Literature DB >> 30337550

Genomics of experimental adaptation of Staphylococcus aureus to a natural combination of insect antimicrobial peptides.

Olga Makarova1,2, Paul Johnston1,3,4, Alexandro Rodriguez-Rojas1, Baydaa El Shazely1,5, Javier Moreno Morales1, Jens Rolff6,7,8.   

Abstract

Antimicrobial peptides (AMP) are highly conserved immune effectors across the tree of life and are employed as combinations. In the beetle Tenebrio molitor, a defensin and a coleoptericin are highly expressed in vivo after inoculation with S. aureus. The defensin displays strong in vitro activity but no survival benefit in vivo. The coleoptericin provides a survival benefit in vivo, but no activity in vitro. This suggests a potentiating effect in vivo, and here we wanted to investigate the effects of this combination on resistance evolution using a bottom-approach in vitro starting with a combination of two abundant AMPs only. We experimentally evolved S. aureus in the presence of the defensin and a combination of the defensin and coleoptericin. Genome re-sequencing showed that resistance was associated with mutations in either the pmt or nsa operons. Strains with these mutations show longer lag phases, slower Vmax, and nsa mutants reach lower final population sizes. Mutations in the rpo operon showed a further increase in the lag phase in nsa mutants but not in pmt mutants. In contrast, final MICs (minimum inhibitory concentrations) do not differ according to mutation. All resistant lines display AMP but not antibiotic cross-resistance. Costly resistance against AMPs readily evolves for an individual AMP as well as a naturally occurring combination in vitro and provides broad protection against AMPs. Such non-specific resistance could result in strong selection on host immune systems that rely on cocktails of AMPs.

Entities:  

Mesh:

Substances:

Year:  2018        PMID: 30337550      PMCID: PMC6193990          DOI: 10.1038/s41598-018-33593-7

Source DB:  PubMed          Journal:  Sci Rep        ISSN: 2045-2322            Impact factor:   4.379


Introduction

In antibiotic treatments, often single drugs are successfully used to clear infections. Yet, in innate immune systems, infections typically result in the expression and release of cocktails of antimicrobial peptides (AMP)[1-3], even though individual antimicrobial peptides can be very potent[4]. Possible evolutionary explanations are physiological cost savings, for example, if immune effectors synergize or potentiate and hence reduce the total amount of effectors required for clearance[5,6]. Other possible explanations are that resistance evolution has a lower probability if bacteria are under selection from multiple antimicrobials[7] or a high probability of mixed infections. An interesting observation is that during an infection antimicrobial peptides are expressed that have no known activity against the agent of infection. This is surprising, given that insects for example have different receptors that can distinguish between classes of infectious microbes such as fungi or bacteria[8] and energetic costs of protein synthesis are considered to be high[3]. In the mealworm beetle Tenebrio molitor experimental infection with S. aureus induces the expression of at least ten antimicrobial peptides for a week[3]. A proteomic analysis shows that the majority of these inducible antimicrobial peptides remain elevated in the haemolymph after three weeks[9]. While some of them such as Tenecin 1, a defensin, show high activity against S. aureus in vitro, other abundant AMPs such as Tenecin 2, a coleoptericin, displays no activity against S. aureus[10]. The knock-down, however, of tenecin 2 led to highly increased mortality of T. molitor 3 days after S. aureus infection[11]. This clearly indicates that Tenecin 2 has an unknown role or activity in combination with other AMPs, of which Tenecin 1 is highly abundant[9]. Here we want to use the simplest approach of understanding combinations of AMPs as observed in hosts, by using in vitro experimental evolution of bacteria to start with the minimum number in a combination: two. We explore if this combination of two highly abundant AMPs influences the evolution of bacterial resistance. We focus on the level and costs of resistance, possible underlying mutations and cross-resistance against other AMPs. In a recent experimental evolution study investigating S. aureus resistance evolution against three different AMPs from different organisms (melittin, pexiganan and iseganan)[12], we found a range of mutations associated with resistance[13]. These mutations were not specific for different AMPs. These results are in line with a growing number of studies that show a high probability of cross-resistance against AMPs[14,15]. Bacteria have evolved a number of resistance mechanisms that provide protection against ubiquitous AMPs. As most AMPs target the cell envelope and are often cationic, most described resistance mechanisms are related to changes in the cell wall such as altering the net cell surface charge[16]. In the case of S. aureus, the antimicrobial peptide sensing system GraRS[17] regulates the dlt operon, which controls D-alanylation of the wall teichoic acids[18] and mprF expression, which is responsible for peptidoglycan lysinylation[16] as well as the Bce-type ABC transporter vreFG which confers broad-spectrum AMP resistance. Two additional Bce-type ABC transporters, BraDE and vraDE, are under the control of the nisin susceptibility-associated two-component system NsaSR (also known as BceS/BceR[19]and BraS/BraR[20]). In short, the number of available resistance mechanisms against AMPs seems to be limited providing one possible explanation for the findings on cross-resistance. Here we explore for the first time resistance evolution against a pair of naturally co-expressed AMPs rather than artificial combinations as used previously. We ask if this combination changes the outcome of resistance evolution with respect to level and costs of resistance, possible underlying mutations and cross-resistance against other AMPs. Using an experimental evolution protocol, we selected S. aureus for resistance against the T. molitor defensin Tenecin 1, either alone or in combination with Tenecin 2. We then investigated if resistance evolution results in fitness costs and if the presence of Tenecin 2 changes the outcome of resistance evolution against the potent Tenecin 1. The resulting strains were re-sequenced to identify mutations associated with AMP resistance and to study the degree of parallel evolution.

Methods

Bacterial strains and culturing conditions

Staphylococcus aureus strain SH1000 and Escherichia coli strain MG1655 were used in the experiments. Bacterial cultures were grown in non-cation adjusted Mueller Hinton Broth (MHB) (Panreac Applichem GmbH) at 37 °C with mild shaking and plated on Mueller Hinton Agar (MHA), unless stated otherwise.

Antimicrobial peptides

Mealworm Tenebrio molitor antimicrobial peptides Tenecin 1 (VTCDILSVEAKGVKLNDAACAAHCLFRGRSGGYCNGKRVCVCR) and Tenecin 2 (SLQPGAPSFPGAPQQNGGWSVNPSVGRDERGNTRTNVEVQHKGQDHDFNAGWGKVIKGKEKGSPTWHVGGSFRF) were chemically synthesised by Peptide Protein Research Ltd (Funtley, UK). To avoid multiple freeze-thaw cycles and prevent binding of the peptides to the vials during storage, peptides were re-suspended in sterile water to the final peptide concentration of 5 mg/ml and glycerol concentration 50% and stored at −20 °C in sterile glass vials, which were pre-treated with “Piranha” solution (3 parts of concentrated sulfuric acid and 1 part of 30% hydrogen peroxide solution).

Selection experiment

Prior to selection, bacteria were pre-adapted to the experimental conditions (following;[21]). For this, three randomly selected clones of S. aureus strain SH1000 were picked from a Tryptic Soy agar plate, inoculated individually into 10 ml MHB and incubated overnight with shaking at 37 °C. To mimic experimental conditions, the cultures were then diluted 1:1000 and incubated at 37 °C without agitation in 50 ml polypropylene Falcon tubes containing 3.7 ml MHB. The specific volume of MHB used for pre-adaptation was calculated to ensure the same surface-area-to-volume ratio as in 96-well plates that were used in the evolution experiment. Pre-adaptation was carried out as described above by serial passage every 24 hours (to allow for approximately 36 doublings) for 8 days, with daily measurements of optical density at 600 nm, contamination checks by plating out on MHA and cryopreservation of culture aliquots at −80 °C in 12% glycerol solution. One “ancestor” line was used to establish the initial MIC value for Tenecin 1 (see below). For the selection protocol, five independent parallel selection lines (numbered 1 to 5) were founded by plating one pre-adapted “ancestor” line on MHA and isolating five random colonies. The experiment was performed at 37 °C without shaking in a microplate reader (Synergy 2, Biotek). We used flat bottom polypropylene non-binding 96-well plates (Greiner Bio-One GmbH, Germany) to avoid attachment of the peptides to the plastic surfaces covered with clear polystyrene lids with condensation rings (Greiner Bio-One GmbH, Germany). The plates were filled with MHB, with the total volume of 200 µl per well. Growth curves were generated by taking measurements of OD600 every 30 minutes (preceded by a brief shaking for 10 seconds) for 23 hours. For each of the five replicate lines there were two experimental conditions – Tenecin 1 or a combination of Tenecin 1 + Tenecin 2, as well as four controls - negative control (culture medium control), two glycerol controls - for each AMP treatment - to account for the increasing concentrations of glycerol at higher concentrations of peptides, in which they were stored, and a non-selected control. The serial passage started at 1/2 × MIC, which corresponded to 4 µg/ml for Tenecin 1 and 4 µg/ml Tenecin 1 and 8 µg/ml Tenecin 2 for the combined treatment. To inoculate the treatment wells and the respective control wells, overnight cultures of the five replicate lines were diluted 1:100 and sub-cultured until OD600 0.5 (corresponding to 1 × 108 cfu/ml), then 10 µl of these cultures were inoculated into each treatment and control (except negative control) wells resulting in the final total volume of 200 µl and bacterial density of approximately 5 × 106 cfu per well. Two percent of the culture were transferred every 24 hours to a fresh 96 well plate and the concentration of AMPs was doubled. Twenty µl of the remaining cultures were added to 180 µl of sterile 0.9% NaCl and then serially diluted (typically from 10−1 to 10−5) and checked for contamination and viable counts by plating 5 µl of each dilution on MH-agar using the drop plate method[22] and incubating the plates overnight at 30 °C. Glycerol was added to the rest of the cultures to the final concentration of 12% and the plates were stored at −80 °C. The selection experiment continued for 7 daily passages, in each of which the concentration of AMPs was doubled reaching 256 µg/ml for Tenecin 1 and 512 µg/ml Tenecin 2 on the last day of the experiment (day 7). When the volume of added peptide started to exceed 5% of the total volume of medium per well, 2-fold concentrated MHB was used to prepare stock solutions of the desired concentration to alleviate the possible effects of nutrients depletion. The resulting resistant lines were used for subsequent assays (MIC, growth curves) and sequencing both as populations and colonies.

Antimicrobial susceptibility testing

Minimal inhibitory concentration (MIC) was determined using a broth micro-dilution method[23]. Briefly, 5 µl (1 × 105 cfu/ml) of the mid-exponential phase bacterial culture diluted 1:100 were inoculated into the wells of polypropylene V-bottom 96-well plates (lids with condensation rings 656171, both from Greiner Bio-One GmbH, Germany, Germany) containing two-fold serial dilutions of AMPs or antibiotics in the total volume of 100 µl MHB per well. Each assay was performed in triplicate. The plates were incubated at 37 °C in a humidity chamber. The MIC was defined as the lowest concentration that inhibited visible bacterial growth after 24 hours of incubation. This standard method was used to determine the initial MIC of Tenecin 1 for the pre-adapted “ancestor” line and mutant lines and antibiotics. Because Tenecin 2 is mostly active against gram-negative bacteria, Escherichia coli strain MG1655 was used to determine the activity of this peptide. To determine the MICs of Tenecins immediately after the selection experiment, we scaled-down the assays to the total volume of 40 µl per well because of the high number of bacterial lines and the limited amount of the antimicrobial peptide available. For this, we used flat-bottom 384-well polypropylene plates (Greiner Bio-One GmbH, Germany) and clear polystyrene lids (Greiner Bio-One GmbH, Germany). We determined MIC as the lowest concentration at which OD600 readings were indistinguishable from those of the NTC wells. As a method control, we compared the MIC determined using the standard and the small-volume protocol, and found no differences. The MICs were determined for populations and individual colonies derived from the selection lines.

Growth curves

Growth curve assays were performed by monitoring the changes in turbidity at OD600 of the selected mutant lines, non-selected controls and ancestor in un-supplemented MHB using a microtitre plate reader. For this, bacterial lines (populations and colonies) were grown until OD600 0.5, diluted 1:10 and 20 µl of the resulting cell suspension were inoculated into 180 µl MHB. Each assay had four replicates. The measurements were taken at 20 minutes intervals during 16 hours of incubation at 37 °C inside the microtitre plate reader, with 10 seconds shaking before each reading. Growth parameters such as final and maximum OD, the maximum growth rate (Vmax) and lag time (for a rationale using these)[24-26] were calculated with Gen5 software (Biotek).

DNA isolation

Genomic DNA for whole genome sequencing was isolated using GeneMATRIX Bacterial and Yeast genomic DNA purification kit (Roboklon, Germany) following manufacturer’s instructions. Four µl of 10 mg/ml freshly prepared lysozyme and lysostaphin (both from Sigma) each were added into bacterial lysate. The DNA quantity and quality were estimated by measuring the optical density at A260/280 using the Nanodrop spectrophotometer (Thermo Scientific) and agarose gel electrophoresis.

Genome re-sequencing

TruSeq DNA PCR-free libraries were constructed according to the manufacturers instructions and sequenced for 600 cycles using a MiSeq at the Berlin Center for Genomics in Biodiversity Research. The genetic differences between strain SH1000 and other members of the 8325 lineage have been described using array-based resequencing[27], and de novo genome sequencing[28]. The differences comprise: the excision of three prophages from 8325 (Φ11, 12, 13), 13 single-nucleotide polymorphisms (SNPs; two synonymous, 11 nonsynonymous), a 63-bp deletion in the spa-sarS intergenic region, and an 11-bp deletion in rsbU[28]. To account for these differences we first assembled reads from SH1000 using SPAdes[29], and used the resulting contigs to correct the three phage excision sites in the 8325 reference genome. SH1000 reads were then mapped to the resulting sequence and bcftools consensus[30] was used to correct the remaining 13 SNPs and two indels. The haploid variant calling pipeline snippy[31] was used to identify mutations in the selection lines. Snippy uses bwa[30] to align reads to the reference genome and identifies variants in the resulting alignments using FreeBayes (Garrison and Marth 2012). All variants were independently verified using a second computational pipeline, breseq[32].

Statistical analyses

Statistical analyses were performed using R version 3.4.1. Growth parameters (Vmax, duration of lag phase, final OD600 and log2 (MIC)) were analysed by using the nlme package[33] to fit linear mixed-effects models specifying line as a random effect. Differences between groups were analysed with contrasts. We also used visreg[34] and Ismeans[35]. Permutational analyses of Jaccard distance were performed using the vegan package[36].

Results

Resistance evolves readily at a cost

Over the course of selection all replicates of both treatments (single and combination of AMPs) readily evolved a high level of resistance. All lines were able to grow in the presence of 256 µg/ml Tenecin 1 and 512 µg/ml Tenecin 2, resulting in an increase in MIC for Tenecin 1 (after selection with either Tenecin 1 or Tenecin 1 + 2, T = −9.98, df = 35, p = < 0.0001, Fig. 1). MICs did not differ between Tenecin 1 and Tenecin 1 + 2 lines (T = 0.894, df =35, p =0.3776). When comparing bacterial growth curves of strains isolated either from the selected lines or non-selected controls, we found consistently slower growth rates in the exponential phase for both Tenecin 1 (T = −6.8, df = 56, p = < 0.0001, Fig. 1) and Tenecin 1 + Tenecin 2-selected strains (T = −7.17, df = 56, p = < 0.0001, Fig. 1) and also extended lag phases (Tenecin 1: T = 9.4, df = 56, p = < 0.0001, Tenecin 1 + Tenecin 2: T = 9.1, df = 56, p = < 0.0001, Fig. 1). Tenecin 1 and Tenecin 1 + Tenecin 2 selected strains did not differ (vmax: T = −0.67, df = 56, p = 0.5042, lag: T = 0.012087, df = 56, p = 0.9904, Fig. 1). Final population sizes measured as OD did not differ (Tenecin 1: T = −0.57419 df = 54, p = 0.5682 Tenecin 1 + 2: T = −1.70549, df = 54, p = 0.0938). This suggests that AMP resistance incurs fitness costs irrespective of the type of selection.
Figure 1

Growth parameters of experimentally evolved AMP-resistant S. aureus in relation to treatment (Vmax, lag phase, maximal OD) (blue line: mean, grey box: 95% confidence intervals).

Growth parameters of experimentally evolved AMP-resistant S. aureus in relation to treatment (Vmax, lag phase, maximal OD) (blue line: mean, grey box: 95% confidence intervals).

Cross-Resistance to other AMPs but not antibiotics

We tested for cross-resistance against commercially available AMPs, colistin (T = −3.826, df = 27.94, p = 0.0007), and melittin (T = −7.669, df = 27.94, p < 0.0001). We found 2–8-fold cross-resistance of all AMP-selected strains against the AMPs Mellitin and Colistin (Table S1). The selected strains showed no cross-resistance against Vancomycin, a drug of last resort for staphylococcal infections with multiple resistances. There was no relationship between the AMP cross-resistance and the resistance mutations (see Table S2). We also tested the evolved strains against a panel of eight antibiotics (see Table S2) but detected no cross-resistance.

Genome re-sequencing reveals mutations in a limited number of loci

Whole genome sequencing of the selected mutants and the respective controls (at the population and single colony levels) showed differences both between treatments and between replicate lines within treatments. In each resistant strain one mutation was identified in either pmtR, pmtA, nsaS, or nsaR gene, all of which are known to be involved in envelope stress tolerance (see also Tables S3 and S4 for a full list of mutations). In case of the pmtR mutations, there were examples of missense, frameshifts, and stop gains. For pmtA, nsaS, nsaR, rpoB, and rpoC mostly missense mutations were found. Interestingly, we found the same pmtR stop-gain mutation (c.14 T > A p.Leu5*) in at least 11 strains, which has previously been described for melittin-selected S. aureus lines (Johnston et al. 2016). Additionally we also identified an nsaS missense mutation (A208E) in 4 strains which has been shown to be responsible for nisin resistance in SH1000[37], the same strain as used here. The final MICs achieved did not differ by mutation (T = 0.25, df = 32, p = 0.8, Fig. 2).
Figure 2

Log2 MIC in MICs against Tenecin 1 for resistant strains separated by mutations compared to procedural controls (blue line: mean, grey box: 95% confidence intervals).

Log2 MIC in MICs against Tenecin 1 for resistant strains separated by mutations compared to procedural controls (blue line: mean, grey box: 95% confidence intervals).

Reduced fitness in relation to resistance mutations

Fitness reduction, as measured by the increased lag phase, did not differ by mutation (T = 0.93, df = 56, p = 0.3576, Fig. 3A–C). Vmax differed between nsa and pmt mutations, with nsa mutants showing a lower growth rate than pmt mutants (T = 2.7, df = 56, p = 0.0092) and both mutants grow significantly slower than the controls (pmt: T = −6.46, df = 56, p = < 0.0001, nsa: T = −8.16, df = 56, p = < 0.0001, Fig. 3A–F). In the presence of a second mutation rpo, nsa mutants show a further extension of the lag phase (T = 4.21, df = 54, p = 1e-04, Fig. 3G–I). Final OD differed by mutation (T = −3.36 df = 56 p = 0.0014), final OD is lower for nsa mutants than pmt mutants or controls.
Figure 3 

Fitness costs over mutation/operon (A–C), in relation to the selective environment (D–F) and in the presence or absences of a second mutation (G–I). (blue line: mean, grey box: 95% confidence intervals).

Fitness costs over mutation/operon (A–C), in relation to the selective environment (D–F) and in the presence or absences of a second mutation (G–I). (blue line: mean, grey box: 95% confidence intervals).

Parallel evolution

Using the Jaccard distance to calculate the degree of parallel evolution (see Wong et al. 2012), we did not find evidence for parallel evolution at the operon level. Selection treatment (T1 or T1T2) did not affect the mean proportion of shared mutated operons (permutational analysis of multivariate homogeneity of group dispersion F = 0.1925, p = 0.625) or the mean number of shared mutations (permutational multivariate analysis of Jaccard distance matrix, F = 1.063, p = 0.347, Fig. 4). Yet, as reported above, all AMP selected lines showed either a mutation in nsa or in pmt operons, but never in both (Table S1).
Figure 4

Parallel evolution as assessed by Jaccard Distance for operons (1 = no shared evolution) (box depicts 25–75% interquartile range, the whisker shows the largest value inside 1.5x IQR).

Parallel evolution as assessed by Jaccard Distance for operons (1 = no shared evolution) (box depicts 25–75% interquartile range, the whisker shows the largest value inside 1.5x IQR).

Discussion

Our study was one of the first to explore the evolution of resistance to AMPs that are part of the same immune system. We find that all populations under antimicrobial peptide selection evolve resistance quickly and to a similar degree irrespective of the presence of one or two AMPs. In all cases resistant strains possessed a mutation in either in the pmt or nsa operons. Mutations in these operons were not found together. We have previously shown that evolution of resistance towards the AMP melittin in S. aureus JLA513 is associated with nonsense mutations in pmtR (previously referred to as ytrA[13]. Here we find that the most frequent pmtR mutation is identical to the stop-gain mutation described in S. aureus JLA513[13]. In S. aureus, the pmt operon encodes an essential export system for Phenol-soluble modulin peptide toxins (PSM)[38]. pmt expression is negatively regulated by the GntR-type transcriptional repressor PmtR which binds to an operator site within the pmt promoter[16]. PSMs enable pmt expression by disrupting the binding of PmtR to the operator[16]. pmt is the only known regulatory target of PmtR and pmtR deletion mutants show constitutive upregulation of only pmtA-D[16]. pmt expression is also induced by exposure to cationic AMPs[39] and has recently been shown to be responsible for defending S. aureus against killing by human AMPs[40]. This raises the possibility that the pmtR mutations observed here may mediate Tenecin 1 resistance via repression of pmt. The nisin susceptibility-associated (nsa) two-component system was independently discovered three times[19,20,37] as being responsible for resistance to nisin and bacitracin. In the presence of it’s substrate NsaSR activates transcription of the Bce-AB type ABC transporters BraDE and VraDE which are involved in sensing and detoxification respectively[20]. Strikingly, in 4 strains we identified the same nsaS mutation (A208E) which was shown to confer increased nisin resistance in SH1000[37]. The costs of antibiotic resistance are variable and examples of cost-free resistance exist[25]. The issue of cost of resistance is much less researched for AMPresistance costs[14,21]. Here we find clear evidence for costly resistance as measured in growth rate and lag phase for both AMPtreatments. When looking at the level of the most frequent mutated genes, nsa and pmt, we find that all three measured costs, reduction in growth rate and population density (final OD) and extended lag phase are increased. The cost of resistance by mutations in nsa seems to be higher as indicated by both, growth rate (Vmax) and population density (final OD). With the exception of the double mutation nsa/rpo, which displays the longest lag phase the costs in our experiments do not differ by mutation. rpoB mutations in AMP-resistant S. aureus have been found before[41]. At the moment it is not clear why the more costly double-mutation evolves, given that there is no difference in MICs between nsa and nsa/rpo mutants. Limited costs in S. aureus selected for resistance against the human AMP LL-37 were reported[41], but the same study found reduced growth rates in AMP-resistant strains. Antibiotic resistance evolution resulting in extended lag phases has been frequently reported (e.g.)[42] and also has been proposed as a mechanism explaining antibiotic tolerance[25] even in the absence of bona fide resistance.

Lack of parallel evolution

While we do find strong evidence for parallel evolution at the level of the resistance phenotype, all populations under selection evolve resistance at a comparable speed to a similar level (MIC), we do not find evidence for parallel evolution at the level of the operons and treatments. This contrasts with findings reported in Pseudomonas fluorescens under antibiotic selection[43], which found a higher degree of parallel evolution, albeit in more complex environments. A low level of parallelism has been observed in other studies of bacterial antibiotic resistance evolution[42,44]. While our assessment is based on the Jaccard-Distance, it is noteworthy that all strains have one of two resistance-associated mutations. This is much lower than the variation observed in a previous study in S. aureus against a panel of antimicrobial peptides originating from different organisms[13].

Cross-resistance

Despite the limited number of resistance mutations, both our experimentally evolved Tenecin 1 and Tenecin 1 + Tenecin 2-selected strains, display cross-resistance against colistin and melittin. All of these antimicrobial peptides have a different origin (from Paenibacillus polymixa, the African clawed frog and the honey bee, respectively) and belong to distinct AMP families. This underlines that AMP resistance mechanisms can be relatively nonspecific. In gram-positive bacteria resistance is mostly achieved by modifications to the physico-chemical properties of the cell envelope[16]. Cross-resistance between AMPs has been reported before[14,21] and might constitute a risk for the application of AMPs in medical treatments[45]. In the context of natural immune defenses it is likely that the resistance evolution to one AMP possibly results in resistance also against AMP cocktails. This could constitute a strong selection pressure by AMP resistant bacteria for those innate immune systems that are strongly dependent on AMPs, though combinations of AMPs can still be beneficial in relation to resistance as they change the probability of resistance evolution by changing the pharmacodynamics (Yu et al. 2018). Finally, while we did not find indications for cross-resistance against antibiotics, cross-resistance against human AMPs and the peptide antibiotic daptomycin, which targets the cell membrane, have been reported in MRSA[46]. It hence seems possible that resistance against AMPs comes with the risk of cross-resistance against new potential antibiotics such as teixobactin[47] that target the cell surface. While we found differences in costs of resistance depending on mutation, we did not find differences in the costs of resistance nor the resistance mutations acquired dependent on treatment with either Tenecin 1 alone or Tenecin 1 and 2 combined. In this respect our simplified in vitro approach did not allow us to understand the more complex interactions observed in vivo. Whether this is caused by the strong reduction in interacting immune effectors to only two, or by the physiological environment, i.e. differences between the artificial growth medium and haemolypmph remains to be investigated. Supplementary Table 1 Supplementary Table 2 Supplementary Table 3
  42 in total

Review 1.  Designing antimicrobial peptides: form follows function.

Authors:  Christopher D Fjell; Jan A Hiss; Robert E W Hancock; Gisbert Schneider
Journal:  Nat Rev Drug Discov       Date:  2011-12-16       Impact factor: 84.694

2.  Staphylococcus aureus SH1000 and 8325-4: comparative genome sequences of key laboratory strains in staphylococcal research.

Authors:  A J O'Neill
Journal:  Lett Appl Microbiol       Date:  2010-06-10       Impact factor: 2.858

3.  Therapeutic antimicrobial peptides may compromise natural immunity.

Authors:  Michelle G J L Habets; Michael A Brockhurst
Journal:  Biol Lett       Date:  2012-01-25       Impact factor: 3.703

Review 4.  Bacterial strategies of resistance to antimicrobial peptides.

Authors:  Hwang-Soo Joo; Chih-Iung Fu; Michael Otto
Journal:  Philos Trans R Soc Lond B Biol Sci       Date:  2016-05-26       Impact factor: 6.237

Review 5.  Perspectives on the evolutionary ecology of arthropod antimicrobial peptides.

Authors:  Jens Rolff; Paul Schmid-Hempel
Journal:  Philos Trans R Soc Lond B Biol Sci       Date:  2016-05-26       Impact factor: 6.237

6.  The effect of selection environment on the probability of parallel evolution.

Authors:  Susan F Bailey; Nicolas Rodrigue; Rees Kassen
Journal:  Mol Biol Evol       Date:  2015-03-11       Impact factor: 16.240

7.  Antimicrobial Peptide Resistance Mechanism Contributes to Staphylococcus aureus Infection.

Authors:  Gordon Y C Cheung; Emilie L Fisher; Joshua W McCausland; Justin Choi; John W M Collins; Seth W Dickey; Michael Otto
Journal:  J Infect Dis       Date:  2018-03-13       Impact factor: 5.226

8.  Validation of drop plate technique for bacterial enumeration by parametric and nonparametric tests.

Authors:  Hossein Naghili; Hossein Tajik; Karim Mardani; Seyed Mehdi Razavi Rouhani; Ali Ehsani; Payman Zare
Journal:  Vet Res Forum       Date:  2013       Impact factor: 1.054

9.  Increased survival of experimentally evolved antimicrobial peptide-resistant Staphylococcus aureus in an animal host.

Authors:  Adam J Dobson; Joanne Purves; Jens Rolff
Journal:  Evol Appl       Date:  2014-07-02       Impact factor: 5.183

10.  Combination Effects of Antimicrobial Peptides.

Authors:  Guozhi Yu; Desiree Y Baeder; Roland R Regoes; Jens Rolff
Journal:  Antimicrob Agents Chemother       Date:  2016-01-04       Impact factor: 5.191

View more
  5 in total

1.  Probiotics Modulate a Novel Amphibian Skin Defense Peptide That Is Antifungal and Facilitates Growth of Antifungal Bacteria.

Authors:  Douglas C Woodhams; Louise A Rollins-Smith; Laura K Reinert; Briana A Lam; Reid N Harris; Cheryl J Briggs; Vance T Vredenburg; Bhumi T Patel; Richard M Caprioli; Pierre Chaurand; Peter Hunziker; Laurent Bigler
Journal:  Microb Ecol       Date:  2019-05-16       Impact factor: 4.552

Review 2.  Insect antimicrobial peptides: potential weapons to counteract the antibiotic resistance.

Authors:  M D Manniello; A Moretta; R Salvia; C Scieuzo; D Lucchetti; H Vogel; A Sgambato; P Falabella
Journal:  Cell Mol Life Sci       Date:  2021-02-17       Impact factor: 9.261

Review 3.  Insect Antimicrobial Peptides, a Mini Review.

Authors:  Qinghua Wu; Jiří Patočka; Kamil Kuča
Journal:  Toxins (Basel)       Date:  2018-11-08       Impact factor: 4.546

4.  Antimicrobial Peptide Induced-Stress Renders Staphylococcus aureus Susceptible to Toxic Nucleoside Analogs.

Authors:  Alexandro Rodríguez-Rojas; Arpita Nath; Baydaa El Shazely; Greta Santi; Joshua Jay Kim; Christoph Weise; Benno Kuropka; Jens Rolff
Journal:  Front Immunol       Date:  2020-09-29       Impact factor: 7.561

5.  The Synergistic Effect of Mud Crab Antimicrobial Peptides Sphistin and Sph12-38 With Antibiotics Azithromycin and Rifampicin Enhances Bactericidal Activity Against Pseudomonas Aeruginosa.

Authors:  Jie Liu; Fangyi Chen; Xiaofei Wang; Hui Peng; Hua Zhang; Ke-Jian Wang
Journal:  Front Cell Infect Microbiol       Date:  2020-10-23       Impact factor: 5.293

  5 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.