor: 3.490

6.  Biochemical and genetic evidence that Enterococcus faecium L50 produces enterocins L50A and L50B, the sec-dependent enterocin P, and a novel bacteriocin secreted without an N-terminal extension termed enterocin Q.

Authors:  L M Cintas; P Casaus; C Herranz; L S Hâvarstein; H Holo; P E Hernández; I F Nes
Journal:  J Bacteriol       Date:  2000-12       Impact factor: 3.490

7.  Isolation and characterization of pediocin L50, a new bacteriocin from Pediococcus acidilactici with a broad inhibitory spectrum.

Authors:  L M Cintas; J M Rodriguez; M F Fernandez; K Sletten; I F Nes; P E Hernandez; H Holo
Journal:  Appl Environ Microbiol       Date:  1995-07       Impact factor: 4.792

Review 8.  Safety assessment of dairy microorganisms: Streptococcus thermophilus.

Authors:  Christine Delorme
Journal:  Int J Food Microbiol       Date:  2007-08-22       Impact factor: 5.277

Review 9.  The role of Pneumococcal vaccine.

Authors:  Fulvio Braido; Michele Bellotti; Andrea De Maria; Mario Cazzola; Giorgio Walter Canonica
Journal:  Pulm Pharmacol Ther       Date:  2008-04-25       Impact factor: 3.410

10.  Reappraisal of the taxonomy of the Streptococcus bovis/Streptococcus equinus complex and related species: description of Streptococcus gallolyticus subsp. gallolyticus subsp. nov., S. gallolyticus subsp. macedonicus subsp. nov. and S. gallolyticus subsp. pasteurianus subsp. nov.

Authors:  Laurent Schlegel; Francine Grimont; Elisabeth Ageron; Patrick A D Grimont; Anne Bouvet
Journal:  Int J Syst Evol Microbiol       Date:  2003-05       Impact factor: 2.747

View more
  2 in total

Review 1.  Toward understanding the signals of bacteriocin production by Streptococcus spp. and their importance in current applications.

Authors:  Laura García-Curiel; Ma Del Rocío López-Cuellar; Adriana Inés Rodríguez-Hernández; Norberto Chavarría-Hernández
Journal:  World J Microbiol Biotechnol       Date:  2021-01-04       Impact factor: 3.312

Review 2.  Bacteriocins Produced by LAB Isolated from Cheeses within the Period 2009-2021: a Review.

Authors:  Lorena Trejo-González; Ana-Estefanía Gutiérrez-Carrillo; Adriana-Inés Rodríguez-Hernández; Ma Del Rocío López-Cuellar; Norberto Chavarría-Hernández
Journal:  Probiotics Antimicrob Proteins       Date:  2021-08-03       Impact factor: 5.265

  2 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.