Literature DB >> 31517566

De novo phosphatidylcholine synthesis is required for autophagosome membrane formation and maintenance during autophagy.

Gabriela Andrejeva1, Sharon Gowan2, Gigin Lin1,3, Anne-Christine Lf Wong Te Fong1, Elham Shamsaei1, Harry G Parkes1, James Mui2, Florence I Raynaud2, Yasmin Asad2, Gema Vizcay-Barrena4, Joanna Nikitorowicz-Buniak5, Melanie Valenti2, Louise Howell6, Roland A Fleck4, Lesley-Ann Martin5, Vladimir Kirkin2, Martin O Leach1, Yuen-Li Chung1.   

Abstract

Macroautophagy/autophagy can enable cancer cells to withstand cellular stress and maintain bioenergetic homeostasis by sequestering cellular components into newly formed double-membrane vesicles destined for lysosomal degradation, potentially affecting the efficacy of anti-cancer treatments. Using 13C-labeled choline and 13C-magnetic resonance spectroscopy and western blotting, we show increased de novo choline phospholipid (ChoPL) production and activation of PCYT1A (phosphate cytidylyltransferase 1, choline, alpha), the rate-limiting enzyme of phosphatidylcholine (PtdCho) synthesis, during autophagy. We also discovered that the loss of PCYT1A activity results in compromised autophagosome formation and maintenance in autophagic cells. Direct tracing of ChoPLs with fluorescence and immunogold labeling imaging revealed the incorporation of newly synthesized ChoPLs into autophagosomal membranes, endoplasmic reticulum (ER) and mitochondria during anticancer drug-induced autophagy. Significant increase in the colocalization of fluorescence signals from the newly synthesized ChoPLs and mCherry-MAP1LC3/LC3 (microtubule-associated protein 1 light chain 3) was also found on autophagosomes accumulating in cells treated with autophagy-modulating compounds. Interestingly, cells undergoing active autophagy had an altered ChoPL profile, with longer and more unsaturated fatty acid/alcohol chains detected. Our data suggest that de novo synthesis may be required to increase autophagosomal ChoPL content and alter its composition, together with replacing phospholipids consumed from other organelles during autophagosome formation and turnover. This addiction to de novo ChoPL synthesis and the critical role of PCYT1A may lead to development of agents targeting autophagy-induced drug resistance. In addition, fluorescence imaging of choline phospholipids could provide a useful way to visualize autophagosomes in cells and tissues. ABBREVIATIONS: AKT: AKT serine/threonine kinase; BAX: BCL2 associated X, apoptosis regulator; BECN1: beclin 1; ChoPL: choline phospholipid; CHKA: choline kinase alpha; CHPT1: choline phosphotransferase 1; CTCF: corrected total cell fluorescence; CTP: cytidine-5'-triphosphate; DCA: dichloroacetate; DMEM: dulbeccos modified Eagles medium; DMSO: dimethyl sulfoxide; EDTA: ethylenediaminetetraacetic acid; ER: endoplasmic reticulum; GDPD5: glycerophosphodiester phosphodiesterase domain containing 5; GFP: green fluorescent protein; GPC: glycerophosphorylcholine; HBSS: hanks balances salt solution; MAP1LC3/LC3: microtubule associated protein 1 light chain 3; LPCAT1: lysophosphatidylcholine acyltransferase 1; LysoPtdCho: lysophosphatidylcholine; MRS: magnetic resonance spectroscopy; MTORC1: mechanistic target of rapamycin kinase complex 1; PCho: phosphocholine; PCYT: choline phosphate cytidylyltransferase; PLA2: phospholipase A2; PLB: phospholipase B; PLC: phospholipase C; PLD: phospholipase D; PCYT1A: phosphate cytidylyltransferase 1, choline, alpha; PI3K: phosphoinositide-3-kinase; pMAFs: pancreatic mouse adult fibroblasts; PNPLA6: patatin like phospholipase domain containing 6; Pro-Cho: propargylcholine; Pro-ChoPLs: propargylcholine phospholipids; PtdCho: phosphatidylcholine; PtdEth: phosphatidylethanolamine; PtdIns3P: phosphatidylinositol-3-phosphate; RPS6: ribosomal protein S6; SCD: stearoyl-CoA desaturase; SEM: standard error of the mean; SM: sphingomyelin; SMPD1/SMase: sphingomyelin phosphodiesterase 1, acid lysosomal; SGMS: sphingomyelin synthase; WT: wild-type.

Entities:  

Keywords:  Autophagosome; CTP:phosphocholine cytidylyltransferase; autophagy; choline phospholipids; phosphatidylcholine; propargylcholine

Year:  2019        PMID: 31517566      PMCID: PMC7469489          DOI: 10.1080/15548627.2019.1659608

Source DB:  PubMed          Journal:  Autophagy        ISSN: 1554-8627            Impact factor:   16.016


Introduction

Cytoprotective macroautophagy, henceforth referred to as autophagy, is implicated in resistance to a wide range of anticancer treatments by means of mitigating cellular stress [1,2] inflicted by therapy-induced nutrient or growth factor deprivation, energy depletion, hypoxia, accumulation of protein aggregates, damage to organelles or DNA and reactive oxygen species production [3]. It is a highly regulated catabolic process, whereby parts of the cytosol and cellular organelles, including protein aggregates, damaged or superfluous organelles or pathogens, are sequestered into the double-membrane vesicles, called autophagosomes, and delivered to lysosomes for degradation. The resulting “nutrients” are released into the cytosol to support energy metabolism, biosynthesis and cellular homeostasis. Here we investigate the metabolic impact of anti-cancer treatment, starvation and Tat-Beclin 1 induced autophagy in cancer cells. Autophagy is initiated by the ULK1/2 (unc-51 like autophagy activating kinase 1/2) signaling as well as the activation of the PIK3C3/Vps34 (phosphatidylinositol 3-kinase catalytic subunit type 3) complex, containing BECN1/Beclin-1, which assembles at the phagophore nucleation site to produce phosphatidylinositol-3-phosphate (PtdIns3P) [4]. For example, PtdIns3P contributes to the formation of an ER-associated cup-shaped membrane structure, the omegasome, which acts as a platform for the orchestrated recruitment of other autophagy proteins [5]. This leads to the phagophore expansion at least in part due to the lipidation, and hence membrane association, of the autophagosome marker LC3. The current consensus is that the autophagosome assembly takes place at the ER or, more specifically, ER-mitochondrial junctions during starvation-induced autophagy [5-10]. Until the phagophore detaches from the ER, the phospholipids needed for its expansion are thought to be synthesized locally at the omegasome [11]. It is thought that subsequent autophagosome expansion is driven by vesicles derived from the Golgi and plasma membrane via recycling endosomes [11-13]. In the final stage the phagophore seals to form the autophagosome, which then fuses with the lysosome. While the source of the autophagosomal membrane during starvation-induced autophagy has been subject to much recent research, the metabolism of major cellular phospholipids, PtdCho and PtdEth (phosphatidylethanolamine) is not well understood. PtdEth has an established role in autophagy as the lipid anchor for LC3, which is required for the elongation of the phagophore and is thought to positively regulate the autophagic flux [14-16]. The most abundant phospholipids in eukaryotic cell membranes are ChoPLs, which are essential for membrane structure and cellular function. Altered choline metabolism is a metabolic feature of oncogenesis and tumor progression [17]. ChoPLs comprise ester- or ether-linked PtdCho, sphingomyelin (SM) and ester- or ether-linked lysophosphatidylcholines (LysoPtdCho), with PtdChos accounting for more than 50%, SMs contributing a further 5–20%, and LysoPtdChos about 3% of all cellular membrane phospholipids [18,19]. The Kennedy pathway accounts for the bulk of the ChoPL PtdCho biosynthesis (about 80% of all ChoPLs), with PCYT (choline phosphate cytidylyltransferase) being the rate-limiting enzyme and its predominant isoform being encoded by the PCYT1A gene (Figure 1A) [20]. Some PtdChos can also be synthesized from LysoPtdCho by Lands cycle enzymes, LPCATs (lysophosphatidylcholine acyltransferases) [21] (Figure 1A). PtdCho can be used for downstream synthesis of LysoPtdCho and SMs.
Figure 1.

Changes in choline metabolism in cell models of autophagy. (A) A simplified diagram of cellular choline metabolism. Key metabolites are shown in gray boxes, enzymes of choline phospholipid metabolism are shown in red. (B) Western blots of autophagy marker LC3B in 20 μM PI-103 (6, 24, 96 and 192 h) or 75 mM DCA (24 h) or starvation (6 h)-treated HCT116 BAX-ko cells, in 75 mM DCA (24 h) and starvation (6 h)-treated HCT116 WT, and in 100 μM PI-103 (24 h)-treated HT29 cells. TUBA was used as a loading control. (C) Western blot of autophagy marker LC3B, apoptosis marker cleaved PARP (cPARP) and CASP3, and p-RPS6 in HCT116 BAX-ko cells treated with 50 μM Tat-Beclin 1 or 50 μM Tat-Scramble control for 6 h. TUBA was used as a loading control. (D) Summary of changes in cellular choline metabolites and cholesterol in drug- or starvation-induced autophagy models. Data shown are means of fold changes and presented as a color-coded heat map for different treatment groups compared with their respective controls. (E) Fold changes in [1,2-13C]choline metabolites in HCT116 BAX-ko cells treated with 20 μM PI-103 (24 h) or 75 mM DCA (24 h). Normal medium was substituted for medium containing [1,2-13C]choline instead of unlabeled choline in the last 6 h of treatment. Data expressed as mean ± SEM, n = 3 in each group. (F) ChoPL level as measured by MRS versus LC3B-II expression as measured by western blot densitometry in HCT116 cell autophagy models. Data expressed as fold change (treated/control). Statistically significant changes are indicated: *p < 0.05, **p < 0.01, ***p < 0.001.

Changes in choline metabolism in cell models of autophagy. (A) A simplified diagram of cellular choline metabolism. Key metabolites are shown in gray boxes, enzymes of choline phospholipid metabolism are shown in red. (B) Western blots of autophagy marker LC3B in 20 μM PI-103 (6, 24, 96 and 192 h) or 75 mM DCA (24 h) or starvation (6 h)-treated HCT116 BAX-ko cells, in 75 mM DCA (24 h) and starvation (6 h)-treated HCT116 WT, and in 100 μM PI-103 (24 h)-treated HT29 cells. TUBA was used as a loading control. (C) Western blot of autophagy marker LC3B, apoptosis marker cleaved PARP (cPARP) and CASP3, and p-RPS6 in HCT116 BAX-ko cells treated with 50 μM Tat-Beclin 1 or 50 μM Tat-Scramble control for 6 h. TUBA was used as a loading control. (D) Summary of changes in cellular choline metabolites and cholesterol in drug- or starvation-induced autophagy models. Data shown are means of fold changes and presented as a color-coded heat map for different treatment groups compared with their respective controls. (E) Fold changes in [1,2-13C]choline metabolites in HCT116 BAX-ko cells treated with 20 μM PI-103 (24 h) or 75 mM DCA (24 h). Normal medium was substituted for medium containing [1,2-13C]choline instead of unlabeled choline in the last 6 h of treatment. Data expressed as mean ± SEM, n = 3 in each group. (F) ChoPL level as measured by MRS versus LC3B-II expression as measured by western blot densitometry in HCT116 cell autophagy models. Data expressed as fold change (treated/control). Statistically significant changes are indicated: *p < 0.05, **p < 0.01, ***p < 0.001. The relative input of different organelles and the plasma membrane as well as de novo synthesis of phospholipids may vary depending on the initiating signal for autophagy and the nutrients available to the cells. Furthermore, replenishing phospholipid sources for autophagic membrane synthesis is required for their continual functioning and for ensuring autophagy-dependent survival during anti-cancer treatment. Consistently, neutral lipid stores were shown to contribute to autophagic membrane phospholipid formation during starvation-induced autophagy [22]. Metabolic stress is a potent physiological stimulus of autophagy, with MTORC1 (mechanistic target of rapamycin kinase complex 1) being a major negative regulator of autophagy [23]. Starvation using a medium lacking amino acids and growth factors has been the system of choice for autophagy studies; however, it may not reflect the actual conditions found in the tumor microenvironment. In this study, we examined choline phospholipid metabolism in cancer cells during autophagy under both nutrient-poor and nutrient-rich conditions. We used anticancer agents dichloroacetate (DCA), a pyruvate dehydrogenase kinase inhibitor currently in clinical investigation as antineoplastic treatment [24] that we had previously shown to induce autophagy [25], and PI-103, a dual phosphoinositide 3-kinase (PI3K)-AKT (AKT serine/threonine kinase) and MTOR inhibitor that also induces cytoprotective autophagy in drug-resistant glioma and myeloma [26,27], to initiate autophagy in well-nourished conditions. We starved cells in Hanks Balanced Salt Solution (HBSS) to simulate nutrient-poor conditions. We had previously shown that DCA, PI-103 or starvation in HBSS induce autophagy in human colorectal carcinoma wild-type (WT) HCT116, HT29, and the apoptosis-resistant HCT116 BAX (BCL2 associated X, apoptosis regulator)-knockout (ko) cells, which is associated with MTORC1 inhibition [25,28,29]. We also treated HCT116 BAX-ko cells with Tat-Beclin 1, an autophagy-inducing peptide derived from BECN1, to induce autophagy independently of MTORC1 [30]. With a novel approach to directly image newly synthesized ChoPLs, we showed their incorporation into autophagosomal membranes. We found increased expression of the rate-limiting enzyme of PtdCho synthesis, PCYT1A, in cancer cells undergoing autophagy and showed that the loss of its activity results in the inability of cells to maintain autophagosome biogenesis. Finally, using targeted mass spectrometry, we found that the increased level of choline phospholipids in autophagy was accompanied by an altered profile of choline phospholipid species.

Results

Cancer cells undergoing autophagy showed increase in choline phospholipids and decrease in phosphocholine levels

Consistent with our previous findings [25,28], autophagy was induced in HCT116 WT, HCT116 BAX-ko and HT29 cells with DCA, PI-103 and starvation in HBSS as indicated by an elevated expression of the autophagy marker LC3B-II (Figure 1B). Increased expression of LC3B-II with minimal apoptosis was also observed in Tat-Beclin 1-treated HCT116 BAX-ko cells, with no effect on MTORC1, as indicated by unchanged phosphorylation status of MTORC1 downstream effector RPS6 (ribosomal protein S6) when compared to Tat-Scramble control (Figure 1C). Steady-state magnetic resonance spectroscopy (1H-MRS) measurements (Figure S1A and B) revealed altered levels of intracellular choline metabolites in our autophagy models. The cellular level of phosphocholine (PCho) was reduced in all treatments (Figure 1D and Table S1). glycerophosphorylcholine (GPC) was reduced with 192 h of PI-103 treatment in HCT116 BAX-ko cells, increased with 24 h DCA treatment in both HCT116 BAX-ko and HCT116 WT cells but unchanged in the remaining autophagy models (Figure 1D and Table S1). Despite the reduced levels of PCho, ChoPLs were increased in all treatment groups (Figure 1D and Table S1). Our data suggested that autophagy in colorectal carcinoma cells was accompanied by alterations in the choline metabolic flux. We also measured the cellular levels of cholesterol, as it accounts for about 30% of total membrane lipids [31]. We observed an increase in total cholesterol in drug-treatment induced autophagy but not in Tat-Beclin 1 treatment or starvation models of autophagy (Figure 1D and Table S1), implying that an increase in ChoPLs might be a more universal marker of autophagy.

Increased choline phospholipid levels in cancer cells undergoing drug-induced autophagy were due to de novo synthesis

To establish whether the increased level of ChoPLs observed in autophagic cells under nutrient-rich conditions was due to an increase in the de novo synthesis, we traced [1,2-13C]choline metabolites by 13C-MRS (Figure S1C and D). Autophagy was induced in HCT116 BAX-ko cells with 24 h PI-103 or DCA treatment, and in the last 6 h of the treatment the medium was substituted for that containing [1,2-13C]choline instead of the unlabeled choline. The selection of this timing ensured that de novo ChoPL synthesis was measured after the onset of autophagy for both treatments (Figure S2). 13C-labeled ChoPLs were increased in PI-103-treated and DCA-treated HCT116 BAX-ko cells when compared with controls (Figure 1E). 13C-labeled PCho was reduced following both treatments (Figure 1E). No 13C-labeled GPC was detected during this time-course. These results indicated that de novo ChoPLs synthesis from choline was increased during drug-induced autophagy. We next sought to understand the relationship between the levels of ChoPLs and LC3B-II since a positive correlation between LC3-II and the number of autophagosomes has been established [14,32]. Linear regression analysis of the fold increase in cellular ChoPLs, as measured by MRS, versus the fold increase in LC3B-II, as measured by western blot, showed a significant (p = 0.04) positive (R2 = 0.55) relationship between the two (Figure 1F). However, ChoPLs, and specifically the major PtdCho species, are intermediary metabolites involved in other metabolic processes as well. Thus, with DCA-induced autophagy, there was a large increase in the PtdCho breakdown product GPC, which was specific for the DCA treatment, but not in other autophagy models, suggesting that this effect was unrelated to autophagy (Figure 1D). We observed a large increase in LC3B-II in DCA-treated cells, and indeed, our data from 13C-choline tracing (Figure 1E) indicated highly elevated de novo synthesis of ChoPLs. However, the steady-state level of ChoPLs (Figure 1D) was increased to a much lesser extent, which might be a result of the net change in increased PtdCho synthesis and breakdown of PtdCho to GPC. We therefore used 13C-choline tracing data for DCA treatment for Figure 1F.

Newly synthesized choline phospholipids contributed to the phagophore membrane

We next imaged the metabolic fate of the newly synthesized ChoPLs in cells undergoing autophagy to determine if they contribute to the newly synthesized membrane phospholipids in the forming and expanding phagophores, or replenish ChoPLs in other organelles, such as the ER and mitochondria, which supply membranes for the growing phagophores. We used propargylcholine (Pro-Cho), a synthetic analog of choline, which is converted via the Kennedy pathway to propargyl-PtdCho and all other classes of ChoPLs, albeit its incorporation into SM and ether PtdCho is somewhat slower [33]. Pro-Cho addition does not alter the relative abundance of other membrane phospholipids [33]. Treatment media were supplemented with Pro-Cho at the start of the 6 h or 24 h treatment with PI-103 in HCT116 BAX-ko and HT29 cells, and in the last 6 h of 24 h DCA treatment of HCT116 BAX-ko cells, to account for the temporal differences in autophagy onset between DCA and PI-103 treatments (Figure S2). Fluorescent Pro-ChoPL staining of the nuclear envelope and structures consistent with the ER and mitochondria was visible in both control and in PI-103- or DCA-induced HCT116 BAX-ko and HT29 cells undergoing autophagy (Figure 2A). In addition, Pro-ChoPLs also enclosed and localized to vesicular structures that are likely to be autophagic vesicles (Figure 2A).
Figure 2.

Increased synthesis and vacuolar appearance of Pro-Cho-labeled phospholipids in drug-induced autophagic cells. (A) Imaging of Pro-ChoPLs in 20 μM PI-103 (24 h and 6 h)-treated HCT116 BAX-ko cells, 100 μM PI-103 (24 h)-treated HT29 cells and in 75 mM DCA (24 h)-treated HCT116 BAX-ko cells. Pro-Cho was added together with the PI-103 treatment but in the last 6 h of DCA treatment to adjust for the difference in the timing of autophagy onset between the two treatments (Figure S2). The cells were then stained with Alexa Fluor 647-azide. Magenta arrows indicate potential autophagosomes or autolysosomes as vesicles enclosed in Pro-ChoPL membranes, cyan arrows indicate potential autophagosomes with autophagic cargo containing Pro-ChoPLs. Scale bar 20 μm. (B) Fold changes in ChoPL level in drug-induced autophagy as measured by 1H-MRS (for PI-103 treatments) and 13C-MRS (for DCA treatment) in comparison to corrected total cell fluorescence as obtained by propargyl-choline incorporation and staining. Data expressed as mean ± SEM, min n = 3 in each group. Statistically significant changes are indicated: *p < 0.05, **p < 0.01, ***p < 0.001.

Increased synthesis and vacuolar appearance of Pro-Cho-labeled phospholipids in drug-induced autophagic cells. (A) Imaging of Pro-ChoPLs in 20 μM PI-103 (24 h and 6 h)-treated HCT116 BAX-ko cells, 100 μM PI-103 (24 h)-treated HT29 cells and in 75 mM DCA (24 h)-treated HCT116 BAX-ko cells. Pro-Cho was added together with the PI-103 treatment but in the last 6 h of DCA treatment to adjust for the difference in the timing of autophagy onset between the two treatments (Figure S2). The cells were then stained with Alexa Fluor 647-azide. Magenta arrows indicate potential autophagosomes or autolysosomes as vesicles enclosed in Pro-ChoPL membranes, cyan arrows indicate potential autophagosomes with autophagic cargo containing Pro-ChoPLs. Scale bar 20 μm. (B) Fold changes in ChoPL level in drug-induced autophagy as measured by 1H-MRS (for PI-103 treatments) and 13C-MRS (for DCA treatment) in comparison to corrected total cell fluorescence as obtained by propargyl-choline incorporation and staining. Data expressed as mean ± SEM, min n = 3 in each group. Statistically significant changes are indicated: *p < 0.05, **p < 0.01, ***p < 0.001. The corrected total cell fluorescence (CTCF) measurements of Pro-ChoPLs were higher in the drug-induced autophagic cells when compared to their respective controls (Figure 2B). These values were in a good agreement with the fold increases in ChoPLs measured by 1H-MRS (for HT29 cells) and 13C-MRS (for HCT116 BAX-ko cells) (Figure 2B). The fold increases in CTCF are mostly likely reflecting the increases in PtdCho levels [33], as it is the most abundant class of choline phospholipid (about 80% of all ChoPLs) present in mammalian cell membranes. To determine the precise localization of the newly synthesized ChoPLs in drug-induced autophagy, HCT116 BAX-ko cells were labeled with Pro-Cho as above and the position of Pro-ChoPLs was detected using immunogold labeling and imaging by transmission electron microscopy. Gold particles were localized to the nuclear envelope, the ER, mitochondria, plasma membrane and small vesicular structures in control cells, whereas the nucleus and areas of cytosol without membrane structures were largely devoid of gold label (Figure 3). More gold label was observed in both PI-103 and DCA-treated cells when compared to controls and they were visible on the membranes of autophagic vacuoles, as well as in digested material inside the autolysosomes (Figure 3). Furthermore, we also observed electron-dense round structures with gold-labeled Pro-ChoPLs, consistent with lipid droplets, in close proximity to or inside autophagosomes (Figure 3). These may reflect lipophagy and/or the transfer of Pro-ChoPLs between the lipid droplets and the autophagic structures [22,34]. We concluded that the newly synthesized ChoPLs contribute to the phagophore and, subsequently, autolysosomal membranes.
Figure 3.

Localization of Pro-ChoPLs during drug-induced autophagy. Imaging of Pro-ChoPLs in 20 μM PI-103 (24 h and 6 h), and in 75 mM DCA (24 h)-treated HCT116 BAX-ko cells by immuno-electron microscopy. Pro-Cho was added together with the vehicle- or PI-103 treatment, but in the last 6 h of DCA treatment to adjust for the difference in the timing of autophagy onset between the two treatments (Figure S2). No Pro-Cho was added for the negative, vehicle-treated control. The cells were fixed, sectioned and Pro-ChoPLs reacted with biotin-azide. The sections were incubated with anti-biotin antibodies and protein A gold, counterstained with uranyl acetate and imaged by transmission electron microscopy. Arrows indicate various cellular structures: AV, autophagic vacuole; ER, endoplasmic reticulum; ICS, intercellular space; Mt, mitochondrion; NE, nuclear envelope; Nu, nucleus; PM, plasma membrane; Ve, vesicle.

Localization of Pro-ChoPLs during drug-induced autophagy. Imaging of Pro-ChoPLs in 20 μM PI-103 (24 h and 6 h), and in 75 mM DCA (24 h)-treated HCT116 BAX-ko cells by immuno-electron microscopy. Pro-Cho was added together with the vehicle- or PI-103 treatment, but in the last 6 h of DCA treatment to adjust for the difference in the timing of autophagy onset between the two treatments (Figure S2). No Pro-Cho was added for the negative, vehicle-treated control. The cells were fixed, sectioned and Pro-ChoPLs reacted with biotin-azide. The sections were incubated with anti-biotin antibodies and protein A gold, counterstained with uranyl acetate and imaged by transmission electron microscopy. Arrows indicate various cellular structures: AV, autophagic vacuole; ER, endoplasmic reticulum; ICS, intercellular space; Mt, mitochondrion; NE, nuclear envelope; Nu, nucleus; PM, plasma membrane; Ve, vesicle.

Fluorescence signals from the newly synthesized choline phospholipids colocalized with mCherry-LC3 in pMAFs (pancreatic mouse adult fibroblasts) undergoing drug-induced autophagy

To further corroborate the colocalization of the newly synthesized ChoPLs with autophagosomes, pMAFs expressing mCherry-GFP-LC3 were labeled with Pro-Cho, and the degree of colocalization of Pro-ChoPLs with LC3 was detected using confocal microscopy. Increased mCherry-LC3 signal was found in pMAFs cells treated with bafilomycin A1, Torin-1 or PI-103 when compared with dimethyl sulfoxide (DMSO) control, confirming the induction of autophagy and autophagosome accumulation (Figure S3A). No green fluorescence signal was observed for GFP, due to the steps in the click chemistry reaction that involve a very low pH which led to the quenching of GFP signal. Hence, only red florescence signals from mCherry-LC3 were observed (Figure S3A). In order to confirm the specificity of the Pro-Cho fluorescence probe, a negative control was utilized in which click chemistry was performed on pMAFs cells using the Alexa Fluor 350-azide probe without prior incubation with Pro-Cho. No signal from the Alexa Fluor 350-azide probe was observed (Figure S3A). This experiment confirmed the specificity of the Alexa Fluor 350 probe and the absence of its interference with the mCherry signal. Pro-ChoPL signal intensities were found to increase in cells treated with bafilomycin A1, Torin-1 or PI-103 when compared to the DMSO-treated control (Figure S3B). The labeled Pro-ChoPLs (blue) signals were pseudo-colored to green using the Zeiss software on the microscope, in order to enhance the contrast against the red signal (Figure. 4A and S3B). Significant increase in the colocalization of Pro-ChoPLs and mCherry-LC3 signals was also found in treated cells when compared with DMSO control (Figure 4 and S3B), confirming the colocalization of the Pro-ChoPLs and the mCherry-LC3 signals upon treatment with autophagy-modulating drugs. We concluded that the colocalization of the signals from the newly synthesized Pro-ChoPLs and mCherry-LC3 increased significantly following autophagy induction and the autophagosome accumulation.
Figure 4.

Colocalization of Pro-ChoPLs and mCherry-LC3 fluorescence signals in drug-induced autophagic mCherry-GFP-LC3 pMAFs. (A) Imaging of Pro-ChoPLs and mCherry-LC3 in mCherry-GFP-LC3 pMAF cells following 6 h of 250 nM Torin-1, 200 nM bafilomycin A1, 20 µM PI-103 or DMSO treatment. These pMAF cells were treated in the last 6 h before the end of 24 h incubation with Pro-Cho and then stained with Alexa Fluor 350-azide. The Pro-ChoPL signals were pseudo-colored to green using the Zeiss software on the microscope, in order to enhance the contrast against the red signal. The yellow signals (colocalization of the Pro-ChoPLs and mCherry-LC3 staining) were artificially colored to white using the software on the microscope, in order to enhance the contrast against the red and green signals. Scale bar: 20 μm. (B) Colocalization Pro-ChoPLs and mCherry-LC3 showed in a scatterplot (pixels in quadrant 3) and fluorescence image (white signals) in DMSO- or bafilomycin A1-treated mCherry-GFP-LC3 pMAFs. (C) The colocalization coefficient ch1-T1 and colocalization coefficient ch2-T2 in mCherry-GFP-LC3 pMAF cells following various treatments. Bars represent mean ± SEM. ****P < 0.0001; *P < 0.05 when compared to DMSO controls.

Colocalization of Pro-ChoPLs and mCherry-LC3 fluorescence signals in drug-induced autophagic mCherry-GFP-LC3 pMAFs. (A) Imaging of Pro-ChoPLs and mCherry-LC3 in mCherry-GFP-LC3 pMAF cells following 6 h of 250 nM Torin-1, 200 nM bafilomycin A1, 20 µM PI-103 or DMSO treatment. These pMAF cells were treated in the last 6 h before the end of 24 h incubation with Pro-Cho and then stained with Alexa Fluor 350-azide. The Pro-ChoPL signals were pseudo-colored to green using the Zeiss software on the microscope, in order to enhance the contrast against the red signal. The yellow signals (colocalization of the Pro-ChoPLs and mCherry-LC3 staining) were artificially colored to white using the software on the microscope, in order to enhance the contrast against the red and green signals. Scale bar: 20 μm. (B) Colocalization Pro-ChoPLs and mCherry-LC3 showed in a scatterplot (pixels in quadrant 3) and fluorescence image (white signals) in DMSO- or bafilomycin A1-treated mCherry-GFP-LC3 pMAFs. (C) The colocalization coefficient ch1-T1 and colocalization coefficient ch2-T2 in mCherry-GFP-LC3 pMAF cells following various treatments. Bars represent mean ± SEM. ****P < 0.0001; *P < 0.05 when compared to DMSO controls.

Increased expression of the active membrane-bound form of PCYT1A was associated with increased ChoPLs synthesis in autophagic cells

To determine the mechanisms responsible for the observed reduction in PCho and increase in PtdCho during autophagy, we examined the expression level of the main isoform of choline kinase – CHKA (choline kinase alpha), the first enzyme in the Kennedy pathway of PtdCho synthesis. The expression of CHKA was reduced in both HCT116 BAX-ko and HT29 cells treated with PI-103 for 24 h, but unchanged in 24 h DCA-treated and 6 h starved HCT116 BAX-ko cells (Figure 5A). These findings were consistent with previous reports of reduced PCho levels and reduced choline kinase expression in PI-103-treated cancer cells [35,36].
Figure 5.

Changes in CHKA and PCYT1A expression and activation in autophagy models. (A) Western blots of CHKA, the main CHK isoform, in 20 μM PI-103 (24 h)-, 75 mM DCA (24 h)-treated and in 6 h starved (in HBSS) HCT116 BAX-ko cells and in 100 μM PI-103 (24 h)-treated HT29 cells, TUBA was used as a loading control. (B) Choline kinase activity measurements: 31P NMR of the extracted cytoplasm of vehicle (24 h)-treated HCT116 BAX-ko cells after addition of exogenous choline, ATP and MgCl2 at the start and at the end of the measurement. (C) The increase of PCho peak integral over time in the soluble HCT116 BAX-ko cell lysates after the addition of exogenous choline, ATP, and MgCl2. The cells were lysed after 24 h of treatment with DMSO control or 20 μM PI-103. A linear fit to the data yields the rate constant. Data expressed as mean ± SEM, n = 3. (D) Western blots of PCYT1A in HCT116 BAX-ko cells following 20 μM PI-103 (24 h), 75mM DCA (24 h) or HBSS (6 h; starved) treatment, and in HT29 cells following 100 μM PI-103 (24 h) treatment. TUBA was used as loading control.

Changes in CHKA and PCYT1A expression and activation in autophagy models. (A) Western blots of CHKA, the main CHK isoform, in 20 μM PI-103 (24 h)-, 75 mM DCA (24 h)-treated and in 6 h starved (in HBSS) HCT116 BAX-ko cells and in 100 μM PI-103 (24 h)-treated HT29 cells, TUBA was used as a loading control. (B) Choline kinase activity measurements: 31P NMR of the extracted cytoplasm of vehicle (24 h)-treated HCT116 BAX-ko cells after addition of exogenous choline, ATP and MgCl2 at the start and at the end of the measurement. (C) The increase of PCho peak integral over time in the soluble HCT116 BAX-ko cell lysates after the addition of exogenous choline, ATP, and MgCl2. The cells were lysed after 24 h of treatment with DMSO control or 20 μM PI-103. A linear fit to the data yields the rate constant. Data expressed as mean ± SEM, n = 3. (D) Western blots of PCYT1A in HCT116 BAX-ko cells following 20 μM PI-103 (24 h), 75mM DCA (24 h) or HBSS (6 h; starved) treatment, and in HT29 cells following 100 μM PI-103 (24 h) treatment. TUBA was used as loading control. To examine how the reduction of CHKA protein level with PI-103 treatment affects the rate of PCho synthesis, choline kinase activity was assayed in HCT116 BAX-ko cell lysates using 31P-MRS after the addition of exogenous choline, ATP and MgCl2 (Figure 5B). Choline kinase activity was lower (58 ± 6%, p = 0.002) in lysates of HCT116 BAX-ko cells treated with PI-103 for 24 h (0.86 ± 0.06 nmol min−1 per 106 cells) when compared with vehicle-treated controls (1.50 ± 0.07 nmol min−1 per 106 cells) (Figure 5C), which was consistent with the decreased PCho level in PI-103-treated cells (Figure 1D). Increased de novo ChoPL synthesis was found in cells with active autophagy, despite decreases in PCho and CHKA expression and activity. Hence, our data suggested that the observed increase of ChoPLs in cells undergoing drug-induced autophagy was not dependent on CHKA expression or activity, consistent with it not being rate-limiting in the biosynthesis of PtdCho, the most abundant ChoPL species [37]. The rate-limiting enzyme in the PtdCho biosynthesis pathway, PCYT, catalyzes the production of CDP-choline from cytidine-5ʹ-triphosphate (CTP) and PCho [37]. We saw increased expression of the main isoform of PCYT, PCYT1A, in all our treatment groups when compared to controls (Figure 5D and S4A). The main isoform, PCYT1A, becomes activated when the inactive cytosolic form associates with cellular membranes [38]. When the membrane fraction of PCYT1A was isolated from the cytosolic fraction using digitonin permeabilization [39], an increase in the expression of the active, membrane-bound form of PCYT1A was seen in all of our autophagy models (Figure S4B). These data indicate that higher levels of PCYT1A in its activated form are expressed in autophagic cells.

Loss of PCYT1A activity abrogated autophagy

To study the cellular effect of ChoPLs and PCYT1A activity on the autophagy process, we used the Chinese hamster ovary (Cho)-derived MT58 cell line, which contains a temperature-sensitive inactivating mutation in PCYT1A [40]. The wild-type CHO-K1 cells have the same PCYT1A activity at both 33°C and 40°C, whereas raising the temperature from 33°C to 40°C causes the loss of PCYT1A protein stability and function in CHO MT58 cells, allowing us to examine the effect of acute loss of PCYT1A on the autophagy process (Figure 6A). There was no difference in the 4 d GI50 for PI-103 between the two cell lines (MT58: 270 ± 30 nM; CHO-K1: 290 ± 20 nM). MT58 and wild-type CHO-K1 cells were treated for 24 h with 11.4 μM PI-103 to achieve ca. 70% reduction in cell number when compared to control cells at 33°C, and ca. 50% reduction at 40°C. The increased level of LC3B-II confirmed the induction of autophagy in both cell lines with PI-103 treatment at both 33°C and 40°C (Figure 6B). The elevated autophagy marker LC3B-II in vehicle-treated MT58 cells at 40°C is likely to be a stress response to the loss of PCYT1A activity (Figure 6B). Unlike the CHO-K1 cells, MT58 cells did not have increased LC3B-II levels with PI-103 treatment at 40°C when compared to 33°C (Figure 6B).
Figure 6.

PI-103-induced autophagy and ChoPLs in cells with impaired PCYT1A activity. (A) Schematic of PCYT1A activity in wild type Cho cell line CHO-K1 and in MT58 cells, that contain a temperature sensitive mutation in PCYT1A, at the permissive temperature of 33°C and the restrictive temperature of 40°C. (B) Western blots of LC3B autophagy marker in DMSO (24 h)- and in 11.4 μM PI-103 (24 h)-treated CHO-K1 and MT58 cells at 33°C and 40°C. TUBA was used as a loading control. ChoPL (C) and PCho (D) levels in DMSO (24 h)- and PI-103 (24 h)-treated CHO-K1 and MT58 cells as measured by 1H-MRS. Data expressed as mean ± SEM, n = 3 in each group. Statistically significant changes are indicated: *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. (E) Imaging of Pro-ChoPLs in DMSO (24 h)- and PI-103 (24 h)-treated CHO-K1 and MT58 cells at 33°C and 40°C. Pro-Cho was added together with the PI-103 treatment and the cells were then stained with Alexa Fluor 647-azide. Magenta arrows indicate potential autophagosomes or autolysosomes as vesicles enclosed in Pro-ChoPL membranes. Scale bar 20 μm.

PI-103-induced autophagy and ChoPLs in cells with impaired PCYT1A activity. (A) Schematic of PCYT1A activity in wild type Cho cell line CHO-K1 and in MT58 cells, that contain a temperature sensitive mutation in PCYT1A, at the permissive temperature of 33°C and the restrictive temperature of 40°C. (B) Western blots of LC3B autophagy marker in DMSO (24 h)- and in 11.4 μM PI-103 (24 h)-treated CHO-K1 and MT58 cells at 33°C and 40°C. TUBA was used as a loading control. ChoPL (C) and PCho (D) levels in DMSO (24 h)- and PI-103 (24 h)-treated CHO-K1 and MT58 cells as measured by 1H-MRS. Data expressed as mean ± SEM, n = 3 in each group. Statistically significant changes are indicated: *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. (E) Imaging of Pro-ChoPLs in DMSO (24 h)- and PI-103 (24 h)-treated CHO-K1 and MT58 cells at 33°C and 40°C. Pro-Cho was added together with the PI-103 treatment and the cells were then stained with Alexa Fluor 647-azide. Magenta arrows indicate potential autophagosomes or autolysosomes as vesicles enclosed in Pro-ChoPL membranes. Scale bar 20 μm. Both CHO-K1 and MT58 cells had an increased level of ChoPLs after the 24 h treatment with PI-103 compared to control at the permissive temperature of 33°C (Figure 6C). However, at the restrictive temperature of 40°C, the vehicle-treated MT58 cells had a reduced level of ChoPLs that was not increased upon PI-103 treatment (Figure 6C). Consistent with the inhibition of PCYT1A activity at 40°C, vehicle-treated MT58 cells at 40°C had a buildup of PCho, the substrate of PCYT1A, in agreement with previous findings [40] (Figure 6D). Pro-Cho labeling indicated an increase in Pro-ChoPLs in PI-103-treated CHO-K1 cells at both temperatures when compared to vehicle-treated controls, whereas an increase in Pro-ChoPLs was only seen at 33°C in PI-103-treated MT58 cells, consistent with the 1H-MRS data (Figure 6E). The amount of Pro-ChoPLs was severely reduced in MT58 cells, indicating a large reduction in new ChoPL synthesis at the restrictive temperature of 40°C (Figure 6E). Very few autophagosomes could be seen by Pro-Cho labeling in PI-103-treated MT58 cells (Figure 6E). A small reduction in the level of Pro-Cho-derived ChoPLs was also seen at 40°C in PI-103- and vehicle-treated CHO-K1 cells and this might have been due to the heat effects. Light microscopy indicated the presence of vacuoles following PI-103 treatment in both cell lines, but fewer vacuoles were visible at 40°C in 18 h and 24 h PI-103-treated MT58 cells when the PCYT1A activity was impaired (Figure S5). Electron microscopy was performed on CHO-K1 and MT58 cells following 18 h and 24 h of vehicle and PI-103 treatment at 33°C and 40°C to investigate the dynamics of autophagosome formation. Following 18 h of PI-103 treatment, autophagic vacuoles were present in both CHOK-1 and MT58 cells at 33°C and 40°C, indicating that autophagy could be initiated even when PtdCho synthesis by PCYT1A was impaired (Figure 7A). However, the proportion of cytosolic area occupied by autophagic vacuoles was reduced in MT58 cells at the restrictive temperature at this time-point (Figure 7A,B). After 24 h of PI-103 treatment, the area of cytosol occupied by autophagic vacuoles increased in all PI-103-treated samples, with the exception of the PI-103-treated MT58 cells at 40°C, which had very few autophagic vacuoles present (Figure 7A,B). We concluded that the loss of PCYT1A activity resulted in the inability of cells to sustain autophagosome formation during prolonged periods of autophagy. Consistent with this, even though the levels of LC3B-II were slightly increased in vehicle-treated MT58 cells at 40°C, there were no autophagosomes or autophagic vacuoles visible under this condition (Figure 7A).
Figure 7.

Autophagosome morphology in PI-103-treated cells with impaired PCYT1A activity. (A) Transmission electron micrographs of 18 h- and 24 h- DMSO- and 11.4 μM PI-103-treated CHO-K1 and MT58 cells at the permissive temperature of 33°C and the restrictive temperature of 40°C. Green arrows indicate autophagosome and autolysosomes, yellow arrows indicate mitochondria and cyan arrows indicate ER sphericles. (B) The percentage of cytosolic area occupied by autophagic vacuoles in the transmission electron micrographs shown in (A). Data expressed as mean ± SEM, min n = 3 in each group. Statistically significant changes are indicated: *p < 0.05, **p < 0.01.

Autophagosome morphology in PI-103-treated cells with impaired PCYT1A activity. (A) Transmission electron micrographs of 18 h- and 24 h- DMSO- and 11.4 μM PI-103-treated CHO-K1 and MT58 cells at the permissive temperature of 33°C and the restrictive temperature of 40°C. Green arrows indicate autophagosome and autolysosomes, yellow arrows indicate mitochondria and cyan arrows indicate ER sphericles. (B) The percentage of cytosolic area occupied by autophagic vacuoles in the transmission electron micrographs shown in (A). Data expressed as mean ± SEM, min n = 3 in each group. Statistically significant changes are indicated: *p < 0.05, **p < 0.01. The loss of PCYT1A activity also resulted in the dilation of the ER and appearance of spherical ER structures in both vehicle- and PI-103-treated MT58 cells at 40°C, consistent with a previous report [41]. We observed that the loss of PCYT1A activity also caused alterations in mitochondrial morphology, with the shape of mitochondria becoming more rounded, with no apparent deformations of mitochondrial cristae (Figure 7A). Thus, the impairments of PtdCho synthesis resulted in disruption of normal ER and mitochondrial appearance.

Phospholipid architecture was altered in autophagy

To further characterize the PtdCho and related species that were increased during autophagy, we performed targeted metabolomic analysis using the Absolute IDQ p180 kit to measure the levels of 101 choline-containing phospholipid species in the four choline phospholipid groups: PtdCho ester phospholipids (35), PtdCho ether phospholipids (38), LysoPtdChos (14) and SMs (14). To ensure that the observed changes in phospholipid species were related to autophagy rather than to the more general drug effects, Tat-Beclin 1 peptide-induced autophagy models were added to the analysis (Figure 8A).
Figure 8.

Choline phospholipid composition of autophagic cells. (A) Western blot of autophagy marker LC3B, apoptosis marker cleaved PARP (cPARP) and CASP3, and p-RPS6 in 6 h- or 24 h- HCT116 WT and HCT116 BAX-ko cells treated with 50 μM Tat-Beclin 1 or 50 μM Tat-Scramble control. TUBA was used as a loading control. (B) Fold changes in the composition of the measured PtdChos (ester and ether) in HCT116 BAX-ko and HCT116 WT cells treated for 24 h with 20 μM PI-103 or 75 mM DCA, 6 h and 24 h 50 μM Tat-Beclin 1 when compared to their respective controls (DMSO for PI-103, water for DCA and 50 μM Tat-Scramble for 50 μM Tat-Beclin 1). The PtdChos are categorized by the total number of double bonds in the fatty acid/alcohol chains of the phospholipid or the fatty acid/alcohol chain length. Fold changes in the sum of all measured SMs and LysoPtdChos of the same treatments are also indicated. Data expressed as a color-coded heat map of fold changes, n = 4 in each group. Only statistically significant changes (p < 0.05) are indicated in colors.

Choline phospholipid composition of autophagic cells. (A) Western blot of autophagy marker LC3B, apoptosis marker cleaved PARP (cPARP) and CASP3, and p-RPS6 in 6 h- or 24 h- HCT116 WT and HCT116 BAX-ko cells treated with 50 μM Tat-Beclin 1 or 50 μM Tat-Scramble control. TUBA was used as a loading control. (B) Fold changes in the composition of the measured PtdChos (ester and ether) in HCT116 BAX-ko and HCT116 WT cells treated for 24 h with 20 μM PI-103 or 75 mM DCA, 6 h and 24 h 50 μM Tat-Beclin 1 when compared to their respective controls (DMSO for PI-103, water for DCA and 50 μM Tat-Scramble for 50 μM Tat-Beclin 1). The PtdChos are categorized by the total number of double bonds in the fatty acid/alcohol chains of the phospholipid or the fatty acid/alcohol chain length. Fold changes in the sum of all measured SMs and LysoPtdChos of the same treatments are also indicated. Data expressed as a color-coded heat map of fold changes, n = 4 in each group. Only statistically significant changes (p < 0.05) are indicated in colors. In all the autophagy models, for both HCT116 WT and HCT116 BAX-ko cell lines, there were increased levels of both ester PtdChos and ether PtdChos (plasmalogens) with longer fatty acid/alcohol chain length (with a total of 36–40 carbon atoms per PtdCho molecule) and higher chain unsaturation (3–6 double bonds per PtdCho molecule) (Figure 8B). The total of all LysoPtdChos and SMs measured also increased in all treatment-induced and Tat-Beclin 1-induced autophagic cells, indicating the involvement of additional pathways of choline phospholipid metabolism. These data suggested that the de novo PtdCho synthesis might be important not only to increase the absolute amounts of PtdCho but also to alter the ChoPL profile for the autophagosome and autolysosome membrane formation.

Discussion

Increased ChoPL synthesis in drug-induced autophagy provided membrane phospholipids for the growing autophagosomes and replaced phospholipids consumed from other organelles during autophagosome formation and degradation. Autophagy induced in colorectal cancer cells in response to starvation, the dual PI3K-MTOR inhibitor PI-103, the metabolic drug DCA, or the autophagy-inducing peptide Tat-Beclin 1, was associated with increased levels of ChoPLs and a reduction in PCho as measured by 1H-MRS. Supplying the autophagic cells with exogenous 13C-labeled choline resulted in increased label incorporation into ChoPLs, showing that ChoPLs were synthesized de novo. Pro-Cho labeling indicated that increased ChoPL synthesis in drug-induced autophagy provided membrane phospholipids for autophagosomal membranes and replaced phospholipids consumed from other organelles during autophagosome formation and turnover, as Pro-Cho labeling of mitochondria and the ER was also observed. This study also demonstrated that the fluorescence signals from the newly synthesized Pro-ChoPLs colocalized with mCherry-LC3 signals following autophagy induction and the colocalization was related to autophagosome accumulation. The expression level of PCYT1A, the rate-limiting enzyme of PtdCho synthesis, increased in its active, membrane-bound form in autophagy models. Loss of PCYT1A function and subsequently reduced ChoPL synthesis capacity resulted in the CHO MT58 cells’ (harboring a temperature-sensitive mutation in PCYT1A) inability to maintain autophagosome formation. These findings are in keeping with the work of Dupont et al., who showed that lipid droplets are mobilized for use in autophagosome membrane synthesis during starvation, which may avoid the use of preformed membranes for autophagy [22]. In addition, they showed that knockdown of CHPT1 (choline phosphotransferase 1), the last enzyme of the Kennedy pathway of PtdCho synthesis, and of LPCAT2, the Lands cycle enzyme, results in a reduced number of autophagy puncta and LC3 lipidation in starved HeLa cells. While Dupont et al. focused on the source of the PtdCho fatty acyl chains in starvation, our study examined the autophagosome membrane genesis from the ChoPL synthesis aspect and identified the requirement of PCYT1A for autophagosome membrane formation and maintenance. While we showed upregulation of PCYT1A expression consistent with increased ChoPL levels in autophagy, the regulation of PCYT1A expression and the signals that lead to its membrane localization during autophagy merits further investigation. A recent study has demonstrated that PCYT1A responds to membrane packing defects induced by conical lipids such as PtdEth, which create a physical torque that promotes the association of PCYT1A to the membrane, activating it to synthesize PtdCho and alleviate the membrane torque [42,43]. Given the known role of PtdEth in initiation of autophagosome formation, sensing of membrane stress in phagophores, as well as in other organelles from which membrane lipids are delivered to the growing phagophore, by PCYT1A, could provide a mechanism for linking PtdCho synthesis to the autophagy process. We also found increased levels of PtdCho ether and PtdCho ester phospholipids with longer fatty acid/alcohol chain lengths and higher chain unsaturation in cells undergoing autophagy. These changes in PtdCho species profile could modify the physical properties of membranes such as fluidity, thickness and membrane curvature and may be important for the formation of autophagosomes and autolysosomal membranes. For example, the introduction of double bonds and reduced acyl chain length increase the membrane fluidity, whereas increased fatty acyl/alcohol chain length leads to thicker bilayer structures [44]. The right balance of various phospholipid species might ensure suitable physical properties for the membrane dynamics that take place during the autophagy process. Further investigation into the specific species and the remodeling enzymes of choline phospholipids may provide new targets for autophagy inhibition. Altered PtdCho acyl chain composition in autophagic cells suggested the synthesis of new PtdCho and possibly the remodeling of existing PtdCho species by Landes cycle enzymes as the level of LysoPtdCho was increased. This increase in LysoPtdCho could also potentially be due to PtdCho catabolism in autophagosomes during the autophagy process [45]. The increased level of PtdCho with polyunsaturated fatty acyl chains was consistent with the early electron microscopy studies that noted high electron density in autophagosome membranes, a marker of membrane phospholipid unsaturation [46]. More recently, Ogasawara et al. identified SCD (stearoyl-CoA desaturase), which introduces a double bond in stearoyl-CoA, as necessary for the earliest steps of autophagosome formation in starved mouse fibroblasts and HeLa cells [47]. SCD is also important for cancer cell survival in metabolically compromised environments [48]. Further studies of the fatty acyl chain requirements for the dynamic membrane processes that take place during autophagy and the enzymes involved in membrane lipid remodeling could provide novel targets to interfere with autophagy. Another choline phospholipid species that was significantly increased was SM. Sphingolipids have signaling roles in autophagy [49], but Yamagata et al. provided evidence that autophagosome formation in starved yeast requires inositol phosphorylceramide, a sphingolipid structurally similar to the mammalian SM [50]. Excess SM that occurs in SMPD1 (sphingomyelin phosphodiesterase 1, acid lysosomal)-deficiency (Niemann-Pick diseases) prevents autophagosome closure by defective regulation of ATG9 (autophagy related 9) cycling during autophagosome maturation [51]. The role of SM in mammalian autophagosome formation requires future investigation. The findings presented here are also congruent with bioenergetic considerations: it has long been established that autophagosomal membranes, unlike those of other organelles, are largely devoid of protein [52]. It is energetically more costly to remove proteins from existing membranes than to synthesize new membranes, supporting the finding that autophagosome membranes are synthesized de novo [15]. Our work suggests that PtdCho synthesis machinery participates in the dynamics of autophagosome formation and sustaining autophagy, as well as in supplying the membranes of other intracellular organelles, such as ER and Golgi, that contribute phospholipids to autophagosomal membranes [5,6,8,10-13]. This study documented and visualized the incorporation of newly made ChoPLs into autophagosome membranes in the clinically relevant setting of treatment-induced autophagy, in conditions where nutrients are available. De novo choline phospholipid synthesis was required for sustaining drug-induced cytoprotective autophagy and may provide a new therapeutic target, such as PCYT1A or other enzymes, against autophagy-acquired drug resistance. While the Kennedy pathway is required for normal cell function and thus targeting PCYT1A in cancer may lead to unfavorable side effects, two groups of adult patients with a functional mutation in PCYT1A have been identified [42,53]. These individuals have bone deformities and progressive visual impairments, or abnormal liver and adipose fat metabolism. While detrimental, it indicates that PCYT1A inhibition may be tolerated in patients for a short time period. Furthermore, as new membrane synthesis is required for cellular growth and division in cancer, inhibition of PCYT1A may have an anti-tumor effect. In addition, fluorescence imaging of Pro-Cho labeling may offer a useful way to visualize newly formed autophagosome membranes.

Materials and methods

Cell culture and treatment

All media and reagents for cell culture were purchased from Life Technologies. HCT116 BAX-ko and HCT116 WT cells were a kind gift of Dr Bert Vogelstein, Johns Hopkin’s Medical Center, USA via Dr Paul Clarke (ICR) and were cultivated in Dulbecco’s Modified Eagle Medium (DMEM; Life Technologies, 41,965) with 3.97 mM glutamine, 25 mM D-glucose, without sodium pyruvate (Life Technologies, 41,965) supplemented with non-essential amino acids (Life Technologies, 11,140). HT29 cells (American Type Culture Collection, HTB-38) were cultivated in McCoy’s 5A medium with glutamine and HEPES (Life Technologies, 22,330). CHO-K1 cells and CHO MT58 cells (MT58 cells), containing a temperature-sensitive mutation in PCYT1A originally isolated by Esko and Raetz [40], were both kindly donated by Prof Dennis Vance, University of Alberta, Canada. CHO-K1 and MT58 cells were cultured in Ham’s F12 medium (Life Technologies, 11,765). All culture media were supplemented with 10% heat-inactivated fetal bovine serum (Sigma-Aldrich, F2442), 100 U/ml penicillin and 100 μg/ml streptomycin (Life Technologies, 15,070). Cells were incubated in a humidified atmosphere containing 5% CO2. HCT116 BAX-ko, HCT116 WT and HT29 cells were grown at 37°C, CHO-K1 and MT58 cells were grown at the permissive temperature of 33°C. HCT116 BAX-ko and HCT116 WT cells were treated for 24 h with 20 μM PI-103 (Selleck Chemicals, S1038), 75 mM DCA (Sigma-Aldrich, 347,795) or for 6 h or 24 h with serum- and amino acid-deprived medium, HBSS (Life Technologies, 24,020). HT29 cells were treated with 100 μM PI-103. For prolonged autophagy, HCT116 BAX-ko cells were treated with 20 μM PI-103 for 8 d, with change of fresh medium every day. CHO-K1 and MT58 cells were treated for 18 h or 24 h with 11.4 μM PI-103 at 33°C or 40°C. Treatment with autophagy inducing peptide, Tat-Beclin 1 (amino acid sequence YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT), and its scrambled control, Tat-Scramble (amino acid sequence YGRKKRRQRRRGGVGNDFFINHETTGFATEW) (both custom-ordered from GeneCust) was performed as described [30]. Briefly, prior to treatment the peptides were dissolved in H2O to achieve a stock concentration of 50 mg/ml and diluted into Opti-MEM Reduced-Serum Medium (Life Technologies, 31,985) acidified with 0.15% 6 M HCl. HCT116 BAX-ko and HCT116 WT cells were washed with phosphate-buffered saline (PBS, Life Technologies, 20,012) and treated with 50 μM Tat-Beclin 1 or Tat-Scramble for 6 h or 24 h. Cells were washed with PBS and collected by standard trypsin (Sigma-Aldrich, T3924, for HT116 BAX-ko and HCT116 WT cells or Life Technologies, 12,605, for HT29 cells) treatment. Cell number, viability and average diameter were measured using Vi-CELL Cell Viability Analyzer (Beckman Colter, Brea, CA, USA).

mCherry-GFP-LC3 pancreatic mouse adult fibroblast cells

pMAFs were derived from mCherry-GFP-LC3 homozygous mice (kindly provided by Ian Ganley, The University of Dundee). After aseptic dissection, the pancreas was finely minced and digested in a “liberase blendzyme” (Roche, 05401020001) for 60 min at 37°C. Tissue fragments were then plated onto 10-cm culture dishes and allowed to attach. Fibroblasts were seen to “crawl” out of the tissue for up to 10 d. These fibroblasts were harvested and sub-cultured in RPMI 1640 medium (GlutaMAX supplemented, Life Technologies, 72,400,021) with 10% FCS, 50 µM of 2-mercaptoethanol (Sigma Aldrich, M6250) and 50 µM of asparagine (Sigma Aldrich, A4159). The fibroblasts divide rapidly for a few divisions, then slow down and cell numbers remain constant or decline slightly for up to 6–8 weeks. Following on from this “crisis” the cells once again return to fast replication at which point they are considered immortal and suitable for use in ongoing studies.

Immunoblotting

Western blotting was performed as described previously [28]. Proteins separated by SDS-PAGE were electrophoretically transferred onto “Immobilon-P” membrane (Millipore) and blocked with 5% w:v non-fat milk. The following primary antibodies were used: cleaved-PARP (9541), CASP3/caspase-3 (9665), LC3B (2775), phospho-RPS6/RPS6 (Ser240/Ser244, 2215), RPS6 (2217), TUBA/α-tubulin (2144), ACTB/β-actin (4967), CTNNB1/β-catenin (9562) (all from Cell Signaling Technology), PCYT1A (Santa Cruz Biotechnology, sc-161,447), CHKA (Sigma, HPA024153), horseradish peroxidase (HRP)-conjugated polyclonal goat anti-rabbit (GE Healthcare, NA934V) or rabbit anti-mouse (Dako, P0260) secondary antibodies were used. The protein-antibody interactions were visualized using SuperSignal West Pico Chemiluminescent Substrate (Thermo Scientific, 34,080) and exposed to KODAK BioMax XAR Film (Sigma-Aldrich, F5763). Protein densitometry was performed using ImageJ v1.48 (NIH) software. Relative optical density was calculated by dividing the densitometry of protein with its respective loading control from the same blot. The values obtained were used to calculate the treatment:control ratios.

CHK activity assay

CHK activity was assayed using an MRS-based method as described [54], with modifications. Briefly, about 25 million cells were collected by trypsinization and washed in PBS. The cells were lysed on ice for 10 min in 550 μl cell lysis buffer containing 50 mM 3-(N-morpholino) propanesulfonic acid-potassium hydroxide (MOPS-KOH; pH 7.5; Sigma-Aldrich, M1254), 5.5 mM sodium bisulfite, 5 mM ethylenediaminetetraacetic acid (EDTA), 5 mM ethylene glycol tetraacetic acid (EGTA) and EDTA-free protease inhibitor cocktail (Thermo Scientific, 88,266). The homogenate was passed through a fine-tipped needle (27.5 G) and lysed by sonication for 3 periods of 5 s. The lysate was centrifuged at 4°C for 20 min at 16,000 g. An aliquot of the supernatant fraction (500 µl) containing soluble proteins was placed in a 5 mm NMR tube (Wilmad, Z272019). Reaction mixture was added into the NMR tube immediately prior to the start of MRS measurement. The reaction mixture was prepared in 50 mM Tris-HCl buffer (pH 8.0). The final concentrations of reagents were 5 mM choline chloride, 25 mM MgCl2 and 10 mM ATP and the reaction was performed at 25°C to prevent the degradation of ATP. The total volume of reaction in the assay was 650 μl. 31P NMR spectra were acquired using a 30° proton-decoupled pulse sequence, spectral width of 12,000 Hz, 1.65 s relaxation delay and 128 scans per FID on a Bruker 500 MHz spectrometer (Bruker Biospin, Coventry, UK). Line broadening of 5 Hz was applied before Fourier transformation and the peak areas were integrated. The absolute concentrations of metabolites were determined using the ATP at the start of the experiment as a reference. The CHK activities were calculated from the straight-line fit to plots of PCho versus time and normalized to cell number.

1H-MRS of cell extracts

For cellular metabolite analysis, water-soluble and lipid metabolites were extracted using a dual phase extraction protocol [55]. Freeze-dried water-soluble cell extracts were reconstituted in 650 μl D2O and 50 μl of 0.75% sodium TSP (3-trimethylsilyl-2,2,3,3‐tetradeuteropropionate) in D2O (Sigma-Aldrich, 151,882 and 293,040) for chemical shift calibration and quantification. An aliquot of the sample (500 µl) was placed in a 5 mm NMR tube and the pH adjusted to pH 7 using 0.1 M KOH. Chloroform phase (containing lipid metabolites) was evaporated, and the lipid metabolites were reconstituted in 450 μl of deuterated chloroform and 150 μl of 0.1% tetramethylsilane (TMS) in deuterated chloroform (both from Sigma-Aldrich, 151,823 and 434,876) as the standard of reference.

13C-labeled choline tracer studies

HCT116 BAX-ko cells were cultured and treated for 18 h with control, DCA or PI-103 as described above. The treatment medium was then removed and substituted for medium containing [1,2-13C] choline together with the respective treatment for a further 6 h. The [1,2-13C] choline medium was prepared by using DMEM without choline (Life Technologies, custom ordered) supplemented with 0.0286 mM [1,2-13C] choline (Cambridge Isotopes, CLM-548-0.1). The overall treatment length was 24 h.

MRS measurements

All spectra were acquired on a 500 MHz spectrometer (Bruker Biospin, Coventry, UK) at 298 K. 1H spectra were acquired with 7,500 Hz spectral width, 32,768 time domain points, relaxation delay of 2.7 s and 128 or 256 scans for lipid or water-soluble cell extracts, respectively. The water resonance from soluble cell extract samples was suppressed by a gated irradiation centered on the water frequency. For 13C-MRS 13,000 spectral averages were acquired for with 26,000 Hz spectral width, 32,768 time domain points and 6.5 s relaxation delay. The spectra were phased and manually baseline-corrected using Bruker TopSpin-3.1 (Bruker Biospin) and MestRe-C-4.9.9.6 6 (Mestrelab Research) software packages, respectively. Spectral assignments were based on literature values [55-57]. Metabolite levels were standardized to cell number.

Targeted metabolomics analysis

Extracted intracellular metabolites were measured using AbsoluteIDQ® p180 targeted metabolomics kit according to manufacturer’s instructions (Biocrates Life Sciences AG, Innsbruck, Austria). The cells were lysed in 1.5 ml ice-cold 85% ethanol, scraped into 2 ml microcentrifuge tubes and subjected to three rounds of sonication followed by rapid freeze-thaw. The lysates were sonicated for 15 s, frozen for 30 s in liquid nitrogen, rapidly thawed in a 98°C water bath and returned to ice. After the third round of freeze-thaw cycle, the cell lysates were centrifuged at 16,000 g for 10 min at 4°C, and the supernatants were collected and freeze-dried to avoid hydrolysis of unstable metabolites. The lyophilized metabolites were stored at −80°C until analysis. The freeze-dried powder was then resuspended in 85% ethanol and 15% of 10 mM phosphate buffer, pH 7.4 to achieve cell concentration of 40 million cells/ml. 10 μl of the sample was applied to the AbsoluteIDQ® p180 plate.

Mass spectrometry data acquisition and processing

For quantification of glycerophospholipids and sphingolipids, metabolite measurements were performed using the validated AbsoluteIDQ p180 targeted metabolomics kit (Biocrates Life Sciences AG). The samples were processed in the 96-well format provided as per the instructions of the manufacturer. The sample preparations were injected directly into a Waters Xevo TQ-S mass spectrometer coupled to an Acquity HPLC system (Waters Corporation, Milford, MA USA) by electrospray ionization and mass spectrometric analyses were carried out in positive ion mode with multiple reaction monitoring. The elution profile was as follows (min/flow-rate in μl/min): 0/30, 1.6/30, 2.4/200, 2.8/200, 3/30. The auto-sampler was kept at 10°C. Data processing and peak integration was performed using MassLynxTM (Waters Corporation) and MetIDQ™ software (Biocrates Life Sciences AG). Quantification of the metabolites was achieved by calculating the area under the curve and using a one-point internal standard calibration with representative internal standards (one unlabeled LysoPtdCho, two unlabeled PtdChos and one unlabeled SM). Metabolite levels were standardized to cell number. The semi-quantitative concentration of 76 PtdChos, 15 SMs and 14 LysoPtdChos obtained represent total concentrations of possible isobars and structural isomers. For SMs and LysoPtdChos, the sum of all species detected was used for comparisons of treatment and control samples. For PtdChos, the sum of individual species by bond number or total chain length were used in comparisons.

Propargyl-choline synthesis

Propargyl-choline (Pro-Cho) was synthesized using the method described [33]. Briefly, dimethylethanolamine (3.54 ml, 35.3 mmol; Sigma Aldrich, 38,990) was added to a solution of propargyl bromide (80% in toluene, 3.74 ml, 33.6 mmol; Sigma Aldrich, 81,831) in anhydrous tetrahydrofuran (THF; 10 ml; VWR, 44,608.AE) at 0°C under a nitrogen atmosphere. The solution was allowed to warm to room temperature and was stirred for 18 h, after which time the resultant solid was washed with cold THF (3 x 20 ml) and dried in vacuo to afford the title compound as an off-white solid (6.05 g, 87% yield). The sample was analyzed by 1H NMR (in MeOD): 4.87 (1H, s), 4.46 (2H, d, J = 2.3 Hz), 4.04 (2H, a-dq, J = 2.5, 4.8 Hz), 3.62 (2H, m), 3.56 (1H, t, J = 2.5 Hz), 3.29 (6H, s); 13C NMR (in MeOD): 81.3 (C, t, J = 40 Hz), 70.7 (CH, t, 8 Hz), 65.3 (CH2, s), 55.5 (CH2, s), 55.0 (CH2, s), 50.6 (CH3x2, s).

Pro-Cho labeling of cells and detection by confocal fluorescence microscopy

Pro-Cho labeling was performed as described [33]. In essence, HCT116 BAX-ko and HT29 cells were grown in 35 mm glass bottom dishes (MatTek, P35G-0-10-C) and labeled with 1 mM Pro-Cho bromide in complete media. Unlabeled cells (with no Pro-Cho added) were used as controls. The cells were washed with PBS and fixed for 15 min (IC Fixation Buffer, eBioscience, 00-8222-49). The plates were then washed with TBS (50 mM Tris-Cl, 150 mM NaCl, pH 7.5) and reacted with fluorescent azide for 30 min. The fluorescent azide reaction mixture was prepared fresh every time in 100 mM Tris (from 1 M stock, pH 8.5) and contained 0.75 mM CuSO4, 20 μM Alexa Fluor 647-azide (from 20 mM stock in DMSO, Life Technologies, A10277) and 75 mM ascorbic acid. The cells were washed with TBS, 0.5M NaCl, and then with TBS again before counterstaining with Hoechst 33,342 (Enzo Life Sciences, 23,491-52-3). Cell images were acquired on confocal laser scanning microscope Zeiss LSM 700 (Carl Zeiss, Jena, Germany).

Immuno-gold electron microscopy of Pro-Cho-labeled cells

HCT116 BAX-ko cells were treated with 1 mM Pro-Cho and PI-103 or DCA as for confocal microscopy. The cells were washed with PBS, detached from the dish in 0.5 mM EDTA in PBS, pelleted and fixed with 4% formaldehyde (prepared from a 16% stock; TAAB, F017/2), 0.1% glutaraldehyde (prepared from a 50% stock purchased, TAAB, G014) in 100 mM sodium phosphate buffer (pH 7.4). Fixed cell pellets were infiltrated with 2.3 M sucrose in PBS, frozen in liquid nitrogen and sectioned on an ultramicrotome at −120°C. The 80–100 nm cryo-sections were laid on formvar/carbon-coated copper grids (Agar Scientific, AGS138), thawed, washed with TBS and stained with 20 μM biotin-azide (Life Technologies, B10184) for 30 min. The biotin azide reaction mixture was prepared fresh every time in 100 mM Tris (from 1 M stock, pH 8.5) and contained 0.75 mM CuSO4, 20 μM biotin-azide (from 20 mM stock in DMSO) and 75 mM ascorbic acid. The cells were washed with TBS, 0.5 M NaCl, and TBS again, then blocked in 40 mg/ml bovine serum albumin (Sigma-Aldrich, A3311) in TBS. Biotin was detected using a rabbit anti-biotin antibody (Rockland Immunochemicals, 600-401-098), followed by protein A-gold (10-nm colloidal gold; Boster Biological Technology, GA1054). The grids were counterstained and embedded by incubation with 3% uranyl acetate (Agar Scientific, AGR1260A) in 2% methyl-cellulose (Sigma, M6385). The cells were imaged on a Tecnai G2 Spirit BioTWIN transmission electron microscope (Philips/FEI, Eindhoven, the Netherlands) equipped with an AMT 2k CCD camera (Advanced Microscopy Techniques, Woburn, MA, USA).

Pro-Cho labeling of mCherry-GFP-LC3 pMAF cells and detection by confocal fluorescence microscopy

The immortalized mCherry-GFP-LC3 pMAFs were cultured in RPMI 1640 media containing GlutaMAX (Life Technologies, 72,400,021) supplemented with 10% FCS (PAN Biotech UK, P30-3702), 50 μM 2-mercaptoethanol (Sigma Aldrich, M6250) and 50 μM asparagine (Sigma Aldrich, A4159). The pMAFs were then plated onto ibidi 96-well μ-plate (Thistle scientific, 89,646) and incubated for 5 h. Pro-Cho labeling and synthesis was performed as described [33]. The cells were labeled with 1 mM Pro-Cho bromide for 24 h in complete media, washed with TBS, fixed with 4% PFA at room temp for 15 min and reacted with 20 μM Alexa Fluor 350-azide (Click Chemistry, A1267-01). All the solutions for click chemistry were made fresh, added immediately and incubated on a shaker for 30 min at room temp. The pMAFs were then washed with TBS-NaCl (50 mM Tris-Cl, 0.5 M NaCl, pH 7.5) followed by TBS and with Vectashield (Vector Laboratories, H-1000) added at the end. The pMAFs cells were treated with 250 nM Torin-1 (Bio-techne, 4247), 200 nM bafilomycin A1 (Tocris, 1334), 20 µM PI-103 or DMSO for 6 h before the end of the 24 h incubation with Pro-Cho. Cell images were acquired on a confocal laser scanning microscope, Zeiss LSM700 (Carl Zeiss, Jena, Germany).

Quantitative colocalization analysis

Samples were viewed on a Zeiss LSM700 confocal microscope at x63 magnification. Colocalization was measured using the Zen 2009 software (Carl Zeiss). Colocalization was performed on a pixel by pixel basis with every pixel in the image plotted onto a scatter diagram. Segmentation was established by using the software to false color the red and green pixels (as single color staining was not possible), so that the placement of the crosshairs can be estimated. Quadrant 3 on the scatterplot shows the colocalized pixels. The colocalized pixels in the images were false colored to white, so that the location of these pixels could be observed more readily. Once these conditions were established, they were subsequently kept constant throughout the analysis. Region of interest (ROI) were drawn around each cell in each field of view, in order to remove the areas of no signal which can skew the results. Colocalization was quantified using the Manders colocalization coefficient, as this is sensitive to colocalization independent of a linear relationship of signal levels to each other [58,59]. Colocalization coefficient ch1-T1 and colocalization coefficient ch2-T2 were analyzed. The colocalization coefficients describe the contribution of each one from two selected channels to the pixels of interest, i.e, the colocalization coefficient ch1-T1 shows the value of how many red pixels colocalize with the green pixels, whereas, the colocalization coefficient ch2-T2 shows the value of how many green pixels colocalize with the red pixels. The values are between 0 and 1 where 1 corresponds to 100% colocalization, 0.2 to 20% and 0 to no colocalization [60].

Electron microscopy of CHO-K1 and MT58 cells

For transmission electron microscopy (TEM) analysis, cells were fixed for 4 h with 2.5% (v:v) glutaraldehyde in 0.1 M cacodylate buffer (pH 7.4; TAAB, S006), pelleted by centrifugation and post-fixed in 1% (w:v) osmium tetroxide (prepared from a 4% stock, TAAB, O014) in 0.1 M cacodylate buffer for 1 h at 4°C. The cells were then stained for 1 h with 2% uranyl acetate (Agar Scientific, AGR1260A) in water at 4°C before dehydration through a graded ethanol series. Samples were equilibrated with propylene oxide (Sigma-Aldrich, 110,205) before infiltration with TAAB epoxy resin (TAAB, T028) and polymerized at 70°C for 24 h. Ultrathin sections (50–70 nm) were prepared using a Reichert-Jung Ultracut E ultramicrotome, mounted on 150 mesh copper grids and contrasted using uranyl acetate and lead citrate [61]. Samples were examined on a FEI Tecnai 12 transmission microscope (Philips/FEI, Eindhoven, Netherlands) operated at 120 kV. Images were acquired with an AMT 16000M camera (Advanced Microscopy Techniques, Woburn, CA, USA). For measuring cytosolic area occupied by autophagosomes, total autophagosomal area was divided by total cytosolic area (measured by NIH ImageJ digital image analysis software) in a random selection of EM images (min. n = 3).

Statistics

All assays were performed at least in triplicate and data presented as mean ± 1 SEM. Student’s two-tailed unpaired t-test was used in all statistical analyses unless otherwise stated, with a p value of ≤ 0.05 considered significant. For statistical tests involving CHO-K1 and MT58 cells, One-way ANOVA with Bonferroni post-comparison test (GraphPad Prism 6, GraphPad Software Incorporated) was used and a p value of ≤ 0.05 considered significant. To correlate ChoPL levels with LC3B-II expression, linear regression analysis was performed in GraphPad Prism 7 (GraphPad Software). The Welch t-test was used to compare the colocalization coefficient changes between DMSO and the various treatment groups (GraphPad Prism 7). Click here for additional data file.
  57 in total

Review 1.  Dichloroacetate and cancer: new home for an orphan drug?

Authors:  Shyam Kankotia; Peter W Stacpoole
Journal:  Biochim Biophys Acta       Date:  2014-08-23

2.  Switch-like control of SREBP-2 transport triggered by small changes in ER cholesterol: a delicate balance.

Authors:  Arun Radhakrishnan; Joseph L Goldstein; Jeffrey G McDonald; Michael S Brown
Journal:  Cell Metab       Date:  2008-12       Impact factor: 27.287

3.  Stearoyl-CoA desaturase 1 activity is required for autophagosome formation.

Authors:  Yuta Ogasawara; Eisuke Itakura; Nozomu Kono; Noboru Mizushima; Hiroyuki Arai; Atsuki Nara; Tamio Mizukami; Akitsugu Yamamoto
Journal:  J Biol Chem       Date:  2014-07-14       Impact factor: 5.157

Review 4.  The role of Atg proteins in autophagosome formation.

Authors:  Noboru Mizushima; Tamotsu Yoshimori; Yoshinori Ohsumi
Journal:  Annu Rev Cell Dev Biol       Date:  2011-07-18       Impact factor: 13.827

5.  Diacylglycerol signals the translocation of CTP:choline-phosphate cytidylyltransferase in HeLa cells treated with 12-O-tetradecanoylphorbol-13-acetate.

Authors:  A K Utal; H Jamil; D E Vance
Journal:  J Biol Chem       Date:  1991-12-15       Impact factor: 5.157

6.  Akt and autophagy cooperate to promote survival of drug-resistant glioma.

Authors:  Qi-Wen Fan; Christine Cheng; Chris Hackett; Morri Feldman; Benjamin T Houseman; Theodore Nicolaides; Daphne Haas-Kogan; C David James; Scott A Oakes; Jayanta Debnath; Kevan M Shokat; William A Weiss
Journal:  Sci Signal       Date:  2010-11-09       Impact factor: 8.192

Review 7.  Autophagy and the integrated stress response.

Authors:  Guido Kroemer; Guillermo Mariño; Beth Levine
Journal:  Mol Cell       Date:  2010-10-22       Impact factor: 17.970

8.  Mutations in PCYT1A, encoding a key regulator of phosphatidylcholine metabolism, cause spondylometaphyseal dysplasia with cone-rod dystrophy.

Authors:  Julie Hoover-Fong; Nara Sobreira; Julie Jurgens; Peggy Modaff; Carrie Blout; Ann Moser; Ok-Hwa Kim; Tae-Joon Cho; Sung Yoon Cho; Sang Jin Kim; Dong-Kyu Jin; Hiroshi Kitoh; Woong-Yang Park; Hua Ling; Kurt N Hetrick; Kimberly F Doheny; David Valle; Richard M Pauli
Journal:  Am J Hum Genet       Date:  2014-01-02       Impact factor: 11.025

Review 9.  Autophagy and chemotherapy resistance: a promising therapeutic target for cancer treatment.

Authors:  X Sui; R Chen; Z Wang; Z Huang; N Kong; M Zhang; W Han; F Lou; J Yang; Q Zhang; X Wang; C He; H Pan
Journal:  Cell Death Dis       Date:  2013-10-10       Impact factor: 8.469

10.  ER-mitochondria associations are regulated by the VAPB-PTPIP51 interaction and are disrupted by ALS/FTD-associated TDP-43.

Authors:  Radu Stoica; Kurt J De Vos; Sébastien Paillusson; Sarah Mueller; Rosa M Sancho; Kwok-Fai Lau; Gema Vizcay-Barrena; Wen-Lang Lin; Ya-Fei Xu; Jada Lewis; Dennis W Dickson; Leonard Petrucelli; Jacqueline C Mitchell; Christopher E Shaw; Christopher C J Miller
Journal:  Nat Commun       Date:  2014-06-03       Impact factor: 14.919

View more
  29 in total

1.  Autophagosome biogenesis: From membrane growth to closure.

Authors:  Thomas J Melia; Alf H Lystad; Anne Simonsen
Journal:  J Cell Biol       Date:  2020-06-01       Impact factor: 10.539

Review 2.  Mechanisms governing autophagosome biogenesis.

Authors:  Hitoshi Nakatogawa
Journal:  Nat Rev Mol Cell Biol       Date:  2020-05-05       Impact factor: 94.444

3.  Autophagy protects murine preputial glands against premature aging, and controls their sebum phospholipid and pheromone profile.

Authors:  Heidemarie Rossiter; Dragan Copic; Martin Direder; Florian Gruber; Samuele Zoratto; Martina Marchetti-Deschmann; Christopher Kremslehner; Michaela Sochorová; Ionela-Mariana Nagelreiter; Veronika Mlitz; Maria Buchberger; Barbara Lengauer; Bahar Golabi; Supawadee Sukseree; Michael Mildner; Leopold Eckhart; Erwin Tschachler
Journal:  Autophagy       Date:  2021-09-07       Impact factor: 13.391

Review 4.  Autophagy in cancer cell remodeling and quality control.

Authors:  Grace A Hernandez; Rushika M Perera
Journal:  Mol Cell       Date:  2022-04-21       Impact factor: 19.328

5.  The cholesterol transport protein GRAMD1C regulates autophagy initiation and mitochondrial bioenergetics.

Authors:  Matthew Yoke Wui Ng; Chara Charsou; Ana Lapao; Sakshi Singh; Laura Trachsel-Moncho; Sebastian W Schultz; Sigve Nakken; Michael J Munson; Anne Simonsen
Journal:  Nat Commun       Date:  2022-10-21       Impact factor: 17.694

6.  Genetic Basis of Aerobically Supported Voluntary Exercise: Results from a Selection Experiment with House Mice.

Authors:  David A Hillis; Liran Yadgary; George M Weinstock; Fernando Pardo-Manuel de Villena; Daniel Pomp; Alexandra S Fowler; Shizhong Xu; Frank Chan; Theodore Garland
Journal:  Genetics       Date:  2020-09-25       Impact factor: 4.562

Review 7.  Autophagosome biogenesis comes out of the black box.

Authors:  Chunmei Chang; Liv E Jensen; James H Hurley
Journal:  Nat Cell Biol       Date:  2021-04-26       Impact factor: 28.824

8.  Guidelines for the use and interpretation of assays for monitoring autophagy (4th edition)1.

Authors:  Daniel J Klionsky; Amal Kamal Abdel-Aziz; Sara Abdelfatah; Mahmoud Abdellatif; Asghar Abdoli; Steffen Abel; Hagai Abeliovich; Marie H Abildgaard; Yakubu Princely Abudu; Abraham Acevedo-Arozena; Iannis E Adamopoulos; Khosrow Adeli; Timon E Adolph; Annagrazia Adornetto; Elma Aflaki; Galila Agam; Anupam Agarwal; Bharat B Aggarwal; Maria Agnello; Patrizia Agostinis; Javed N Agrewala; Alexander Agrotis; Patricia V Aguilar; S Tariq Ahmad; Zubair M Ahmed; Ulises Ahumada-Castro; Sonja Aits; Shu Aizawa; Yunus Akkoc; Tonia Akoumianaki; Hafize Aysin Akpinar; Ahmed M Al-Abd; Lina Al-Akra; Abeer Al-Gharaibeh; Moulay A Alaoui-Jamali; Simon Alberti; Elísabet Alcocer-Gómez; Cristiano Alessandri; Muhammad Ali; M Abdul Alim Al-Bari; Saeb Aliwaini; Javad Alizadeh; Eugènia Almacellas; Alexandru Almasan; Alicia Alonso; Guillermo D Alonso; Nihal Altan-Bonnet; Dario C Altieri; Élida M C Álvarez; Sara Alves; Cristine Alves da Costa; Mazen M Alzaharna; Marialaura Amadio; Consuelo Amantini; Cristina Amaral; Susanna Ambrosio; Amal O Amer; Veena Ammanathan; Zhenyi An; Stig U Andersen; Shaida A Andrabi; Magaiver Andrade-Silva; Allen M Andres; Sabrina Angelini; David Ann; Uche C Anozie; Mohammad Y Ansari; Pedro Antas; Adam Antebi; Zuriñe Antón; Tahira Anwar; Lionel Apetoh; Nadezda Apostolova; Toshiyuki Araki; Yasuhiro Araki; Kohei Arasaki; Wagner L Araújo; Jun Araya; Catherine Arden; Maria-Angeles Arévalo; Sandro Arguelles; Esperanza Arias; Jyothi Arikkath; Hirokazu Arimoto; Aileen R Ariosa; Darius Armstrong-James; Laetitia Arnauné-Pelloquin; Angeles Aroca; Daniela S Arroyo; Ivica Arsov; Rubén Artero; Dalia Maria Lucia Asaro; Michael Aschner; Milad Ashrafizadeh; Osnat Ashur-Fabian; Atanas G Atanasov; Alicia K Au; Patrick Auberger; Holger W Auner; Laure Aurelian; Riccardo Autelli; Laura Avagliano; Yenniffer Ávalos; Sanja Aveic; Célia Alexandra Aveleira; Tamar Avin-Wittenberg; Yucel Aydin; Scott Ayton; Srinivas Ayyadevara; Maria Azzopardi; Misuzu Baba; Jonathan M Backer; Steven K Backues; Dong-Hun Bae; Ok-Nam Bae; Soo Han Bae; Eric H Baehrecke; Ahruem Baek; Seung-Hoon Baek; Sung Hee Baek; Giacinto Bagetta; Agnieszka Bagniewska-Zadworna; Hua Bai; Jie Bai; Xiyuan Bai; Yidong Bai; Nandadulal Bairagi; Shounak Baksi; Teresa Balbi; Cosima T Baldari; Walter Balduini; Andrea Ballabio; Maria Ballester; Salma Balazadeh; Rena Balzan; Rina Bandopadhyay; Sreeparna Banerjee; Sulagna Banerjee; Ágnes Bánréti; Yan Bao; Mauricio S Baptista; Alessandra Baracca; Cristiana Barbati; Ariadna Bargiela; Daniela Barilà; Peter G Barlow; Sami J Barmada; Esther Barreiro; George E Barreto; Jiri Bartek; Bonnie Bartel; Alberto Bartolome; Gaurav R Barve; Suresh H Basagoudanavar; Diane C Bassham; Robert C Bast; Alakananda Basu; Henri Batoko; Isabella Batten; Etienne E Baulieu; Bradley L Baumgarner; Jagadeesh Bayry; Rupert Beale; Isabelle Beau; Florian Beaumatin; Luiz R G Bechara; George R Beck; Michael F Beers; Jakob Begun; Christian Behrends; Georg M N Behrens; Roberto Bei; Eloy Bejarano; Shai Bel; Christian Behl; Amine Belaid; Naïma Belgareh-Touzé; Cristina Bellarosa; Francesca Belleudi; Melissa Belló Pérez; Raquel Bello-Morales; Jackeline Soares de Oliveira Beltran; Sebastián Beltran; Doris Mangiaracina Benbrook; Mykolas Bendorius; Bruno A Benitez; Irene Benito-Cuesta; Julien Bensalem; Martin W Berchtold; Sabina Berezowska; Daniele Bergamaschi; Matteo Bergami; Andreas Bergmann; Laura Berliocchi; Clarisse Berlioz-Torrent; Amélie Bernard; Lionel Berthoux; Cagri G Besirli; Sebastien Besteiro; Virginie M Betin; Rudi Beyaert; Jelena S Bezbradica; Kiran Bhaskar; Ingrid Bhatia-Kissova; Resham Bhattacharya; Sujoy Bhattacharya; Shalmoli Bhattacharyya; Md Shenuarin Bhuiyan; Sujit Kumar Bhutia; Lanrong Bi; Xiaolin Bi; Trevor J Biden; Krikor Bijian; Viktor A Billes; Nadine Binart; Claudia Bincoletto; Asa B Birgisdottir; Geir Bjorkoy; Gonzalo Blanco; Ana Blas-Garcia; Janusz Blasiak; Robert Blomgran; Klas Blomgren; Janice S Blum; Emilio Boada-Romero; Mirta Boban; Kathleen Boesze-Battaglia; Philippe Boeuf; Barry Boland; Pascale Bomont; Paolo Bonaldo; Srinivasa Reddy Bonam; Laura Bonfili; Juan S Bonifacino; Brian A Boone; Martin D Bootman; Matteo Bordi; Christoph Borner; Beat C Bornhauser; Gautam Borthakur; Jürgen Bosch; Santanu Bose; Luis M Botana; Juan Botas; Chantal M Boulanger; Michael E Boulton; Mathieu Bourdenx; Benjamin Bourgeois; Nollaig M Bourke; Guilhem Bousquet; Patricia Boya; Peter V Bozhkov; Luiz H M Bozi; Tolga O Bozkurt; Doug E Brackney; Christian H Brandts; Ralf J Braun; Gerhard H Braus; Roberto Bravo-Sagua; José M Bravo-San Pedro; Patrick Brest; Marie-Agnès Bringer; Alfredo Briones-Herrera; V Courtney Broaddus; Peter Brodersen; Jeffrey L Brodsky; Steven L Brody; Paola G Bronson; Jeff M Bronstein; Carolyn N Brown; Rhoderick E Brown; Patricia C Brum; John H Brumell; Nicola Brunetti-Pierri; Daniele Bruno; Robert J Bryson-Richardson; Cecilia Bucci; Carmen Buchrieser; Marta Bueno; Laura Elisa Buitrago-Molina; Simone Buraschi; Shilpa Buch; J Ross Buchan; Erin M Buckingham; Hikmet Budak; Mauricio Budini; Geert Bultynck; Florin Burada; Joseph R Burgoyne; M Isabel Burón; Victor Bustos; Sabrina Büttner; Elena Butturini; Aaron Byrd; Isabel Cabas; Sandra Cabrera-Benitez; Ken Cadwell; Jingjing Cai; Lu Cai; Qian Cai; Montserrat Cairó; Jose A Calbet; Guy A Caldwell; Kim A Caldwell; Jarrod A Call; Riccardo Calvani; Ana C Calvo; Miguel Calvo-Rubio Barrera; Niels Os Camara; Jacques H Camonis; Nadine Camougrand; Michelangelo Campanella; Edward M Campbell; François-Xavier Campbell-Valois; Silvia Campello; Ilaria Campesi; Juliane C Campos; Olivier Camuzard; Jorge Cancino; Danilo Candido de Almeida; Laura Canesi; Isabella Caniggia; Barbara Canonico; Carles Cantí; Bin Cao; Michele Caraglia; Beatriz Caramés; Evie H Carchman; Elena Cardenal-Muñoz; Cesar Cardenas; Luis Cardenas; Sandra M Cardoso; Jennifer S Carew; Georges F Carle; Gillian Carleton; Silvia Carloni; Didac Carmona-Gutierrez; Leticia A Carneiro; Oliana Carnevali; Julian M Carosi; Serena Carra; Alice Carrier; Lucie Carrier; Bernadette Carroll; A Brent Carter; Andreia Neves Carvalho; Magali Casanova; Caty Casas; Josefina Casas; Chiara Cassioli; Eliseo F Castillo; Karen Castillo; Sonia Castillo-Lluva; Francesca Castoldi; Marco Castori; Ariel F Castro; Margarida Castro-Caldas; Javier Castro-Hernandez; Susana Castro-Obregon; Sergio D Catz; Claudia Cavadas; Federica Cavaliere; Gabriella Cavallini; Maria Cavinato; Maria L Cayuela; Paula Cebollada Rica; Valentina Cecarini; Francesco Cecconi; Marzanna Cechowska-Pasko; Simone Cenci; Victòria Ceperuelo-Mallafré; João J Cerqueira; Janete M Cerutti; Davide Cervia; Vildan Bozok Cetintas; Silvia Cetrullo; Han-Jung Chae; Andrei S Chagin; Chee-Yin Chai; Gopal Chakrabarti; Oishee Chakrabarti; Tapas Chakraborty; Trinad Chakraborty; Mounia Chami; Georgios Chamilos; David W Chan; Edmond Y W Chan; Edward D Chan; H Y Edwin Chan; Helen H Chan; Hung Chan; Matthew T V Chan; Yau Sang Chan; Partha K Chandra; Chih-Peng Chang; Chunmei Chang; Hao-Chun Chang; Kai Chang; Jie Chao; Tracey Chapman; Nicolas Charlet-Berguerand; Samrat Chatterjee; Shail K Chaube; Anu Chaudhary; Santosh Chauhan; Edward Chaum; Frédéric Checler; Michael E Cheetham; Chang-Shi Chen; Guang-Chao Chen; Jian-Fu Chen; Liam L Chen; Leilei Chen; Lin Chen; Mingliang Chen; Mu-Kuan Chen; Ning Chen; Quan Chen; Ruey-Hwa Chen; Shi Chen; Wei Chen; Weiqiang Chen; Xin-Ming Chen; Xiong-Wen Chen; Xu Chen; Yan Chen; Ye-Guang Chen; Yingyu Chen; Yongqiang Chen; Yu-Jen Chen; Yue-Qin Chen; Zhefan Stephen Chen; Zhi Chen; Zhi-Hua Chen; Zhijian J Chen; Zhixiang Chen; Hanhua Cheng; Jun Cheng; Shi-Yuan Cheng; Wei Cheng; Xiaodong Cheng; Xiu-Tang Cheng; Yiyun Cheng; Zhiyong Cheng; Zhong Chen; Heesun Cheong; Jit Kong Cheong; Boris V Chernyak; Sara Cherry; Chi Fai Randy Cheung; Chun Hei Antonio Cheung; King-Ho Cheung; Eric Chevet; Richard J Chi; Alan Kwok Shing Chiang; Ferdinando Chiaradonna; Roberto Chiarelli; Mario Chiariello; Nathalia Chica; Susanna Chiocca; Mario Chiong; Shih-Hwa Chiou; Abhilash I Chiramel; Valerio Chiurchiù; Dong-Hyung Cho; Seong-Kyu Choe; Augustine M K Choi; Mary E Choi; Kamalika Roy Choudhury; Norman S Chow; Charleen T Chu; Jason P Chua; John Jia En Chua; Hyewon Chung; Kin Pan Chung; Seockhoon Chung; So-Hyang Chung; Yuen-Li Chung; Valentina Cianfanelli; Iwona A Ciechomska; Mariana Cifuentes; Laura Cinque; Sebahattin Cirak; Mara Cirone; Michael J Clague; Robert Clarke; Emilio Clementi; Eliana M Coccia; Patrice Codogno; Ehud Cohen; Mickael M Cohen; Tania Colasanti; Fiorella Colasuonno; Robert A Colbert; Anna Colell; Miodrag Čolić; Nuria S Coll; Mark O Collins; María I Colombo; Daniel A Colón-Ramos; Lydie Combaret; Sergio Comincini; Márcia R Cominetti; Antonella Consiglio; Andrea Conte; Fabrizio Conti; Viorica Raluca Contu; Mark R Cookson; Kevin M Coombs; Isabelle Coppens; Maria Tiziana Corasaniti; Dale P Corkery; Nils Cordes; Katia Cortese; Maria do Carmo Costa; Sarah Costantino; Paola Costelli; Ana Coto-Montes; Peter J Crack; Jose L Crespo; Alfredo Criollo; Valeria Crippa; Riccardo Cristofani; Tamas Csizmadia; Antonio Cuadrado; Bing Cui; Jun Cui; Yixian Cui; Yong Cui; Emmanuel Culetto; Andrea C Cumino; Andrey V Cybulsky; Mark J Czaja; Stanislaw J Czuczwar; Stefania D'Adamo; Marcello D'Amelio; Daniela D'Arcangelo; Andrew C D'Lugos; Gabriella D'Orazi; James A da Silva; Hormos Salimi Dafsari; Ruben K Dagda; Yasin Dagdas; Maria Daglia; Xiaoxia Dai; Yun Dai; Yuyuan Dai; Jessica Dal Col; Paul Dalhaimer; Luisa Dalla Valle; Tobias Dallenga; Guillaume Dalmasso; Markus Damme; Ilaria Dando; Nico P Dantuma; April L Darling; Hiranmoy Das; Srinivasan Dasarathy; Santosh K Dasari; Srikanta Dash; Oliver Daumke; Adrian N Dauphinee; Jeffrey S Davies; Valeria A Dávila; Roger J Davis; Tanja Davis; Sharadha Dayalan Naidu; Francesca De Amicis; Karolien De Bosscher; Francesca De Felice; Lucia De Franceschi; Chiara De Leonibus; Mayara G de Mattos Barbosa; Guido R Y De Meyer; Angelo De Milito; Cosimo De Nunzio; Clara De Palma; Mauro De Santi; Claudio De Virgilio; Daniela De Zio; Jayanta Debnath; Brian J DeBosch; Jean-Paul Decuypere; Mark A Deehan; Gianluca Deflorian; James DeGregori; Benjamin Dehay; Gabriel Del Rio; Joe R Delaney; Lea M D Delbridge; Elizabeth Delorme-Axford; M Victoria Delpino; Francesca Demarchi; Vilma Dembitz; Nicholas D Demers; Hongbin Deng; Zhiqiang Deng; Joern Dengjel; Paul Dent; Donna Denton; Melvin L DePamphilis; Channing J Der; Vojo Deretic; Albert Descoteaux; Laura Devis; Sushil Devkota; Olivier Devuyst; Grant Dewson; Mahendiran Dharmasivam; Rohan Dhiman; Diego di Bernardo; Manlio Di Cristina; Fabio Di Domenico; Pietro Di Fazio; Alessio Di Fonzo; Giovanni Di Guardo; Gianni M Di Guglielmo; Luca Di Leo; Chiara Di Malta; Alessia Di Nardo; Martina Di Rienzo; Federica Di Sano; George Diallinas; Jiajie Diao; Guillermo Diaz-Araya; Inés Díaz-Laviada; Jared M Dickinson; Marc Diederich; Mélanie Dieudé; Ivan Dikic; Shiping Ding; Wen-Xing Ding; Luciana Dini; Jelena Dinić; Miroslav Dinic; Albena T Dinkova-Kostova; Marc S Dionne; Jörg H W Distler; Abhinav Diwan; Ian M C Dixon; Mojgan Djavaheri-Mergny; Ina Dobrinski; Oxana Dobrovinskaya; Radek Dobrowolski; Renwick C J Dobson; Jelena Đokić; Serap Dokmeci Emre; Massimo Donadelli; Bo Dong; Xiaonan Dong; Zhiwu Dong; Gerald W Dorn Ii; Volker Dotsch; Huan Dou; Juan Dou; Moataz Dowaidar; Sami Dridi; Liat Drucker; Ailian Du; Caigan Du; Guangwei Du; Hai-Ning Du; Li-Lin Du; André du Toit; Shao-Bin Duan; Xiaoqiong Duan; Sónia P Duarte; Anna Dubrovska; Elaine A Dunlop; Nicolas Dupont; Raúl V Durán; Bilikere S Dwarakanath; Sergey A Dyshlovoy; Darius Ebrahimi-Fakhari; Leopold Eckhart; Charles L Edelstein; Thomas Efferth; Eftekhar Eftekharpour; Ludwig Eichinger; Nabil Eid; Tobias Eisenberg; N Tony Eissa; Sanaa Eissa; Miriam Ejarque; Abdeljabar El Andaloussi; Nazira El-Hage; Shahenda El-Naggar; Anna Maria Eleuteri; Eman S El-Shafey; Mohamed Elgendy; Aristides G Eliopoulos; María M Elizalde; Philip M Elks; Hans-Peter Elsasser; Eslam S Elsherbiny; Brooke M Emerling; N C Tolga Emre; Christina H Eng; Nikolai Engedal; Anna-Mart Engelbrecht; Agnete S T Engelsen; Jorrit M Enserink; Ricardo Escalante; Audrey Esclatine; Mafalda Escobar-Henriques; Eeva-Liisa Eskelinen; Lucile Espert; Makandjou-Ola Eusebio; Gemma Fabrias; Cinzia Fabrizi; Antonio Facchiano; Francesco Facchiano; Bengt Fadeel; Claudio Fader; Alex C Faesen; W Douglas Fairlie; Alberto Falcó; Bjorn H Falkenburger; Daping Fan; Jie Fan; Yanbo Fan; Evandro F Fang; Yanshan Fang; Yognqi Fang; Manolis Fanto; Tamar Farfel-Becker; Mathias Faure; Gholamreza Fazeli; Anthony O Fedele; Arthur M Feldman; Du Feng; Jiachun Feng; Lifeng Feng; Yibin Feng; Yuchen Feng; Wei Feng; Thais Fenz Araujo; Thomas A Ferguson; Álvaro F Fernández; Jose C Fernandez-Checa; Sonia Fernández-Veledo; Alisdair R Fernie; Anthony W Ferrante; Alessandra Ferraresi; Merari F Ferrari; Julio C B Ferreira; Susan Ferro-Novick; Antonio Figueras; Riccardo Filadi; Nicoletta Filigheddu; Eduardo Filippi-Chiela; Giuseppe Filomeni; Gian Maria Fimia; Vittorio Fineschi; Francesca Finetti; Steven Finkbeiner; Edward A Fisher; Paul B Fisher; Flavio Flamigni; Steven J Fliesler; Trude H Flo; Ida Florance; Oliver Florey; Tullio Florio; Erika Fodor; Carlo Follo; Edward A Fon; Antonella Forlino; Francesco Fornai; Paola Fortini; Anna Fracassi; Alessandro Fraldi; Brunella Franco; Rodrigo Franco; Flavia Franconi; Lisa B Frankel; Scott L Friedman; Leopold F Fröhlich; Gema Frühbeck; Jose M Fuentes; Yukio Fujiki; Naonobu Fujita; Yuuki Fujiwara; Mitsunori Fukuda; Simone Fulda; Luc Furic; Norihiko Furuya; Carmela Fusco; Michaela U Gack; Lidia Gaffke; Sehamuddin Galadari; Alessia Galasso; Maria F Galindo; Sachith Gallolu Kankanamalage; Lorenzo Galluzzi; Vincent Galy; Noor Gammoh; Boyi Gan; Ian G Ganley; Feng Gao; Hui Gao; Minghui Gao; Ping Gao; Shou-Jiang Gao; Wentao Gao; Xiaobo Gao; Ana Garcera; Maria Noé Garcia; Verónica E Garcia; Francisco García-Del Portillo; Vega Garcia-Escudero; Aracely Garcia-Garcia; Marina Garcia-Macia; Diana García-Moreno; Carmen Garcia-Ruiz; Patricia García-Sanz; Abhishek D Garg; Ricardo Gargini; Tina Garofalo; Robert F Garry; Nils C Gassen; Damian Gatica; Liang Ge; Wanzhong Ge; Ruth Geiss-Friedlander; Cecilia Gelfi; Pascal Genschik; Ian E Gentle; Valeria Gerbino; Christoph Gerhardt; Kyla Germain; Marc Germain; David A Gewirtz; Elham Ghasemipour Afshar; Saeid Ghavami; Alessandra Ghigo; Manosij Ghosh; Georgios Giamas; Claudia Giampietri; Alexandra Giatromanolaki; Gary E Gibson; Spencer B Gibson; Vanessa Ginet; Edward Giniger; Carlotta Giorgi; Henrique Girao; Stephen E Girardin; Mridhula Giridharan; Sandy Giuliano; Cecilia Giulivi; Sylvie Giuriato; Julien Giustiniani; Alexander Gluschko; Veit Goder; Alexander Goginashvili; Jakub Golab; David C Goldstone; Anna Golebiewska; Luciana R Gomes; Rodrigo Gomez; Rubén Gómez-Sánchez; Maria Catalina Gomez-Puerto; Raquel Gomez-Sintes; Qingqiu Gong; Felix M Goni; Javier González-Gallego; Tomas Gonzalez-Hernandez; Rosa A Gonzalez-Polo; Jose A Gonzalez-Reyes; Patricia González-Rodríguez; Ing Swie Goping; Marina S Gorbatyuk; Nikolai V Gorbunov; Kıvanç Görgülü; Roxana M Gorojod; Sharon M Gorski; Sandro Goruppi; Cecilia Gotor; Roberta A Gottlieb; Illana Gozes; Devrim Gozuacik; Martin Graef; Markus H Gräler; Veronica Granatiero; Daniel Grasso; Joshua P Gray; Douglas R Green; Alexander Greenhough; Stephen L Gregory; Edward F Griffin; Mark W Grinstaff; Frederic Gros; Charles Grose; Angelina S Gross; Florian Gruber; Paolo Grumati; Tilman Grune; Xueyan Gu; Jun-Lin Guan; Carlos M Guardia; Kishore Guda; Flora Guerra; Consuelo Guerri; Prasun Guha; Carlos Guillén; Shashi Gujar; Anna Gukovskaya; Ilya Gukovsky; Jan Gunst; Andreas Günther; Anyonya R Guntur; Chuanyong Guo; Chun Guo; Hongqing Guo; Lian-Wang Guo; Ming Guo; Pawan Gupta; Shashi Kumar Gupta; Swapnil Gupta; Veer Bala Gupta; Vivek Gupta; Asa B Gustafsson; David D Gutterman; Ranjitha H B; Annakaisa Haapasalo; James E Haber; Aleksandra Hać; Shinji Hadano; Anders J Hafrén; Mansour Haidar; Belinda S Hall; Gunnel Halldén; Anne Hamacher-Brady; Andrea Hamann; Maho Hamasaki; Weidong Han; Malene Hansen; Phyllis I Hanson; Zijian Hao; Masaru Harada; Ljubica Harhaji-Trajkovic; Nirmala Hariharan; Nigil Haroon; James Harris; Takafumi Hasegawa; Noor Hasima Nagoor; Jeffrey A Haspel; Volker Haucke; Wayne D Hawkins; Bruce A Hay; Cole M Haynes; Soren B Hayrabedyan; Thomas S Hays; Congcong He; Qin He; Rong-Rong He; You-Wen He; Yu-Ying He; Yasser Heakal; Alexander M Heberle; J Fielding Hejtmancik; Gudmundur Vignir Helgason; Vanessa Henkel; Marc Herb; Alexander Hergovich; Anna Herman-Antosiewicz; Agustín Hernández; Carlos Hernandez; Sergio Hernandez-Diaz; Virginia Hernandez-Gea; Amaury Herpin; Judit Herreros; Javier H Hervás; Daniel Hesselson; Claudio Hetz; Volker T Heussler; Yujiro Higuchi; Sabine Hilfiker; Joseph A Hill; William S Hlavacek; Emmanuel A Ho; Idy H T Ho; Philip Wing-Lok Ho; Shu-Leong Ho; Wan Yun Ho; G Aaron Hobbs; Mark Hochstrasser; Peter H M Hoet; Daniel Hofius; Paul Hofman; Annika Höhn; Carina I Holmberg; Jose R Hombrebueno; Chang-Won Hong Yi-Ren Hong; Lora V Hooper; Thorsten Hoppe; Rastislav Horos; Yujin Hoshida; I-Lun Hsin; Hsin-Yun Hsu; Bing Hu; Dong Hu; Li-Fang Hu; Ming Chang Hu; Ronggui Hu; Wei Hu; Yu-Chen Hu; Zhuo-Wei Hu; Fang Hua; Jinlian Hua; Yingqi Hua; Chongmin Huan; Canhua Huang; Chuanshu Huang; Chuanxin Huang; Chunling Huang; Haishan Huang; Kun Huang; Michael L H Huang; Rui Huang; Shan Huang; Tianzhi Huang; Xing Huang; Yuxiang Jack Huang; Tobias B Huber; Virginie Hubert; Christian A Hubner; Stephanie M Hughes; William E Hughes; Magali Humbert; Gerhard Hummer; James H Hurley; Sabah Hussain; Salik Hussain; Patrick J Hussey; Martina Hutabarat; Hui-Yun Hwang; Seungmin Hwang; Antonio Ieni; Fumiyo Ikeda; Yusuke Imagawa; Yuzuru Imai; Carol Imbriano; Masaya Imoto; Denise M Inman; Ken Inoki; Juan Iovanna; Renato V Iozzo; Giuseppe Ippolito; Javier E Irazoqui; Pablo Iribarren; Mohd Ishaq; Makoto Ishikawa; Nestor Ishimwe; Ciro Isidoro; Nahed Ismail; Shohreh Issazadeh-Navikas; Eisuke Itakura; Daisuke Ito; Davor Ivankovic; Saška Ivanova; Anand Krishnan V Iyer; José M Izquierdo; Masanori Izumi; Marja Jäättelä; Majid Sakhi Jabir; William T Jackson; Nadia Jacobo-Herrera; Anne-Claire Jacomin; Elise Jacquin; Pooja Jadiya; Hartmut Jaeschke; Chinnaswamy Jagannath; Arjen J Jakobi; Johan Jakobsson; Bassam Janji; Pidder Jansen-Dürr; Patric J Jansson; Jonathan Jantsch; Sławomir Januszewski; Alagie Jassey; Steve Jean; Hélène Jeltsch-David; Pavla Jendelova; Andreas Jenny; Thomas E Jensen; Niels Jessen; Jenna L Jewell; Jing Ji; Lijun Jia; Rui Jia; Liwen Jiang; Qing Jiang; Richeng Jiang; Teng Jiang; Xuejun Jiang; Yu Jiang; Maria Jimenez-Sanchez; Eun-Jung Jin; Fengyan Jin; Hongchuan Jin; Li Jin; Luqi Jin; Meiyan Jin; Si Jin; Eun-Kyeong Jo; Carine Joffre; Terje Johansen; Gail V W Johnson; Simon A Johnston; Eija Jokitalo; Mohit Kumar Jolly; Leo A B Joosten; Joaquin Jordan; Bertrand Joseph; Dianwen Ju; Jeong-Sun Ju; Jingfang Ju; Esmeralda Juárez; Delphine Judith; Gábor Juhász; Youngsoo Jun; Chang Hwa Jung; Sung-Chul Jung; Yong Keun Jung; Heinz Jungbluth; Johannes Jungverdorben; Steffen Just; Kai Kaarniranta; Allen Kaasik; Tomohiro Kabuta; Daniel Kaganovich; Alon Kahana; Renate Kain; Shinjo Kajimura; Maria Kalamvoki; Manjula Kalia; Danuta S Kalinowski; Nina Kaludercic; Ioanna Kalvari; Joanna Kaminska; Vitaliy O Kaminskyy; Hiromitsu Kanamori; Keizo Kanasaki; Chanhee Kang; Rui Kang; Sang Sun Kang; Senthilvelrajan Kaniyappan; Tomotake Kanki; Thirumala-Devi Kanneganti; Anumantha G Kanthasamy; Arthi Kanthasamy; Marc Kantorow; Orsolya Kapuy; Michalis V Karamouzis; Md Razaul Karim; Parimal Karmakar; Rajesh G Katare; Masaru Kato; Stefan H E Kaufmann; Anu Kauppinen; Gur P Kaushal; Susmita Kaushik; Kiyoshi Kawasaki; Kemal Kazan; Po-Yuan Ke; Damien J Keating; Ursula Keber; John H Kehrl; Kate E Keller; Christian W Keller; Jongsook Kim Kemper; Candia M Kenific; Oliver Kepp; Stephanie Kermorgant; Andreas Kern; Robin Ketteler; Tom G Keulers; Boris Khalfin; Hany Khalil; Bilon Khambu; Shahid Y Khan; Vinoth Kumar Megraj Khandelwal; Rekha Khandia; Widuri Kho; Noopur V Khobrekar; Sataree Khuansuwan; Mukhran Khundadze; Samuel A Killackey; Dasol Kim; Deok Ryong Kim; Do-Hyung Kim; Dong-Eun Kim; Eun Young Kim; Eun-Kyoung Kim; Hak-Rim Kim; Hee-Sik Kim; Jeong Hun Kim; Jin Kyung Kim; Jin-Hoi Kim; Joungmok Kim; Ju Hwan Kim; Keun Il Kim; Peter K Kim; Seong-Jun Kim; Scot R Kimball; Adi Kimchi; Alec C Kimmelman; Tomonori Kimura; Matthew A King; Kerri J Kinghorn; Conan G Kinsey; Vladimir Kirkin; Lorrie A Kirshenbaum; Sergey L Kiselev; Shuji Kishi; Katsuhiko Kitamoto; Yasushi Kitaoka; Kaio Kitazato; Richard N Kitsis; Josef T Kittler; Ole Kjaerulff; Peter S Klein; Thomas Klopstock; Jochen Klucken; Helene Knævelsrud; Roland L Knorr; Ben C B Ko; Fred Ko; Jiunn-Liang Ko; Hotaka Kobayashi; Satoru Kobayashi; Ina Koch; Jan C Koch; Ulrich Koenig; Donat Kögel; Young Ho Koh; Masato Koike; Sepp D Kohlwein; Nur M Kocaturk; Masaaki Komatsu; Jeannette König; Toru Kono; Benjamin T Kopp; Tamas Korcsmaros; Gözde Korkmaz; Viktor I Korolchuk; Mónica Suárez Korsnes; Ali Koskela; Janaiah Kota; Yaichiro Kotake; Monica L Kotler; Yanjun Kou; Michael I Koukourakis; Evangelos Koustas; Attila L Kovacs; Tibor Kovács; Daisuke Koya; Tomohiro Kozako; Claudine Kraft; Dimitri Krainc; Helmut Krämer; Anna D Krasnodembskaya; Carole Kretz-Remy; Guido Kroemer; Nicholas T Ktistakis; Kazuyuki Kuchitsu; Sabine Kuenen; Lars Kuerschner; Thomas Kukar; Ajay Kumar; Ashok Kumar; Deepak Kumar; Dhiraj Kumar; Sharad Kumar; Shinji Kume; Caroline Kumsta; Chanakya N Kundu; Mondira Kundu; Ajaikumar B Kunnumakkara; Lukasz Kurgan; Tatiana G Kutateladze; Ozlem Kutlu; SeongAe Kwak; Ho Jeong Kwon; Taeg Kyu Kwon; Yong Tae Kwon; Irene Kyrmizi; Albert La Spada; Patrick Labonté; Sylvain Ladoire; Ilaria Laface; Frank Lafont; Diane C Lagace; Vikramjit Lahiri; Zhibing Lai; Angela S Laird; Aparna Lakkaraju; Trond Lamark; Sheng-Hui Lan; Ane Landajuela; Darius J R Lane; Jon D Lane; Charles H Lang; Carsten Lange; Ülo Langel; Rupert Langer; Pierre Lapaquette; Jocelyn Laporte; Nicholas F LaRusso; Isabel Lastres-Becker; Wilson Chun Yu Lau; Gordon W Laurie; Sergio Lavandero; Betty Yuen Kwan Law; Helen Ka-Wai Law; Rob Layfield; Weidong Le; Herve Le Stunff; Alexandre Y Leary; Jean-Jacques Lebrun; Lionel Y W Leck; Jean-Philippe Leduc-Gaudet; Changwook Lee; Chung-Pei Lee; Da-Hye Lee; Edward B Lee; Erinna F Lee; Gyun Min Lee; He-Jin Lee; Heung Kyu Lee; Jae Man Lee; Jason S Lee; Jin-A Lee; Joo-Yong Lee; Jun Hee Lee; Michael Lee; Min Goo Lee; Min Jae Lee; Myung-Shik Lee; Sang Yoon Lee; Seung-Jae Lee; Stella Y Lee; Sung Bae Lee; Won Hee Lee; Ying-Ray Lee; Yong-Ho Lee; Youngil Lee; Christophe Lefebvre; Renaud Legouis; Yu L Lei; Yuchen Lei; Sergey Leikin; Gerd Leitinger; Leticia Lemus; Shuilong Leng; Olivia Lenoir; Guido Lenz; Heinz Josef Lenz; Paola Lenzi; Yolanda León; Andréia M Leopoldino; Christoph Leschczyk; Stina Leskelä; Elisabeth Letellier; Chi-Ting Leung; Po Sing Leung; Jeremy S Leventhal; Beth Levine; Patrick A Lewis; Klaus Ley; Bin Li; Da-Qiang Li; Jianming Li; Jing Li; Jiong Li; Ke Li; Liwu Li; Mei Li; Min Li; Min Li; Ming Li; Mingchuan Li; Pin-Lan Li; Ming-Qing Li; Qing Li; Sheng Li; Tiangang Li; Wei Li; Wenming Li; Xue Li; Yi-Ping Li; Yuan Li; Zhiqiang Li; Zhiyong Li; Zhiyuan Li; Jiqin Lian; Chengyu Liang; Qiangrong Liang; Weicheng Liang; Yongheng Liang; YongTian Liang; Guanghong Liao; Lujian Liao; Mingzhi Liao; Yung-Feng Liao; Mariangela Librizzi; Pearl P Y Lie; Mary A Lilly; Hyunjung J Lim; Thania R R Lima; Federica Limana; Chao Lin; Chih-Wen Lin; Dar-Shong Lin; Fu-Cheng Lin; Jiandie D Lin; Kurt M Lin; Kwang-Huei Lin; Liang-Tzung Lin; Pei-Hui Lin; Qiong Lin; Shaofeng Lin; Su-Ju Lin; Wenyu Lin; Xueying Lin; Yao-Xin Lin; Yee-Shin Lin; Rafael Linden; Paula Lindner; Shuo-Chien Ling; Paul Lingor; Amelia K Linnemann; Yih-Cherng Liou; Marta M Lipinski; Saška Lipovšek; Vitor A Lira; Natalia Lisiak; Paloma B Liton; Chao Liu; Ching-Hsuan Liu; Chun-Feng Liu; Cui Hua Liu; Fang Liu; Hao Liu; Hsiao-Sheng Liu; Hua-Feng Liu; Huifang Liu; Jia Liu; Jing Liu; Julia Liu; Leyuan Liu; Longhua Liu; Meilian Liu; Qin Liu; Wei Liu; Wende Liu; Xiao-Hong Liu; Xiaodong Liu; Xingguo Liu; Xu Liu; Xuedong Liu; Yanfen Liu; Yang Liu; Yang Liu; Yueyang Liu; Yule Liu; J Andrew Livingston; Gerard Lizard; Jose M Lizcano; Senka Ljubojevic-Holzer; Matilde E LLeonart; David Llobet-Navàs; Alicia Llorente; Chih Hung Lo; Damián Lobato-Márquez; Qi Long; Yun Chau Long; Ben Loos; Julia A Loos; Manuela G López; Guillermo López-Doménech; José Antonio López-Guerrero; Ana T López-Jiménez; Óscar López-Pérez; Israel López-Valero; Magdalena J Lorenowicz; Mar Lorente; Peter Lorincz; Laura Lossi; Sophie Lotersztajn; Penny E Lovat; Jonathan F Lovell; Alenka Lovy; Péter Lőw; Guang Lu; Haocheng Lu; Jia-Hong Lu; Jin-Jian Lu; Mengji Lu; Shuyan Lu; Alessandro Luciani; John M Lucocq; Paula Ludovico; Micah A Luftig; Morten Luhr; Diego Luis-Ravelo; Julian J Lum; Liany Luna-Dulcey; Anders H Lund; Viktor K Lund; Jan D Lünemann; Patrick Lüningschrör; Honglin Luo; Rongcan Luo; Shouqing Luo; Zhi Luo; Claudio Luparello; Bernhard Lüscher; Luan Luu; Alex Lyakhovich; Konstantin G Lyamzaev; Alf Håkon Lystad; Lyubomyr Lytvynchuk; Alvin C Ma; Changle Ma; Mengxiao Ma; Ning-Fang Ma; Quan-Hong Ma; Xinliang Ma; Yueyun Ma; Zhenyi Ma; Ormond A MacDougald; Fernando Macian; Gustavo C MacIntosh; Jeffrey P MacKeigan; Kay F Macleod; Sandra Maday; Frank Madeo; Muniswamy Madesh; Tobias Madl; Julio Madrigal-Matute; Akiko Maeda; Yasuhiro Maejima; Marta Magarinos; Poornima Mahavadi; Emiliano Maiani; Kenneth Maiese; Panchanan Maiti; Maria Chiara Maiuri; Barbara Majello; Michael B Major; Elena Makareeva; Fayaz Malik; Karthik Mallilankaraman; Walter Malorni; Alina Maloyan; Najiba Mammadova; Gene Chi Wai Man; Federico Manai; Joseph D Mancias; Eva-Maria Mandelkow; Michael A Mandell; Angelo A Manfredi; Masoud H Manjili; Ravi Manjithaya; Patricio Manque; Bella B Manshian; Raquel Manzano; Claudia Manzoni; Kai Mao; Cinzia Marchese; Sandrine Marchetti; Anna Maria Marconi; Fabrizio Marcucci; Stefania Mardente; Olga A Mareninova; Marta Margeta; Muriel Mari; Sara Marinelli; Oliviero Marinelli; Guillermo Mariño; Sofia Mariotto; Richard S Marshall; Mark R Marten; Sascha Martens; Alexandre P J Martin; Katie R Martin; Sara Martin; Shaun Martin; Adrián Martín-Segura; Miguel A Martín-Acebes; Inmaculada Martin-Burriel; Marcos Martin-Rincon; Paloma Martin-Sanz; José A Martina; Wim Martinet; Aitor Martinez; Ana Martinez; Jennifer Martinez; Moises Martinez Velazquez; Nuria Martinez-Lopez; Marta Martinez-Vicente; Daniel O Martins; Joilson O Martins; Waleska K Martins; Tania Martins-Marques; Emanuele Marzetti; Shashank Masaldan; Celine Masclaux-Daubresse; Douglas G Mashek; Valentina Massa; Lourdes Massieu; Glenn R Masson; Laura Masuelli; Anatoliy I Masyuk; Tetyana V Masyuk; Paola Matarrese; Ander Matheu; Satoaki Matoba; Sachiko Matsuzaki; Pamela Mattar; Alessandro Matte; Domenico Mattoscio; José L Mauriz; Mario Mauthe; Caroline Mauvezin; Emanual Maverakis; Paola Maycotte; Johanna Mayer; Gianluigi Mazzoccoli; Cristina Mazzoni; Joseph R Mazzulli; Nami McCarty; Christine McDonald; Mitchell R McGill; Sharon L McKenna; BethAnn McLaughlin; Fionn McLoughlin; Mark A McNiven; Thomas G McWilliams; Fatima Mechta-Grigoriou; Tania Catarina Medeiros; Diego L Medina; Lynn A Megeney; Klara Megyeri; Maryam Mehrpour; Jawahar L Mehta; Alfred J Meijer; Annemarie H Meijer; Jakob Mejlvang; Alicia Meléndez; Annette Melk; Gonen Memisoglu; Alexandrina F Mendes; Delong Meng; Fei Meng; Tian Meng; Rubem Menna-Barreto; Manoj B Menon; Carol Mercer; Anne E Mercier; Jean-Louis Mergny; Adalberto Merighi; Seth D Merkley; Giuseppe Merla; Volker Meske; Ana Cecilia Mestre; Shree Padma Metur; Christian Meyer; Hemmo Meyer; Wenyi Mi; Jeanne Mialet-Perez; Junying Miao; Lucia Micale; Yasuo Miki; Enrico Milan; Małgorzata Milczarek; Dana L Miller; Samuel I Miller; Silke Miller; Steven W Millward; Ira Milosevic; Elena A Minina; Hamed Mirzaei; Hamid Reza Mirzaei; Mehdi Mirzaei; Amit Mishra; Nandita Mishra; Paras Kumar Mishra; Maja Misirkic Marjanovic; Roberta Misasi; Amit Misra; Gabriella Misso; Claire Mitchell; Geraldine Mitou; Tetsuji Miura; Shigeki Miyamoto; Makoto Miyazaki; Mitsunori Miyazaki; Taiga Miyazaki; Keisuke Miyazawa; Noboru Mizushima; Trine H Mogensen; Baharia Mograbi; Reza Mohammadinejad; Yasir Mohamud; Abhishek Mohanty; Sipra Mohapatra; Torsten Möhlmann; Asif Mohmmed; Anna Moles; Kelle H Moley; Maurizio Molinari; Vincenzo Mollace; Andreas Buch Møller; Bertrand Mollereau; Faustino Mollinedo; Costanza Montagna; Mervyn J Monteiro; Andrea Montella; L Ruth Montes; Barbara Montico; Vinod K Mony; Giacomo Monzio Compagnoni; Michael N Moore; Mohammad A Moosavi; Ana L Mora; Marina Mora; David Morales-Alamo; Rosario Moratalla; Paula I Moreira; Elena Morelli; Sandra Moreno; Daniel Moreno-Blas; Viviana Moresi; Benjamin Morga; Alwena H Morgan; Fabrice Morin; Hideaki Morishita; Orson L Moritz; Mariko Moriyama; Yuji Moriyasu; Manuela Morleo; Eugenia Morselli; Jose F Moruno-Manchon; Jorge Moscat; Serge Mostowy; Elisa Motori; Andrea Felinto Moura; Naima Moustaid-Moussa; Maria Mrakovcic; Gabriel Muciño-Hernández; Anupam Mukherjee; Subhadip Mukhopadhyay; Jean M Mulcahy Levy; Victoriano Mulero; Sylviane Muller; Christian Münch; Ashok Munjal; Pura Munoz-Canoves; Teresa Muñoz-Galdeano; Christian Münz; Tomokazu Murakawa; Claudia Muratori; Brona M Murphy; J Patrick Murphy; Aditya Murthy; Timo T Myöhänen; Indira U Mysorekar; Jennifer Mytych; Seyed Mohammad Nabavi; Massimo Nabissi; Péter Nagy; Jihoon Nah; Aimable Nahimana; Ichiro Nakagawa; Ken Nakamura; Hitoshi Nakatogawa; Shyam S Nandi; Meera Nanjundan; Monica Nanni; Gennaro Napolitano; Roberta Nardacci; Masashi Narita; Melissa Nassif; Ilana Nathan; Manabu Natsumeda; Ryno J Naude; Christin Naumann; Olaia Naveiras; Fatemeh Navid; Steffan T Nawrocki; Taras Y Nazarko; Francesca Nazio; Florentina Negoita; Thomas Neill; Amanda L Neisch; Luca M Neri; Mihai G Netea; Patrick Neubert; Thomas P Neufeld; Dietbert Neumann; Albert Neutzner; Phillip T Newton; Paul A Ney; Ioannis P Nezis; Charlene C W Ng; Tzi Bun Ng; Hang T T Nguyen; Long T Nguyen; Hong-Min Ni; Clíona Ní Cheallaigh; Zhenhong Ni; M Celeste Nicolao; Francesco Nicoli; Manuel Nieto-Diaz; Per Nilsson; Shunbin Ning; Rituraj Niranjan; Hiroshi Nishimune; Mireia Niso-Santano; Ralph A Nixon; Annalisa Nobili; Clevio Nobrega; Takeshi Noda; Uxía Nogueira-Recalde; Trevor M Nolan; Ivan Nombela; Ivana Novak; Beatriz Novoa; Takashi Nozawa; Nobuyuki Nukina; Carmen Nussbaum-Krammer; Jesper Nylandsted; Tracey R O'Donovan; Seónadh M O'Leary; Eyleen J O'Rourke; Mary P O'Sullivan; Timothy E O'Sullivan; Salvatore Oddo; Ina Oehme; Michinaga Ogawa; Eric Ogier-Denis; Margret H Ogmundsdottir; Besim Ogretmen; Goo Taeg Oh; Seon-Hee Oh; Young J Oh; Takashi Ohama; Yohei Ohashi; Masaki Ohmuraya; Vasileios Oikonomou; Rani Ojha; Koji Okamoto; Hitoshi Okazawa; Masahide Oku; Sara Oliván; Jorge M A Oliveira; Michael Ollmann; James A Olzmann; Shakib Omari; M Bishr Omary; Gizem Önal; Martin Ondrej; Sang-Bing Ong; Sang-Ging Ong; Anna Onnis; Juan A Orellana; Sara Orellana-Muñoz; Maria Del Mar Ortega-Villaizan; Xilma R Ortiz-Gonzalez; Elena Ortona; Heinz D Osiewacz; Abdel-Hamid K Osman; Rosario Osta; Marisa S Otegui; Kinya Otsu; Christiane Ott; Luisa Ottobrini; Jing-Hsiung James Ou; Tiago F Outeiro; Inger Oynebraten; Melek Ozturk; Gilles Pagès; Susanta Pahari; Marta Pajares; Utpal B Pajvani; Rituraj Pal; Simona Paladino; Nicolas Pallet; Michela Palmieri; Giuseppe Palmisano; Camilla Palumbo; Francesco Pampaloni; Lifeng Pan; Qingjun Pan; Wenliang Pan; Xin Pan; Ganna Panasyuk; Rahul Pandey; Udai B Pandey; Vrajesh Pandya; Francesco Paneni; Shirley Y Pang; Elisa Panzarini; Daniela L Papademetrio; Elena Papaleo; Daniel Papinski; Diana Papp; Eun Chan Park; Hwan Tae Park; Ji-Man Park; Jong-In Park; Joon Tae Park; Junsoo Park; Sang Chul Park; Sang-Youel Park; Abraham H Parola; Jan B Parys; Adrien Pasquier; Benoit Pasquier; João F Passos; Nunzia Pastore; Hemal H Patel; Daniel Patschan; Sophie Pattingre; Gustavo Pedraza-Alva; Jose Pedraza-Chaverri; Zully Pedrozo; Gang Pei; Jianming Pei; Hadas Peled-Zehavi; Joaquín M Pellegrini; Joffrey Pelletier; Miguel A Peñalva; Di Peng; Ying Peng; Fabio Penna; Maria Pennuto; Francesca Pentimalli; Cláudia Mf Pereira; Gustavo J S Pereira; Lilian C Pereira; Luis Pereira de Almeida; Nirma D Perera; Ángel Pérez-Lara; Ana B Perez-Oliva; María Esther Pérez-Pérez; Palsamy Periyasamy; Andras Perl; Cristiana Perrotta; Ida Perrotta; Richard G Pestell; Morten Petersen; Irina Petrache; Goran Petrovski; Thorsten Pfirrmann; Astrid S Pfister; Jennifer A Philips; Huifeng Pi; Anna Picca; Alicia M Pickrell; Sandy Picot; Giovanna M Pierantoni; Marina Pierdominici; Philippe Pierre; Valérie Pierrefite-Carle; Karolina Pierzynowska; Federico Pietrocola; Miroslawa Pietruczuk; Claudio Pignata; Felipe X Pimentel-Muiños; Mario Pinar; Roberta O Pinheiro; Ronit Pinkas-Kramarski; Paolo Pinton; Karolina Pircs; Sujan Piya; Paola Pizzo; Theo S Plantinga; Harald W Platta; Ainhoa Plaza-Zabala; Markus Plomann; Egor Y Plotnikov; Helene Plun-Favreau; Ryszard Pluta; Roger Pocock; Stefanie Pöggeler; Christian Pohl; Marc Poirot; Angelo Poletti; Marisa Ponpuak; Hana Popelka; Blagovesta Popova; Helena Porta; Soledad Porte Alcon; Eliana Portilla-Fernandez; Martin Post; Malia B Potts; Joanna Poulton; Ted Powers; Veena Prahlad; Tomasz K Prajsnar; Domenico Praticò; Rosaria Prencipe; Muriel Priault; Tassula Proikas-Cezanne; Vasilis J Promponas; Christopher G Proud; Rosa Puertollano; Luigi Puglielli; Thomas Pulinilkunnil; Deepika Puri; Rajat Puri; Julien Puyal; Xiaopeng Qi; Yongmei Qi; Wenbin Qian; Lei Qiang; Yu Qiu; Joe Quadrilatero; Jorge Quarleri; Nina Raben; Hannah Rabinowich; Debora Ragona; Michael J Ragusa; Nader Rahimi; Marveh Rahmati; Valeria Raia; Nuno Raimundo; Namakkal-Soorappan Rajasekaran; Sriganesh Ramachandra Rao; Abdelhaq Rami; Ignacio Ramírez-Pardo; David B Ramsden; Felix Randow; Pundi N Rangarajan; Danilo Ranieri; Hai Rao; Lang Rao; Rekha Rao; Sumit Rathore; J Arjuna Ratnayaka; Edward A Ratovitski; Palaniyandi Ravanan; Gloria Ravegnini; Swapan K Ray; Babak Razani; Vito Rebecca; Fulvio Reggiori; Anne Régnier-Vigouroux; Andreas S Reichert; David Reigada; Jan H Reiling; Theo Rein; Siegfried Reipert; Rokeya Sultana Rekha; Hongmei Ren; Jun Ren; Weichao Ren; Tristan Renault; Giorgia Renga; Karen Reue; Kim Rewitz; Bruna Ribeiro de Andrade Ramos; S Amer Riazuddin; Teresa M Ribeiro-Rodrigues; Jean-Ehrland Ricci; Romeo Ricci; Victoria Riccio; Des R Richardson; Yasuko Rikihisa; Makarand V Risbud; Ruth M Risueño; Konstantinos Ritis; Salvatore Rizza; Rosario Rizzuto; Helen C Roberts; Luke D Roberts; Katherine J Robinson; Maria Carmela Roccheri; Stephane Rocchi; George G Rodney; Tiago Rodrigues; Vagner Ramon Rodrigues Silva; Amaia Rodriguez; Ruth Rodriguez-Barrueco; Nieves Rodriguez-Henche; Humberto Rodriguez-Rocha; Jeroen Roelofs; Robert S Rogers; Vladimir V Rogov; Ana I Rojo; Krzysztof Rolka; Vanina Romanello; Luigina Romani; Alessandra Romano; Patricia S Romano; David Romeo-Guitart; Luis C Romero; Montserrat Romero; Joseph C Roney; Christopher Rongo; Sante Roperto; Mathias T Rosenfeldt; Philip Rosenstiel; Anne G Rosenwald; Kevin A Roth; Lynn Roth; Steven Roth; Kasper M A Rouschop; Benoit D Roussel; Sophie Roux; Patrizia Rovere-Querini; Ajit Roy; Aurore Rozieres; Diego Ruano; David C Rubinsztein; Maria P Rubtsova; Klaus Ruckdeschel; Christoph Ruckenstuhl; Emil Rudolf; Rüdiger Rudolf; Alessandra Ruggieri; Avnika Ashok Ruparelia; Paola Rusmini; Ryan R Russell; Gian Luigi Russo; Maria Russo; Rossella Russo; Oxana O Ryabaya; Kevin M Ryan; Kwon-Yul Ryu; Maria Sabater-Arcis; Ulka Sachdev; Michael Sacher; Carsten Sachse; Abhishek Sadhu; Junichi Sadoshima; Nathaniel Safren; Paul Saftig; Antonia P Sagona; Gaurav Sahay; Amirhossein Sahebkar; Mustafa Sahin; Ozgur Sahin; Sumit Sahni; Nayuta Saito; Shigeru Saito; Tsunenori Saito; Ryohei Sakai; Yasuyoshi Sakai; Jun-Ichi Sakamaki; Kalle Saksela; Gloria Salazar; Anna Salazar-Degracia; Ghasem H Salekdeh; Ashok K Saluja; Belém Sampaio-Marques; Maria Cecilia Sanchez; Jose A Sanchez-Alcazar; Victoria Sanchez-Vera; Vanessa Sancho-Shimizu; J Thomas Sanderson; Marco Sandri; Stefano Santaguida; Laura Santambrogio; Magda M Santana; Giorgio Santoni; Alberto Sanz; Pascual Sanz; Shweta Saran; Marco Sardiello; Timothy J Sargeant; Apurva Sarin; Chinmoy Sarkar; Sovan Sarkar; Maria-Rosa Sarrias; Surajit Sarkar; Dipanka Tanu Sarmah; Jaakko Sarparanta; Aishwarya Sathyanarayan; Ranganayaki Sathyanarayanan; K Matthew Scaglione; Francesca Scatozza; Liliana Schaefer; Zachary T Schafer; Ulrich E Schaible; Anthony H V Schapira; Michael Scharl; Hermann M Schatzl; Catherine H Schein; Wiep Scheper; David Scheuring; Maria Vittoria Schiaffino; Monica Schiappacassi; Rainer Schindl; Uwe Schlattner; Oliver Schmidt; Roland Schmitt; Stephen D Schmidt; Ingo Schmitz; Eran Schmukler; Anja Schneider; Bianca E Schneider; Romana Schober; Alejandra C Schoijet; Micah B Schott; Michael Schramm; Bernd Schröder; Kai Schuh; Christoph Schüller; Ryan J Schulze; Lea Schürmanns; Jens C Schwamborn; Melanie Schwarten; Filippo Scialo; Sebastiano Sciarretta; Melanie J Scott; Kathleen W Scotto; A Ivana Scovassi; Andrea Scrima; Aurora Scrivo; David Sebastian; Salwa Sebti; Simon Sedej; Laura Segatori; Nava Segev; Per O Seglen; Iban Seiliez; Ekihiro Seki; Scott B Selleck; Frank W Sellke; Joshua T Selsby; Michael Sendtner; Serif Senturk; Elena Seranova; Consolato Sergi; Ruth Serra-Moreno; Hiromi Sesaki; Carmine Settembre; Subba Rao Gangi Setty; Gianluca Sgarbi; Ou Sha; John J Shacka; Javeed A Shah; Dantong Shang; Changshun Shao; Feng Shao; Soroush Sharbati; Lisa M Sharkey; Dipali Sharma; Gaurav Sharma; Kulbhushan Sharma; Pawan Sharma; Surendra Sharma; Han-Ming Shen; Hongtao Shen; Jiangang Shen; Ming Shen; Weili Shen; Zheni Shen; Rui Sheng; Zhi Sheng; Zu-Hang Sheng; Jianjian Shi; Xiaobing Shi; Ying-Hong Shi; Kahori Shiba-Fukushima; Jeng-Jer Shieh; Yohta Shimada; Shigeomi Shimizu; Makoto Shimozawa; Takahiro Shintani; Christopher J Shoemaker; Shahla Shojaei; Ikuo Shoji; Bhupendra V Shravage; Viji Shridhar; Chih-Wen Shu; Hong-Bing Shu; Ke Shui; Arvind K Shukla; Timothy E Shutt; Valentina Sica; Aleem Siddiqui; Amanda Sierra; Virginia Sierra-Torre; Santiago Signorelli; Payel Sil; Bruno J de Andrade Silva; Johnatas D Silva; Eduardo Silva-Pavez; Sandrine Silvente-Poirot; Rachel E Simmonds; Anna Katharina Simon; Hans-Uwe Simon; Matias Simons; Anurag Singh; Lalit P Singh; Rajat Singh; Shivendra V Singh; Shrawan K Singh; Sudha B Singh; Sunaina Singh; Surinder Pal Singh; Debasish Sinha; Rohit Anthony Sinha; Sangita Sinha; Agnieszka Sirko; Kapil Sirohi; Efthimios L Sivridis; Panagiotis Skendros; Aleksandra Skirycz; Iva Slaninová; Soraya S Smaili; Andrei Smertenko; Matthew D Smith; Stefaan J Soenen; Eun Jung Sohn; Sophia P M Sok; Giancarlo Solaini; Thierry Soldati; Scott A Soleimanpour; Rosa M Soler; Alexei Solovchenko; Jason A Somarelli; Avinash Sonawane; Fuyong Song; Hyun Kyu Song; Ju-Xian Song; Kunhua Song; Zhiyin Song; Leandro R Soria; Maurizio Sorice; Alexander A Soukas; Sandra-Fausia Soukup; Diana Sousa; Nadia Sousa; Paul A Spagnuolo; Stephen A Spector; M M Srinivas Bharath; Daret St Clair; Venturina Stagni; Leopoldo Staiano; Clint A Stalnecker; Metodi V Stankov; Peter B Stathopulos; Katja Stefan; Sven Marcel Stefan; Leonidas Stefanis; Joan S Steffan; Alexander Steinkasserer; Harald Stenmark; Jared Sterneckert; Craig Stevens; Veronika Stoka; Stephan Storch; Björn Stork; Flavie Strappazzon; Anne Marie Strohecker; Dwayne G Stupack; Huanxing Su; Ling-Yan Su; Longxiang Su; Ana M Suarez-Fontes; Carlos S Subauste; Selvakumar Subbian; Paula V Subirada; Ganapasam Sudhandiran; Carolyn M Sue; Xinbing Sui; Corey Summers; Guangchao Sun; Jun Sun; Kang Sun; Meng-Xiang Sun; Qiming Sun; Yi Sun; Zhongjie Sun; Karen K S Sunahara; Eva Sundberg; Katalin Susztak; Peter Sutovsky; Hidekazu Suzuki; Gary Sweeney; J David Symons; Stephen Cho Wing Sze; Nathaniel J Szewczyk; Anna Tabęcka-Łonczynska; Claudio Tabolacci; Frank Tacke; Heinrich Taegtmeyer; Marco Tafani; Mitsuo Tagaya; Haoran Tai; Stephen W G Tait; Yoshinori Takahashi; Szabolcs Takats; Priti Talwar; Chit Tam; Shing Yau Tam; Davide Tampellini; Atsushi Tamura; Chong Teik Tan; Eng-King Tan; Ya-Qin Tan; Masaki Tanaka; Motomasa Tanaka; Daolin Tang; Jingfeng Tang; Tie-Shan Tang; Isei Tanida; Zhipeng Tao; Mohammed Taouis; Lars Tatenhorst; Nektarios Tavernarakis; Allen Taylor; Gregory A Taylor; Joan M Taylor; Elena Tchetina; Andrew R Tee; Irmgard Tegeder; David Teis; Natercia Teixeira; Fatima Teixeira-Clerc; Kumsal A Tekirdag; Tewin Tencomnao; Sandra Tenreiro; Alexei V Tepikin; Pilar S Testillano; Gianluca Tettamanti; Pierre-Louis Tharaux; Kathrin Thedieck; Arvind A Thekkinghat; Stefano Thellung; Josephine W Thinwa; V P Thirumalaikumar; Sufi Mary Thomas; Paul G Thomes; Andrew Thorburn; Lipi Thukral; Thomas Thum; Michael Thumm; Ling Tian; Ales Tichy; Andreas Till; Vincent Timmerman; Vladimir I Titorenko; Sokol V Todi; Krassimira Todorova; Janne M Toivonen; Luana Tomaipitinca; Dhanendra Tomar; Cristina Tomas-Zapico; Sergej Tomić; Benjamin Chun-Kit Tong; Chao Tong; Xin Tong; Sharon A Tooze; Maria L Torgersen; Satoru Torii; Liliana Torres-López; Alicia Torriglia; Christina G Towers; Roberto Towns; Shinya Toyokuni; Vladimir Trajkovic; Donatella Tramontano; Quynh-Giao Tran; Leonardo H Travassos; Charles B Trelford; Shirley Tremel; Ioannis P Trougakos; Betty P Tsao; Mario P Tschan; Hung-Fat Tse; Tak Fu Tse; Hitoshi Tsugawa; Andrey S Tsvetkov; David A Tumbarello; Yasin Tumtas; María J Tuñón; Sandra Turcotte; Boris Turk; Vito Turk; Bradley J Turner; Richard I Tuxworth; Jessica K Tyler; Elena V Tyutereva; Yasuo Uchiyama; Aslihan Ugun-Klusek; Holm H Uhlig; Marzena Ułamek-Kozioł; Ilya V Ulasov; Midori Umekawa; Christian Ungermann; Rei Unno; Sylvie Urbe; Elisabet Uribe-Carretero; Suayib Üstün; Vladimir N Uversky; Thomas Vaccari; Maria I Vaccaro; Björn F Vahsen; Helin Vakifahmetoglu-Norberg; Rut Valdor; Maria J Valente; Ayelén Valko; Richard B Vallee; Angela M Valverde; Greet Van den Berghe; Stijn van der Veen; Luc Van Kaer; Jorg van Loosdregt; Sjoerd J L van Wijk; Wim Vandenberghe; Ilse Vanhorebeek; Marcos A Vannier-Santos; Nicola Vannini; M Cristina Vanrell; Chiara Vantaggiato; Gabriele Varano; Isabel Varela-Nieto; Máté Varga; M Helena Vasconcelos; Somya Vats; Demetrios G Vavvas; Ignacio Vega-Naredo; Silvia Vega-Rubin-de-Celis; Guillermo Velasco; Ariadna P Velázquez; Tibor Vellai; Edo Vellenga; Francesca Velotti; Mireille Verdier; Panayotis Verginis; Isabelle Vergne; Paul Verkade; Manish Verma; Patrik Verstreken; Tim Vervliet; Jörg Vervoorts; Alexandre T Vessoni; Victor M Victor; Michel Vidal; Chiara Vidoni; Otilia V Vieira; Richard D Vierstra; Sonia Viganó; Helena Vihinen; Vinoy Vijayan; Miquel Vila; Marçal Vilar; José M Villalba; Antonio Villalobo; Beatriz Villarejo-Zori; Francesc Villarroya; Joan Villarroya; Olivier Vincent; Cecile Vindis; Christophe Viret; Maria Teresa Viscomi; Dora Visnjic; Ilio Vitale; David J Vocadlo; Olga V Voitsekhovskaja; Cinzia Volonté; Mattia Volta; Marta Vomero; Clarissa Von Haefen; Marc A Vooijs; Wolfgang Voos; Ljubica Vucicevic; Richard Wade-Martins; Satoshi Waguri; Kenrick A Waite; Shuji Wakatsuki; David W Walker; Mark J Walker; Simon A Walker; Jochen Walter; Francisco G Wandosell; Bo Wang; Chao-Yung Wang; Chen Wang; Chenran Wang; Chenwei Wang; Cun-Yu Wang; Dong Wang; Fangyang Wang; Feng Wang; Fengming Wang; Guansong Wang; Han Wang; Hao Wang; Hexiang Wang; Hong-Gang Wang; Jianrong Wang; Jigang Wang; Jiou Wang; Jundong Wang; Kui Wang; Lianrong Wang; Liming Wang; Maggie Haitian Wang; Meiqing Wang; Nanbu Wang; Pengwei Wang; Peipei Wang; Ping Wang; Ping Wang; Qing Jun Wang; Qing Wang; Qing Kenneth Wang; Qiong A Wang; Wen-Tao Wang; Wuyang Wang; Xinnan Wang; Xuejun Wang; Yan Wang; Yanchang Wang; Yanzhuang Wang; Yen-Yun Wang; Yihua Wang; Yipeng Wang; Yu Wang; Yuqi Wang; Zhe Wang; Zhenyu Wang; Zhouguang Wang; Gary Warnes; Verena Warnsmann; Hirotaka Watada; Eizo Watanabe; Maxinne Watchon; Anna Wawrzyńska; Timothy E Weaver; Grzegorz Wegrzyn; Ann M Wehman; Huafeng Wei; Lei Wei; Taotao Wei; Yongjie Wei; Oliver H Weiergräber; Conrad C Weihl; Günther Weindl; Ralf Weiskirchen; Alan Wells; Runxia H Wen; Xin Wen; Antonia Werner; Beatrice Weykopf; Sally P Wheatley; J Lindsay Whitton; Alexander J Whitworth; Katarzyna Wiktorska; Manon E Wildenberg; Tom Wileman; Simon Wilkinson; Dieter Willbold; Brett Williams; Robin S B Williams; Roger L Williams; Peter R Williamson; Richard A Wilson; Beate Winner; Nathaniel J Winsor; Steven S Witkin; Harald Wodrich; Ute Woehlbier; Thomas Wollert; Esther Wong; Jack Ho Wong; Richard W Wong; Vincent Kam Wai Wong; W Wei-Lynn Wong; An-Guo Wu; Chengbiao Wu; Jian Wu; Junfang Wu; Kenneth K Wu; Min Wu; Shan-Ying Wu; Shengzhou Wu; Shu-Yan Wu; Shufang Wu; William K K Wu; Xiaohong Wu; Xiaoqing Wu; Yao-Wen Wu; Yihua Wu; Ramnik J Xavier; Hongguang Xia; Lixin Xia; Zhengyuan Xia; Ge Xiang; Jin Xiang; Mingliang Xiang; Wei Xiang; Bin Xiao; Guozhi Xiao; Hengyi Xiao; Hong-Tao Xiao; Jian Xiao; Lan Xiao; Shi Xiao; Yin Xiao; Baoming Xie; Chuan-Ming Xie; Min Xie; Yuxiang Xie; Zhiping Xie; Zhonglin Xie; Maria Xilouri; Congfeng Xu; En Xu; Haoxing Xu; Jing Xu; JinRong Xu; Liang Xu; Wen Wen Xu; Xiulong Xu; Yu Xue; Sokhna M S Yakhine-Diop; Masamitsu Yamaguchi; Osamu Yamaguchi; Ai Yamamoto; Shunhei Yamashina; Shengmin Yan; Shian-Jang Yan; Zhen Yan; Yasuo Yanagi; Chuanbin Yang; Dun-Sheng Yang; Huan Yang; Huang-Tian Yang; Hui Yang; Jin-Ming Yang; Jing Yang; Jingyu Yang; Ling Yang; Liu Yang; Ming Yang; Pei-Ming Yang; Qian Yang; Seungwon Yang; Shu Yang; Shun-Fa Yang; Wannian Yang; Wei Yuan Yang; Xiaoyong Yang; Xuesong Yang; Yi Yang; Ying Yang; Honghong Yao; Shenggen Yao; Xiaoqiang Yao; Yong-Gang Yao; Yong-Ming Yao; Takahiro Yasui; Meysam Yazdankhah; Paul M Yen; Cong Yi; Xiao-Ming Yin; Yanhai Yin; Zhangyuan Yin; Ziyi Yin; Meidan Ying; Zheng Ying; Calvin K Yip; Stephanie Pei Tung Yiu; Young H Yoo; Kiyotsugu Yoshida; Saori R Yoshii; Tamotsu Yoshimori; Bahman Yousefi; Boxuan Yu; Haiyang Yu; Jun Yu; Jun Yu; Li Yu; Ming-Lung Yu; Seong-Woon Yu; Victor C Yu; W Haung Yu; Zhengping Yu; Zhou Yu; Junying Yuan; Ling-Qing Yuan; Shilin Yuan; Shyng-Shiou F Yuan; Yanggang Yuan; Zengqiang Yuan; Jianbo Yue; Zhenyu Yue; Jeanho Yun; Raymond L Yung; David N Zacks; Gabriele Zaffagnini; Vanessa O Zambelli; Isabella Zanella; Qun S Zang; Sara Zanivan; Silvia Zappavigna; Pilar Zaragoza; Konstantinos S Zarbalis; Amir Zarebkohan; Amira Zarrouk; Scott O Zeitlin; Jialiu Zeng; Ju-Deng Zeng; Eva Žerovnik; Lixuan Zhan; Bin Zhang; Donna D Zhang; Hanlin Zhang; Hong Zhang; Hong Zhang; Honghe Zhang; Huafeng Zhang; Huaye Zhang; Hui Zhang; Hui-Ling Zhang; Jianbin Zhang; Jianhua Zhang; Jing-Pu Zhang; Kalin Y B Zhang; Leshuai W Zhang; Lin Zhang; Lisheng Zhang; Lu Zhang; Luoying Zhang; Menghuan Zhang; Peng Zhang; Sheng Zhang; Wei Zhang; Xiangnan Zhang; Xiao-Wei Zhang; Xiaolei Zhang; Xiaoyan Zhang; Xin Zhang; Xinxin Zhang; Xu Dong Zhang; Yang Zhang; Yanjin Zhang; Yi Zhang; Ying-Dong Zhang; Yingmei Zhang; Yuan-Yuan Zhang; Yuchen Zhang; Zhe Zhang; Zhengguang Zhang; Zhibing Zhang; Zhihai Zhang; Zhiyong Zhang; Zili Zhang; Haobin Zhao; Lei Zhao; Shuang Zhao; Tongbiao Zhao; Xiao-Fan Zhao; Ying Zhao; Yongchao Zhao; Yongliang Zhao; Yuting Zhao; Guoping Zheng; Kai Zheng; Ling Zheng; Shizhong Zheng; Xi-Long Zheng; Yi Zheng; Zu-Guo Zheng; Boris Zhivotovsky; Qing Zhong; Ao Zhou; Ben Zhou; Cefan Zhou; Gang Zhou; Hao Zhou; Hong Zhou; Hongbo Zhou; Jie Zhou; Jing Zhou; Jing Zhou; Jiyong Zhou; Kailiang Zhou; Rongjia Zhou; Xu-Jie Zhou; Yanshuang Zhou; Yinghong Zhou; Yubin Zhou; Zheng-Yu Zhou; Zhou Zhou; Binglin Zhu; Changlian Zhu; Guo-Qing Zhu; Haining Zhu; Hongxin Zhu; Hua Zhu; Wei-Guo Zhu; Yanping Zhu; Yushan Zhu; Haixia Zhuang; Xiaohong Zhuang; Katarzyna Zientara-Rytter; Christine M Zimmermann; Elena Ziviani; Teresa Zoladek; Wei-Xing Zong; Dmitry B Zorov; Antonio Zorzano; Weiping Zou; Zhen Zou; Zhengzhi Zou; Steven Zuryn; Werner Zwerschke; Beate Brand-Saberi; X Charlie Dong; Chandra Shekar Kenchappa; Zuguo Li; Yong Lin; Shigeru Oshima; Yueguang Rong; Judith C Sluimer; Christina L Stallings; Chun-Kit Tong
Journal:  Autophagy       Date:  2021-02-08       Impact factor: 13.391

9.  DGAT1 activity synchronises with mitophagy to protect cells from metabolic rewiring by iron  depletion.

Authors:  Maeve Long; Alvaro Sanchez-Martinez; Marianna Longo; Fumi Suomi; Hans Stenlund; Annika I Johansson; Homa Ehsan; Veijo T Salo; Lambert Montava-Garriga; Seyedehshima Naddafi; Elina Ikonen; Ian G Ganley; Alexander J Whitworth; Thomas G McWilliams
Journal:  EMBO J       Date:  2022-04-12       Impact factor: 14.012

Review 10.  How Lipids Contribute to Autophagosome Biogenesis, a Critical Process in Plant Responses to Stresses.

Authors:  Rodrigo Enrique Gomez; Josselin Lupette; Clément Chambaud; Julie Castets; Amélie Ducloy; Jean-Luc Cacas; Céline Masclaux-Daubresse; Amélie Bernard
Journal:  Cells       Date:  2021-05-21       Impact factor: 6.600

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.