Pu Lu1, Richard Odongo Magwanga2,3, Hejun Lu4, Joy Nyangasi Kirungu5, Yangyang Wei6, Qi Dong7, Xingxing Wang8, Xiaoyan Cai9, Zhongli Zhou10, Kunbo Wang11, Fang Liu12. 1. Research Base in Anyang Institute of Technology, State Key Laboratory of Cotton Biology, Institute of Cotton Research, Chinese Academy of Agricultural Science (ICR, CAAS), Anyang 455000, Henan, China. lupu1992@cricaas.com.cn. 2. Research Base in Anyang Institute of Technology, State Key Laboratory of Cotton Biology, Institute of Cotton Research, Chinese Academy of Agricultural Science (ICR, CAAS), Anyang 455000, Henan, China. magwangarichard@yahoo.com. 3. Jaramogi Oginga Odinga University of Science and Technology, P.O. Box 210-40601, 210 Bondo, Kenya. magwangarichard@yahoo.com. 4. Gembloux Agro-Bio Tech, University of Liège, 5030 Gembloux, Belgium. hejunlu@cricaas.com.cn. 5. Research Base in Anyang Institute of Technology, State Key Laboratory of Cotton Biology, Institute of Cotton Research, Chinese Academy of Agricultural Science (ICR, CAAS), Anyang 455000, Henan, China. joynk@cricaas.com.cn. 6. Anyang Institute of Technology, Anyang 455000, Henan, China. weiyangyang@cricaas.com.cn. 7. Research Base in Anyang Institute of Technology, State Key Laboratory of Cotton Biology, Institute of Cotton Research, Chinese Academy of Agricultural Science (ICR, CAAS), Anyang 455000, Henan, China. dongqi@cricaas.com.cn. 8. Research Base in Anyang Institute of Technology, State Key Laboratory of Cotton Biology, Institute of Cotton Research, Chinese Academy of Agricultural Science (ICR, CAAS), Anyang 455000, Henan, China. wangxx@cricaas.com.cn. 9. Research Base in Anyang Institute of Technology, State Key Laboratory of Cotton Biology, Institute of Cotton Research, Chinese Academy of Agricultural Science (ICR, CAAS), Anyang 455000, Henan, China. caixy@cricaas.com.cn. 10. Research Base in Anyang Institute of Technology, State Key Laboratory of Cotton Biology, Institute of Cotton Research, Chinese Academy of Agricultural Science (ICR, CAAS), Anyang 455000, Henan, China. zhouzl@cricaas.com.cn. 11. Research Base in Anyang Institute of Technology, State Key Laboratory of Cotton Biology, Institute of Cotton Research, Chinese Academy of Agricultural Science (ICR, CAAS), Anyang 455000, Henan, China. wkbcri@163.com. 12. Research Base in Anyang Institute of Technology, State Key Laboratory of Cotton Biology, Institute of Cotton Research, Chinese Academy of Agricultural Science (ICR, CAAS), Anyang 455000, Henan, China. liufcri@163.com.
Abstract
Plants have developed a number of survival strategies which are significant for enhancing their adaptation to various biotic and abiotic stress factors. At the transcriptome level, G-protein-coupled receptors (GPCRs) are of great significance, enabling the plants to detect a wide range of endogenous and exogenous signals which are employed by the plants in regulating various responses in development and adaptation. In this research work, we carried out genome-wide analysis of target of Myb1 (TOM1), a member of the GPCR gene family. The functional role of TOM1 in salt stress tolerance was studied using a transgenic Arabidopsis plants over-expressing the gene. By the use of the functional domain PF06454, we obtained 16 TOM genes members in Gossypium hirsutum, 9 in Gossypium arboreum, and 11 in Gossypium raimondii. The genes had varying physiochemical properties, and it is significant to note that all the grand average of hydropathy (GRAVY) values were less than one, indicating that all are hydrophobic in nature. In all the genes analysed here, both the exonic and intronic regions were found. The expression level of Gh_A07G0747 (GhTOM) was significantly high in the transgenic lines as compared to the wild type; a similar trend in expression was observed in all the salt-related genes tested in this study. The study in epidermal cells confirmed the localization of the protein coded by the gene TOM1 in the plasma membrane. Analysis of anti-oxidant enzymes showed higher concentrations of antioxidants in transgenic lines and relatively lower levels of oxidant substances such as H₂O₂. The low malondialdehyde (MDA) level in transgenic lines indicated that the transgenic lines had relatively low level of oxidative damage compared to the wild types. The results obtained indicate that Gh_A07G0747 (GhTOM) can be a putative target gene for enhancing salt stress tolerance in plants and could be exploited in the future for the development of salt stress-tolerant cotton cultivars.
Plants have developed a number of survival strategies which are significant for enhancing their adaptation to various biotic and abiotic stress factors. At the transcriptome level, G-protein-coupled receptors (GPCRs) are of great significance, enabling the plants to detect a wide range of endogenous and exogenous signals which are employed by the plants in regulating various responses in development and adaptation. In this research work, we carried out genome-wide analysis of target of Myb1 (TOM1), a member of the GPCR gene family. The functional role of TOM1 in salt stress tolerance was studied using a transgenic Arabidopsis plants over-expressing the gene. By the use of the functional domain PF06454, we obtained 16 TOM genes members in Gossypium hirsutum, 9 in Gossypium arboreum, and 11 in Gossypium raimondii. The genes had varying physiochemical properties, and it is significant to note that all the grand average of hydropathy (GRAVY) values were less than one, indicating that all are hydrophobic in nature. In all the genes analysed here, both the exonic and intronic regions were found. The expression level of Gh_A07G0747 (GhTOM) was significantly high in the transgenic lines as compared to the wild type; a similar trend in expression was observed in all the salt-related genes tested in this study. The study in epidermal cells confirmed the localization of the protein coded by the gene TOM1 in the plasma membrane. Analysis of anti-oxidant enzymes showed higher concentrations of antioxidants in transgenic lines and relatively lower levels of oxidant substances such as H₂O₂. The low malondialdehyde (MDA) level in transgenic lines indicated that the transgenic lines had relatively low level of oxidative damage compared to the wild types. The results obtained indicate that Gh_A07G0747 (GhTOM) can be a putative target gene for enhancing salt stress tolerance in plants and could be exploited in the future for the development of salt stress-tolerant cotton cultivars.
Entities:
Keywords:
G-protein-coupled receptors; antioxidant; gene; salt tolerance; transgenic; wild type
Because plants are sessile, they are strongly affected by the ever-deteriorating environmental conditions [1]. Plants have developed a number of survival strategies which are significant for enhancing their adaptation to various biotic and abiotic stress factors [2]. Being that abiotic stresses are dynamic and complex in nature, plants have developed complex mechanisms which encompass changes at the transcriptome, cellular, and physiological levels [3]. At the transcriptome level, G-protein-coupled receptors (GPCRs) are of great significance, enabling the plants to detect a wide range of endogenous and exogenous signals employed by the plants in the regulation of various responses in development and adaptation [4]. The external signals include all the abiotic and biotic factors which have direct effects on the plants’ growth and development, such as light, temperature, mechanical perturbations (e.g., wind), humidity, CO2, edaphic factors (e.g., soil water and nutrients), and gravity. The internal signals mainly include growth regulators, developmental regulators, and metabolites [5]. When plants are exposed to primary stimuli such as water deficit, salt stress, light, hormones, and pathogen-derived elicitors, the primary stimuli can cause membrane depolarization of the plant cells within a few seconds, as a result of early Ca2+ influx and anion efflux through ion channels [6].G-protein-coupled receptors are protein domains with seven putative transmembrane segments (7TM), and are mainly responsible for transmitting extracellular signals to the intracellular region as well as triggering several signalling cascades in response to stimuli as diverse as light, protons, Ca2+, odorants, amino acids, nucleotides, proteins, peptides, steroids, and fatty acids [7]. The GPCRs play key roles in cellular transduction, and hence are considered as critical regulators in cellular processes. Moreover, the fact that their dysfunction can result in several diseases has made GPCRs the targets of the majority of the currently-prescribed drugs [8]. It seems that the signals are mostly perceived at the level of membrane, and therefore transmembrane events are the likely routes for signal generation and transduction. In plants, the best-characterized plasma membrane-based receptors are of two kinds: (i) transmembrane receptor enzymes (usually kinase); and (ii) G-protein-coupled receptors. Over the last few years, a number of receptors have been identified in plants, which has helped in understanding the plant signal transduction network. Presently, in plants, the G-proteins are reported to be involved in processes such as ion channel and abscisic acid signalling [9] and modulation of cell proliferation in Arabidopsis. However, a wide range of processes—including seed germination, shoot and root growth, and stomatal regulation—are altered in Arabidopsis and rice plants with mutations in G-protein components. Furthermore the GPCR proteins have been found to function in gibberellic acid (GA) pathways and in some developmental responses [10]. Recently, the role of heterotrimeric G proteins Gα in pathogenicity [11] and biotic stresses [12] has also been reported.The GPCRs are significantly important to drug industry application in humans and other animals, while little is known about plant GPCRs. Usually, the identification of new GPCRs from genome-wide analysis enables the prediction of novel important receptors in a number of species, while the identification of GPCRs in plants are still debatable compared to animal GPCRs [13]. The main reason for the doubt of the existence of GPCRs in plants is because of the functional paradigm of the animal kingdom, where the activity of GPCRs enables the development of complex signalling and sensing mechanisms, yet this is different in plants [14,15]. Compared to the animal kingdom where thousands of GPCRs have been identified, only a single GPCR has been clearly identified in plant system so far. In Arabidopsis, the gene corresponding to the canonical GPCR candidate was isolated by Josefsson and Rask [16] and Plakidou-Dymock et al. [17]. In their studies, they concluded that glycolysis regulation (GCR)1 encodes the first 7TM receptor homologue identified in higher plants, and is involved in cytokinin signal transduction. Recently, unique GPCR types have been identified in Arabidopsis, such as target of Myb1 (TOM)1 (At4g21790.1) and TOM3 (At2g02180.1), all belonging to the family class A, sub-family Olfactory, but falling in different sub-family types Olfactory II family 10 and Olfactory II family 5, respectively [18]. The two GPCR candidate genes, TOM1 and TOM3, have been found not to interact with guanine nucleotide-binding protein α-1 subunit (GPA1) compared to other functional forms of GPCR such as cullin associated and neddylation dissociated (CAND)1, 2, 3, 5, 7, 8 and heptahelical transmembrane protein (HHP)2, and therefore it has been proved that the inability of a particular gene to bind with Gα does not mean they are not members of GPCR so long as they are able to stimulate the exchange of guanosine diphosphate for guanosine triphosphate [18]. In addition, sequence comparison between the different GPCRs both in animals and plants have revealed the existence of different receptor families sharing no sequence similarity. However, all of these receptors have in common a central core domain constituted of seven transmembrane helices connected by three intracellular and three extracellular loops [19]. Two cysteine residues, which are conserved in most of the GPCRs, form a disulfide link which is probably important for the packing and for the stabilization of a restricted number of conformations of these seven transmembranes (TMs). Aside from sequence variations, GPCRs differ in the length and function of their N-terminal extracellular domain, their C-terminal intracellular domain, and their intracellular loops [20,21].In the last decade, the physiological effect of GCR1 has been investigated in relation to seed germination, cell signalling mediators, response to both gibberellins and brassinosteroid, and even their possible role in enhancing drought stress tolerance [22,23]. Plants known to possess some levels of salt tolerance mainly depend on the cell membrane stability in order to sustain the selective uptake of ions and the absorption of water through osmosis [24]. Salt stress results in a range of responses in plants, while extreme salinity may result in oxidative damage, ion toxicity, nutrition imbalance, and eventually plant death [25]. Plants do produce reactive oxygen species (ROS) during metabolic activities in the form of singlet oxygen (O21), hydrogen peroxide (H2O2), hydroxyl radical (HO−), and superoxide radical (O2−) [26]. The ROS are generated and eliminated by the plants in a synchronized mechanism, but when plants are exposed to a stress factor, the system shuts down, resulting in imbalance. Thus, the excessive production of ROS by the plants results in the synthesis of some vital antioxidants, such as superoxide dismutase (SOD), peroxidase (POD), polyphenol oxidase (PPO), chloramphenicol acetyltransferase (CAT), and malondialdehyde (MDA), which are vital for DNA repair to maintain normal growth during stress conditions [27]. The injuries caused by an increased threshold of ROS is known as oxidative stress. ROS can cause oxidative damage to various cellular components, such as membrane lipids, proteins, nucleic acids, and chlorophyll [28]. The effect of oxidative stress has been reported on cotton [29], rice [30], wheat, and beans [31]. ROS cause chlorophyll degradation and membrane lipid peroxidation, reducing membrane fluidity and selectivity [32]. The chlorophyll loss and lipid peroxidation are quantified by the MDA concentration within the cell, as MDA is the product of lipid peroxidation [33].In this research work, we transformed a novel Gossypium hirsutumGPCR candidate gene, Gh_A07G0747 (GhTOM), into the model plant Arabidopsis thaliana, and carried out the functional and expression analysis under salt stress condition. The findings provide significant information on the potential role of the novel gene designated as Gh_A07G0747 (GhTOM) from G. hirsutum in enhancing salt stress tolerance in transgenic Arabidopsis, and therefore suggest its suitability for future molecular functional characterization and application in the development of cotton genotypes with enhanced salt-stress-tolerance.
2. Materials and Methods
2.1. Identification and Sequence Analysis of TOM Proteins in Cotton
The three cotton genome sequences were downloaded from three different cotton genome websites: Gossypium hirsutum TOM protein sequences were downloaded from the Cotton Research Institute (http://mascotton.njau.edu.cn, Nanjing, China), Gossypium arboreum were obtained from the Beijing Genome Institute (https://www.bgi.com/, Beijing, China), and Gossypium raimondii genome from Phytozome 12 (http://www.phytozome.net/, Joint Genome Institute, Department of Energy), with E-value < 0.01. The conserved domain of TOM protein (PF06454) was downloaded from Pfam protein families (http://pfam.xfam.org/, European Molecular Biology Laboratory). For the identification of TOM proteins in cotton, the hidden Markov model analysis (HMM) profile of TOM protein was used as a query to carry out the HMMER search (http://hmmer.janelia.org/) [34] against Gossypium hirsutum, Gossypium raimondii, and Gossypium arboreum. In order to confirm the presence of the TOM domain, two online tools were later used for further analysis: the ScanProsite tool (http://prosite.expasy.org/scanprosite/, Swiss Institute of Bioinformatics) and the Simple Modular Architecture Research Tool (SMART) program (http://smart.embl-heidelberg.de/). SMART and Pfam databases were used to verify the presence of the TOM gene domains. The isoelectric points (PIs) and molecular weights of TOM proteins were estimated by an online ExPASy Server tool (http://www.web.xpasy.org/compute_pi/, Swiss Institute of Bioinformatics). In addition, Wolfpsort (https://www.wolfpsort.hgc.jp/) [35] was used to determine the subcellular location of all the TOM proteins within the cell. The results obtained for the subcellular location for the all the TOM proteins were further validated by using two other online tools: TargetP1.1 server [36] and Protein Prowler Subcellular Localisation Predictor version 1.2 (http://www.bioinf.scmb.uq.edu.au/pprowler_webapp_1-2/) [37]. In addition, Arabidopsis thaliana TOM protein sequences were downloaded from the Arabidopsis genome sequencing resource, the Arabidopsis information resource (TAIR) (http://www.arabidopsis.org/).
2.2. Chromosomal and Subcellular Localization of the TOM Protein in Cotton
The chromosome locations of all the TOM genes as obtained for all the three cotton genomes were determined through a blast search in Cotton Functional Genome Database [38], using their respective gene identities. In addition, we determined the subcellular localization of the TOM genes in cotton through the online software Wolfpsort (https://wolfpsort.hgc.jp/) and validated the results through TargetP1.1 [36] and Protein Prowler Subcellular Localisation Predictor version 1.2, as used in the analysis of other cotton functional genes [39].
2.3. Phylogenetic Analysis and Functional Classification of TOM Proteins in Cotton
To characterize the evolutionary features of TOM proteins, we used the gene identities of all the TOM genes, which we employed in downloading their respective protein sequences from the Cotton Functional Genome Database. The cotton TOM genes were analysed together with the sequences obtained from Phytozome for Oryza sativa, Arabidopsis thaliana, Populus trichocarpa, and Theobroma cacao. The multiple alignments of the TOM conserved domains were conducted using ClustalW program, a functional tool in MEGA 7.0 software [40], with a gap open penalty of 10 and gap extension penalty of 0.2. Thereafter, a neighbour joining (NJ) tree was performed with support for each node, tested with 1000 bootstrap replicates. The gene structures were obtained by comparing the genomic sequences and their predicted coding sequences from the cotton genome project and the structure displayed by the use of gene structure displayer server [41]. The protein sequences were analysed for motif identification by the Multiple EM for Motif Elicitation (MEME) program [42], with the default parameters adjusted to maximum number of motifs 20 and optimum motif width range set to >6 and <50.
2.4. Analysis of the Expression Patterns of Upland Cotton TOM Genes in Different Tissues, under Salt Stress through RNA Sequencing Data
This was performed in order to get the best sets of TOM genes for cloning. We obtained the RNA sequences data from the Cotton Functional Genome Database. The RNA-sequence data analysed were from torus, stamen, root, leaf, calycle, petal, pistil, and stem. Moreover, we investigated the expression levels of upland cotton TOM genes in response to the salt stress. Salt stress is among the major abiotic stress factors which has a profound effect on cotton production. The Gh_A07G0747 gene (TOM1) was found to be the most highly upregulated gene across various tissues studied in this work (Supplementary Figure S1), and hence the gene was selected for a detailed functional characterization.
2.5. Plant Transformation and Screening of Gh_A07G0747 (GhTOM) Gene Arabidopsis Lines
In this research work, we used two main plants—namely the model plant Arabidopsis thaliana, ecotype Colombia-0 (Col-0). Because the cloned gene is from Gossypium hirsutum, we used Gossypium hirsutum, accession number G. hirsutum-CRI-12 (G09091801–2), in confirming the presence of the genes in various tissues. CRI-12 was developed by our research institute, Cotton Research Institute, an Institute of the Chinese Academy of Agricultural Science (CAAS). The pWM101-35S:Gh_A07G0747 (GhTOM) construct in Agrobacterium tumefaciens GV3101 was confirmed by specific primers: the forward primer pair of Gh_A07G0747 (GhTOM) (3′-CGGGATCCATGATTAAGTGTTACCCTTTC-5′) and reverse primer pair of Gh_A07G0747 (GhTOM) (3′-GCTCTAGATTAATTTGGACTTGTTCTTG-5′) (Invitrogen, Beijing, China). Wild-type (WT) plants were transformed by use of floral dip method though with little modification [43]. Infiltration media used contained Murashige and Skoog (MS) medium 4.3 g/L, sucrose 50 g/L (5%), 2-(4-morpholino) ethane sulfonic acid (MES) 0.5 g/L, Silwet-77 200 µL/L (0.02%), 6-benzylaminopurine (6-BA) 0.01 mg/L with pH of 5.7. Transgenic lines were selected by germinating seeds on 0.5 Murashige and Skoog (MS) medium (PhytoTechnology Laboratories, Lenexa, KS, USA), containing 50 mg/L hygromycin B (Roche Diagnostics GmbH, Mannheim, Germany) for 3 days at 4 °C. This was to maximize germination by breaking seed dormancy, upon which the seedlings were transferred to an Arabidopsis growth chamber in a conditioned controlled room, in which the conditions were set at 16 h light/8 h dark. After one week in selection medium, at 3–4 true leaves emergence stage, the seedlings were transplanted into small pots filled with vermiculite and humus in the ratio of 1:1. The seedlings (T0) were grown to maturity to set seeds for second-generation (T1 seeds) in a well-conditioned Arabidopsis growth chamber. T1 seeds were germinated on antibiotics-selective medium, and the one-copy lines were singled out by examining the segregation ratio (3:1) of the antibiotics-selectable marker. T2 seeds were then germinated on antibiotics-selective medium again, and the one-copy lines were identified based on the seedling survival of the antibiotics-selectable marker. The T3 homozygous progeny was bred from a T2 population after real-time quantitative reverse transcription polymerase chain reaction (qRT-PCR) and the selection of three higher overexpression lines (OE-3, OE-7, and OE-9) using Gh_A07G0747 (GhTOM) forward primer (3′-TGCGAAAGCTTTTTCATCATTGG-5′) and Gh_A07G0747 (GhTOM) reverse primer (3′-ACTTGTAGACGGGGCTGGTA-5′) (Invitrogen, Beijing, China), with total complementary DNA (cDNA) as template. The phenotypic investigations were carried out on T3 homozygous lines.
2.6. Subcellular Localization of Gh_A07G0747 (GhTOM) Protein
The open reading frame (ORF) of Gh_A07G0747 (GhTOM) without the stop codon was amplified by polymerase chain reaction (PCR) by the transformed gene specific primer. The forward primer sequence (Gh_A07G0747 (GhTOM) 3′-ACACGGGGGACTCTAGAGGATCCATGATTAAGT GTTACCCTTT-5′ and reverse primer sequence Gh_A07G0747 (GhTOM) 3′-ACTCATACTAGTC CCGGGGATCCATTTGGACTTGTTCTTGACAC-5′) (Invitrogen, Beijing, China) were obtained using proofreading Pfu DNA polymerase (TransGen Biotech, Beijing, China). The PCR products were then cloned into pBI121-GFP vector upstream of the green fluorescent protein (GFP) sequences producing the pBI121-Gh_A07G0747 (GhTOM)–GFP construct with GhTOM–GFP fusion gene under the regulation of CaMV35S promoter. The cloning procedure was done as outlined in the kit manual, pEASY-Uni Seamless Cloning and Assembly Kit (TransGen Biotech, Beijing, China) [44,45]. The construct was then transferred into Agrobacterium tumefaciens strain LBA4404 (Shanghai Weidi Biotechnology Co., Shangai, China) and subsequently transformed into onion epidermal cells by adopting the method as outlined by Sun et al. [46]. The transformed onion epidermal cells were cultured on 0.5 MS media in a dark growth chamber for 20 h at a temperature of 25 °C. The expression of the genes transformed into the onion epidermal cells was observed using a Zeiss Model Axio Imager M1 Upright Fluorescent Microscope (430004-9901-Axio Imager.M1, Gottingen, Germany).
2.7. Response of Overexpressed Gh_A07G0747 (GhTOM) Transgenic Lines to Salt Stress Tolerance
The T3 homozygous transgenic lines were sterilized by 10% bleach solution (v/v) for 10 min and washed three times with deionised and sterilized water. The sterilized seeds were then plated on 0.5 Murashige and Skoog medium. Plants were stratified at 4 °C in a dark chamber for a period of 3 days and then moved to a growth room with room temperature set at 22 °C with a 16 h light/8 h dark photoperiod. After one week, seedlings were transferred to small planting conical pots (bottom dimension 5 cm, top dimension 7 cm, depth 8 cm) containing well-watered mixtures of vermiculite and humus mixed in the ratio of 1:1, respectively. After 3 weeks of growth, the pots were subsequently watered every four days with water containing 0 mM NaCl, 150 mM NaCl, and 250 mM NaCl. The chlorophyll content determination was carried out after 8 days, while observation of the phenotypic traits was done at 16 days.
2.8. Root Elongation and Survival Assays
The three transgenic lines—overexpressed lines 3, 7, and 9, designated as OE-3, OE-7, and OE-9—were monitored for NaCl stress tolerance by first growing seedlings in vertical position in 0.5 MS for 5 days and then transferring to the new plates with 0.5 MS containing 0 mM NaCl, 150 mM, NaCl, and 200 mM NaCl concentrations; they were grown for 6 days. The root length was recorded on the seventh day post-transfer. Survival assay was carried out by using seeds from WT and Gh_A07G0747 (GhTOM) transgenic lines, sown in 0.5 MS for 5 days and then transferred to the new plates containing 0 mM and 250 mM NaCl concentrations. The plants’ survival rates were examined at the fourth day of germination.
2.9. Catalase Enzymes Extraction and Assay
Fresh leaf samples were frozen in liquid nitrogen upon harvesting from both treated and control plant samples. The frozen leaves were then kept at low temperature (−80 °C) for further analyses. For each sample, 0.5 g of leaf samples was vortexed with 5 mL of extraction buffer with 50 mM K-phosphate buffer with pH of 7.6 and 0.1 mM Na2EDTA (Amresco, Dallas, TX, USA). The buffer mixture was centrifuged at 15,000 rpm for 15 min, and the supernatant fraction was used to assay various enzymes. All steps in the preparation of enzyme extracts were performed at 4 °C. Catalase (CAT) activity was determined by monitoring the declining level of H2O2, as described by Cakmak and Marschner [47].
2.10. Superoxide Dismutase Enzymes Extraction and Assay
Three sets of leaf samples weighing 10 g each were obtained from both salt and control plants, and were frozen in liquid nitrogen upon collection. The leaf samples were crushed into fine powder on ice by the use of a mortar and pestle for a period of 2 min in 10 mL of homogenizing solution containing 50 mmol/L HEPES buffer and 0.1 mmol/L Na2EDTA (pH 7.6). The homogenate was centrifuged at 12,000 rpm for 20 min at a temperature of 4 °C, and the supernatant was used for superoxide dismutase (SOD) assays [48]. Superoxide dismutase activity was determined by monitoring the inhibition of the photochemical reduction of nitro blue tetrazolium (NBT), as described by Giannopolitis and Ries [49] with slight modifications. For the estimation of total SOD, a 5-mL reaction mixture was prepared, containing 50 mmol/L Na2CO3 (pH 10.4), 50 mM of HEPES (pH 7.6), 0.025% (w/v) Triton X-100, 75 μmol/L NBT, 0.1 mmol/L EDTA, 13 mmol/L methionine, 2 μmol/L riboflavin, and an aliquot of enzyme extract, and was illuminated for 10 min at a light intensity of 350 μmol/m2/s. A control reaction was maintained throughout, wherein all the steps and components were exactly the same as described above, except that crude enzyme was replaced with an equal volume of phosphate buffer (pH 7.8) [50]. A unit of SOD activity was evaluated as the amount of enzyme required to cause 50% inhibition of the reduction of NBT as monitored at 560 nm [51].
2.11. Chlorophyll Determination
Leaf sections weighing 200 mg were obtained from both treated and control samples, frozen in liquid nitrogen, then placed in 5 mL of absolute ethanol (99.9%) and heated in a water bath at 80 °C for 20 min. Total chlorophyll was evaluated in the alcohol extracts from absorbance readings, using the appropriate extinction coefficient. Chlorophyll content (mg/g fresh weight) was calculated as 100 × A654/(39.8 × sample fresh weight) as described by Tetley and Thimann [52].
2.12. Malondialdehyde Content
Lipid peroxidation was quantified as the amount of malondialdehyde (MDA) measured by the thiobarbituric acid (TBA) reaction [53]. Frozen samples were ground in a mortar and pestle with two volumes of ice-cold 0.1% (w/v) trichloroacetic acid (TCA) (Agrochemicals, Chennai, India) and centrifuged for 15 min at 15,000 rpm. The mixture containing 1 mL of the supernatant and 2 mL of 0.5% (w/v) TBA in 20% (w/v) TCA was heated at 95 °C for a half an hour and then rapidly cooled in an ice bath. After centrifugation at 12,000 rpm for 10 min at a temperature of 4 °C, the supernatant absorbance was read at 532 nm and the values corresponding to nonspecific absorption done at 600 nm.
2.13. qRT-PCR Analysis of the Expression of Salt-Responsive Genes in Transgenic Arabidopsis
To analyse the expression of Gh_A07G0747 (GhTOM) and the NaCl-responsive genes in the transgenic Arabidopsis plants, total RNA was isolated from four-week-old transgenic Arabidopsis seedlings and wild type (Columbia ecotype) grown under normal conditions (CK) and under 250 mM NaCl treatments for 4 days. The EASYspin Plus plant RNA extraction kit, obtained from Aid Lab (Beijing, China), was used to extract total RNA from the leaf tissues. The quality and concentration of each RNA sample was determined using gel electrophoresis and a NanoDrop 2000 spectrophotometer (Thermo Fisher, Waltham, MA, USA). Only RNAs which met the criterion 260/280 ratio of 1.8–2.1, 260/230 ratio ≥ 2.0 were used for further analyses, and were stored at −80 °C. The extracted RNAs were reverse-transcribed into cDNAs and then applied as templates in PCR analysis. Expression of Gh_A07G0747 (GhTOM) and the NaCl-responsive genes in the transgenic Arabidopsis plants was carried out through qRT-PCR analysis with gene-specific primers (Table 1), using the fluorescent intercalating dye FastaStart Universal SYBR-Green Master in a detection system (Roche Diagnostics GmbH, Mannheim, Germany). ArabidopsisACTIN2 gene, (Atactin2-F (3′-TTGTGCTGGATTCTGGTGATGG-5′) and Atactin2-R (3′-CCGCTCTGCTGTTGTGGTG-5′) was used as a standard control in the qRT-PCR reactions. The qRT-PCR mixture preparation was done in accordance with the manufacturer’s instructions. The qRT-PCR reaction mixture was prepared in a total volume of 20 μL, containing 10 μL of SYBR green master mix, 2 μL of cDNA template, 6 μL of deionised H2O, and 2 μL of each primer to make a final concentration of 10 μM. The PCR thermal cycling conditions were as follows: 95 °C for 10 min; 40 cycles of 95 °C for 5 s, 60 °C for 30 s, and 72 °C for 30 s. Data were collected during the extension step: 95 °C for 15 s, 60 °C for 1 min, 95 °C for 30 s, and 60 °C for 15 s. Three biological replicates and three technical replicates were performed for each cDNA sample.
Table 1
Gene specific primers used in real-time quantitative reverse transcription polymerase chain reaction (qRT-PCR) analysis for the expression of the salt genes in the transgenic Arabidopsis plant.
Genes
Forward Sequence
Reverse Sequence
AtABF4
3′-AACAACTTAGGAGGTGGTGGTCAT-5′
3′-TGTAGCAGCTGGCGCAGAAGTCAT-5′
AtSOS2
3′-GGCTTGAAGAAAGTGAGTCTCG-5′
3′-GCTACATAGTTCGGAGTTCCACA-5′
AtCBL1
3′-GAAATGAAACTGGCTGATGAAACCATAGAG-5′
3′-CTCGTGGCAATCTACTCGGTCTTAAACC-5′
AtRD29A
3′-TGAAAGGAGGAGGAGGAATGGTTGG-5′
3′-ACAAAACACACATAAACATCCAAAGT-5′
2.14. RNA Isolation and qRT-PCR Analysis of the Transformed Gene in Cotton Tissues
The EASYspin Plus plant RNA extraction kit obtained from Aid Lab (Beijing, China) was used to extract RNA from two sets of samples under normal conditions and under salt stress treatment. Under normal conditions, RNA was extracted from the roots, stem, sepal, leaf, petal, stamen, pistil, seed, and fibre tissues; this was to determine which tissue exhibited higher upregulation of the transformed gene. In salt treatment, at an NaCl concentration of 300 mM, only leaf tissues were collected for RNA extraction at 0 h, 3 h, 6 h, 12 h, 24 h, 36 h, and finally at 48 h of salt stress exposure. The concentration and quality of each RNA sample was determined through gel electrophoresis and a NanoDrop 2000 spectrophotometer criterion. Only RNAs which met the criterion 260/280 ratio of 1.8–2.1, 260/230 ratio ≥2.0 were used for further analyses and stored at –80 °C. The Actin7 gene was used as a reference (forward sequence (3′-ATCCTCCGTCTTGACCTTG-5′) and reverse sequence (3′-TGTCCGTCAGGCAACTCAT-5′) and specific TOM genes primer (forward sequence (3′-TGCGAAAGCTTTTTCATCATTGG-5′) and reverse sequence (3′-ACTTGTAGACGGGGC TGGTA-5′) were used for qRT-PCR. The first-strand cDNA synthesis was carried out with TranScript-All-in-One First-Strand cDNA Synthesis SuperMix for qRT-PCR, obtained from Transgen Biotech (Beijing, China), used as per the manufacturer’s instructions. Primer Premier 5 [54] was used to design Gh_A07G0747 (GhTOM) gene specific primers, with melting temperatures of 55–60 °C, primer lengths of 18–21 bp, and amplicon lengths of 101–221 bp. The Fast Start Universal SYBRgreen Master (Rox) (Roche, Mannheim, Germany), was used to perform qRT-PCR as per the manufacturer’s instructions. Reactions were made in a total volume of 20 μL, containing 10 μL of SYBR green master mix, 2 μL of cDNA template, 6 μL of deionised H2O, and 2 μL of each primer to make a final concentration of 10 μM. The qRT-PCR thermal cycling conditions were as follows: 95 °C for 10 min; 40 cycles of 95 °C for 5 s, 60 °C for 30 s, and 72 °C for 30 s. Data were collected during the extension step: 95 °C for 15 s, 60 °C for 1 min, 95 °C for 30 s, and 60 °C for 15 s. Three biological replicates and three technical replicates were performed per cDNA sample.
3. Results
3.1. Identification, Sequence, and Structure Analysis of TOM Candidate Proteins of G-Protein-Coupled Receptors in Cotton
By the use of the functional domain PF06454, we obtained 16 TOM gene members in G. hirsutum (one of which was scaffold, thus not included in further analysis), 9 in G. arboreum, and 11 in G. raimondii. The numbers were varied by analysing their respective sequences through Pfam scan and SMART online software tools. The cotton TOM genes were basically sub-classified as TOM1, TOM3 and THH1; the highest members were TOM1 with 20 genes, followed by TOM3 with 14 genes, while for THH1 there was only one (Table 2). The physiochemical properties of the TOM proteins were determined. The isoelectric point (PI) values ranged from 6.501 (Gorai.011G042100.1) to 10.33 (Gh_D13G0530.1); protein lengths ranged from 86 amino acids (aa) (Gorai.002G150900.1) to 396 aa (Gh_A10G0365.1 and Cotton_A_17563.1); molecular weights ranged from 10.049 kDa (Gorai.002G150900.1) to 44.279 kDa (Cotton_A_17563.1); grand average of hydropathy (GRAVY) values ranged from 0.337 (Gorai.002G150900.1) to 0.753 (Gorai.010G079300.1) (Supplementary Table S1). The results obtained for these cotton genes are in agreement with previous reports, in which the GPCR isolated from the pea GPCR gene (PsGPCR) had a predicted molecular mass of about 35 kDa and PI value of 10.60 [55]. All the genes were interrupted by introns; the highest number on intron interruption was detected in Gh_D10G0373.1, while the fewest intron disruptions were detected in Gh_D11G2418.1 and Gorai.002G150900.1 (Figure 1 and Supplementary Table S2). The results obtained are in agreement with various studies on the functional analysis of stress genes; for instance, in the functional analysis of MYB genes in sesame, a majority were found to be interrupted by introns despite the fact that introns affect the functionality of the genes due to energy demand [56]. Based on motif analysis, the TOM proteins in cotton were functionally identifiable by three distinct motifs, which were found to be common among the three cotton genotypes: motif 2 (YGGRLFFMLRRFPIESKGRRKKLQEVGYVTGICFTCFLVRCIMMCFSAFDKAAD), motif 3 (DHPVLNLIYYMLVEILPSALVLFILRKLPPKRVSNQYHPIR), and motif 6 (WWKYIPVLVIJSKMFIAGVSLFAALGFLL). The cotton TOM proteins contain various proportions of amino acids. Leucine (0.092), serine (0.074), alanine (0.073), glycine (0.069), valine (0.064), and glutamic acid (0.062) were highest in proportion, while histidine (0.022), cysteine (0.018), and tryptophan (0.013) were the least in proportions.
Table 2
The candidate G-protein-coupled receptors (GPCRs) in Gossypium hirsutum, Gossypium arboreum, and Gossypium raimondii. The identification of the GPCR candidate genes and annotation done as described by Gookin [18].
Gene Type
Prediction
Family
Sub Family
Sub Family Type
Gossypium hirsutum
Gossypium arboreum
Gossypium raimondii
TOM1
GPCR
class A
Olfactory
Olfactory II family 10
8
6
6
TOM3
GPCR
class A
Olfactory
Olfactory II family 5
7
3
4
THH1
GPCR
class A
Peptide
-
0
0
1
Total
15
9
11
Figure 1
(A) Phylogenetic tree, gene structure, and motif of all the cotton TOM genes. Red colour indicates the exons, blue indicates the up/downstream, and the grey lines are the introns. The motifs are numbered 1 to 20 and are illustrated by differently-coloured motifs unique to cotton TOM genes; (B) Common motifs which define the cotton-specific TOM gene.
3.2. Phylogenetic Analysis and Functional Classification of TOM Candidate Proteins of G-Protein-Coupled Receptors in Cotton
Phylogenetic tree analysis provides a road map of the origin and evolutionary nature of genes [57]. All the determined TOM genes from the three cotton genomes (G. hirsutum, G. arboreum, G. raimondii), as well as from Oryza sativa, Populus trichocarpa, Theobroma cacao, and A. thaliana were found to be subdivided into three groups based on the phylogenetic tree analysis. No orthologous gene pairs were found between any of the cotton genotypes to their closest relative, T. cacao. All the orthologous gene pairs were found between G. hirsutum and G. arboreum; G. hirsutum and G. raimondii; and/or G. arboreum and G. raimondii. A unique observation was made in the orthologous gene pairs between the tetraploid cotton, G. hirsutum, to the two diploid parental lineages. In all the orthologous gene pairs, the corresponding pair from diploid cotton was homologous to the parental line of the tetraploid gene; for instance, Gh_A13G0241.1-Cotton_A_00877.1 (99%), Gh_D13G0257.1-Gorai.013G028100.1 (93%), Gh_A10G0365.1-CottonA17563.1 (100%), Gh_D10G03713.1-Gorai.011G042100.1 (99%), and finally Gh_A07G0747.1-Cotton_A_24028.1 (96%). All gene pairs exhibited high percentage similarities; a similar observation was also made among the orthologous gene pairs between the diploid cotton genomes (Figure 2A). In the analysis of the late embryogenesis abundant (LEA) genes in cotton in relation to other plants, no orthologous gene pairs were found between the LEA genes of cotton to other plants; all orthologous gene pairs were found among the cotton LEAs [39].Therefore, the results obtained in this research are in agreement with the previous findings of a number of functional analyses of stress genes in plants.
Figure 2
Multiple sequence alignment of Gh_A07G0747 (GhTOM) protein and phylogenetic tree analysis. (A) Gh_A07G0747 (GhTOM) proteins tree analysis built using MEGA 7.0 program together with proteins from other plants as illustrated in the key. (B) Amino acids alignment of Gh_A07G0747 (GhTOM) with other TOM-GPCRs from other plants: Cotton_A_24028.1; Gorai.001G092500.1; Thecc1EG002003; Potri.005G203600.1; Potri.002G058500.1; AT3G59090.2; Thecc1EG029520; Gorai.011G042100.1; Gh_D10G0373.1; Cotton_A_17563.1; Gh_A10G0365.1 and LOC_Os01g54784.1.
The alignment results of the Gh_A07G0747 (GhTOM) protein with other TOM-GPCR from other plants, Cotton_A_24028.1, Gorai.001G092500.1, Thecc1EG002003, Potri.005G203600.1, Potri.002G058500.1, AT3G59090.2, Thecc1EG029520, Gorai.011G042100.1, Gh_D10G0373.1, Cotton_A_17563.1, Gh_A10G0365.1, and LOC_Os01g54784.1 obtained from Gossypium raimondii (Gorai…), Theobroma cacao (Thecc…), Oryza sativa (LOC…), Arabidopsis thaliana (AT…), and Populus trichocarpa (Potri…) exhibited high similarities ranging from 52% to 100%. The aligned sequences revealed two types of functional domain which have never been described in any literature (“GWT” and “FLL”), with most of them exhibiting the C-terminal domain (Figure 2B). The detection of the C-terminal domain is in agreement with earlier descriptions of GPCRs by Tuteja, [55], who stated that some GPCRs contain a cysteine residue in the C-terminal domain which serves as the main site for palmitoylation, mainly referring to site for lipid modification.
3.3. Chromosome Mapping and Subcellular Localization of the TOM Candidate Proteins of G-Protein-Coupled Receptors Proteins in Cotton
The genes were not mapped in all chromosomes, both in tetraploid and diploid cotton; this could be explained by the number of genes to be mapped in all the cotton chromosomes—15 genes in G. hirsutum against the 26 chromosomes (one was scaffold and not used for further analysis), 9 and 11 genes in G. arboreum and G. raimondii, respectively, against 13 chromosomes of the diploid cottons. The tetraploid TOM genes were mapped in 13 chromosomes out of 26 in G. arboreum, covering 50% of all the chromosomes (7 out of 13), while in G. raimondii it was 9 chromosomes out of 13. This indicates the eminent role played by these genes, as they have a wide coverage of the entire cotton genome despite their low numbers. In relation to the subcellular localization, all the bioinformatics tools used gave similar results, indicating that the TOM genes are embedded within the plasma membrane at the cellular level and were evidently involved in secretory pathways (Table 3).
Table 3
Subcellular localization of the cotton TOM candidate genes of G-protein-coupled receptors in cotton.
Gene ID
Gene Name
Chromosome Locations
TargetP
Pprowler
Wolfpsort
Chr.
Start
End
Len
cTP
mTP
SP
other
Loc
Gh_A03G1529
TOM1
A03
95,951,060
95,954,035
271
0.022
0.339
0.129
0.743
_
SP
plas
Gh_A04G1253
TOM3
A04
62,591,785
62,597,706
272
0.025
0.028
0.107
0.986
_
OTHER
plas
Gh_A05G1440
TOM1
A05
14,950,490
14,953,714
291
0.016
0.051
0.433
0.952
_
SP
plas
Gh_A07G0747
TOM1
A07
11,687,587
11,693,293
325
0.003
0.052
0.924
0.044
S
SP
plas
Gh_A10G0365
TOM1
A10
3,340,797
3,347,772
396
0.003
0.056
0.751
0.59
S
SP
plas
Gh_A12G1438
TOM3
A12
73,175,985
73,183,181
268
0.019
0.035
0.176
0.986
_
OTHER
plas
Gh_A13G0241
TOM3
A13
2,823,366
2,827,544
289
0.006
0.075
0.218
0.981
_
OTHER
plas
Gh_A13G0596
TOM1
A13
14,111,783
14,113,994
224
0.013
0.153
0.191
0.98
_
SP
plas
Gh_D04G1878
TOM3
D04
51,121,020
51,126,349
282
0.021
0.031
0.114
0.987
_
OTHER
plas
Gh_D05G1613
TOM1
D05
14,554,705
14,557,876
291
0.014
0.059
0.387
0.956
_
SP
plas
Gh_D10G0373
TOM1
D10
3,299,454
3,305,915
377
0.007
0.228
0.116
0.967
_
SP
plas
Gh_D11G2418
TOM3
D11
48,310,923
48,311,606
112
0.017
0.406
0.232
0.41
_
SP
plas
Gh_D12G1556
TOM3
D12
46,513,482
46,522,251
293
0.018
0.033
0.177
0.987
_
OTHER
plas
Gh_D13G0257
TOM3
D13
2,477,467
2,481,698
289
0.006
0.081
0.181
0.983
_
OTHER
plas
Gh_D13G0530
TOM1
D13
6,994,712
7,002,690
282
0.142
0.054
0.219
0.771
_
SP
plas
Cotton_A_00801
TOM1
Chr13
71,968,383
71,971,076
272
0.011
0.263
0.368
0.621
_
SP
plas
Cotton_A_00877
TOM3
Chr13
73,444,587
73,448,764
290
0.005
0.078
0.229
0.978
_
OTHER
plas
Cotton_A_04698
TOM1
Chr10
20,294,407
20,297,646
292
0.014
0.059
0.387
0.956
_
SP
plas
Cotton_A_11729
TOM3
Chr07
106,242,296
106,246,957
288
0.025
0.028
0.117
0.985
_
OTHER
plas
Cotton_A_17563
TOM1
Chr09
89,683,765
89,690,744
396
0.003
0.056
0.751
0.59
S
SP
plas
Cotton_A_24028
TOM1
Chr01
107,338,814
107,344,313
346
0.003
0.052
0.924
0.044
S
SP
plas
Cotton_A_24163
TOM1
Chr05
48,844,703
48,847,741
291
0.01
0.07
0.264
0.931
_
SP
plas
Cotton_A_25647
TOM1
Chr09
74,805,749
74,808,633
291
0.016
0.096
0.34
0.953
_
SP
plas
Cotton_A_31066
TOM3
Chr06
58,856,809
58,865,968
289
0.017
0.037
0.169
0.987
_
OTHER
plas
Gorai.001G092500
TOM1
Chr01
10,292,446
10,298,692
350
0.003
0.052
0.924
0.044
S
SP
plas
Gorai.002G150900
TOM3
Chr02
29,604,352
29,606,009
86
0.012
0.477
0.068
0.448
M
mTP
cyto
Gorai.005G220700
TOM1
Chr05
60,350,693
60,353,743
262
0.014
0.091
0.299
0.92
_
SP
plas
Gorai.008G171700
TOM3
Chr08
44,664,816
44,674,208
289
0.019
0.034
0.156
0.988
_
OTHER
plas
Gorai.009G177100
TOM1
Chr09
13,701,332
13,705,507
292
0.014
0.059
0.387
0.956
_
SP
plas
Gorai.010G079300
TOM3
Chr10
11,503,072
11,504,804
92
0.009
0.4
0.436
0.05
S
SP
extr
Gorai.011G015600
TOM1
Chr11
1,095,851
1,099,556
291
0.018
0.061
0.407
0.907
_
SP
plas
Gorai.011G042100
TOM1
Chr11
3,118,826
3,125,957
357
0.003
0.056
0.751
0.59
S
SP
plas
Gorai.012G184200
TOM3
Chr12
35,143,300
35,151,941
289
0.021
0.033
0.086
0.989
_
OTHER
plas
Gorai.013G028100
THH1
Chr13
2,095,047
2,098,979
243
0.007
0.079
0.173
0.984
_
OTHER
plas
Gorai.013G061000
TOM1
Chr13
6,622,078
6,625,118
293
0.013
0.16
0.274
0.833
_
SP
plas
Abbreviations: Len, sequence length; cTP, a chloroplast transit peptide; mTP, a mitochondrial targeting peptide; SP, a signal peptide; S, secretory pathway; M, mitochondrion; plas, plasma membrane; cyto, cytoplasm; extr, extracellular organelles; chr, chromosome; Loc, Location.
3.4. RNA Isolation and qRT-PCR Analysis of the Transformed Gene in Cotton Tissues
In order to confirm whether the transformed gene in Arabidopsis is present in cotton tissues, we carried out the qRT-PCR analysis of the expression of the gene using RNA samples extracted from different tissues of cotton plant under normal conditions. We found that the gene was more abundantly expressed in the stamen and leaves compared to other tissues analysed (Figure 3). In addition, we carried out treatment on cotton seedlings after the emergence of three true leaves under high salt stress condition (300 mM NaCl); leaf samples were collected for RNA extraction at intervals of 0 h, 3 h, 6 h, 12 h, 24 h, 36 h, and 48 h. A steady increase from 0 h to 24 h followed by a steady decline in gene expression was observed in salt-treated plants.
Figure 3
Real-time quantitative reverse transcription polymerase chain reaction (qRT-PCR) analysis of the expression of the transformed gene Gh_A07G0747 (GhTOM). (A) Total RNA isolated from two-week-old cotton plant under normal conditions; (B) Total RNA extracted from salt-stressed cotton seedlings; (C) Polymerase chain reaction (PCR) analysis performed to check 978 bp coding sequence (CDS) integration in transformed T0 generation, number 1–13 transgenic lines, 14 positive control (pWM101-Gh_A07G0747 (GhTOM)), and 15 is the negative control (wild-type, WT). Expression of the transformed genes in transgenic; (D) the transcripts levels of the Gh_A07G0747 (GhTOM) of T2 transgenic lines analysed through qRT-PCR.
3.5. Analysis of Oxidant and Antioxidant Content in the Transgenic Lines and Wild-Type under Salt Stress Condition
In the analysis of the oxidants MDA and H2O2, the Gh_A07G0747 (GhTOM) transgenic Arabidopsis had significantly lower levels of MDA compared to the wild type under salt stress conditions, implying that the transgenic plants were subjected to significantly reduced oxidative damage compared to the wild type. Because MDA is a measure of chlorophyll damage [58], it was imperative to determine the concentration of reactive oxygen species (ROS) accumulation in both wild-type and the different lines of transgenic model plant under salt stress conditions. The quantities of H2O2 in all three lines of transgenic plants were significantly lower than the wild-type, as illustrated in (Figure 4). The quantitative determination of H2O2 was carried out after 8 days of salt stress exposure. The H2O2 content increased in both WT and transgenic lines after salt stress exposure. However, the transgenic lines OE-3, OE-7, and OE-9 accumulated significantly reduced levels of H2O2, (only 69.4% increase on average) relative to WT (101.1% increase) after salt stress. Under the controlled experiment, no significant differences were detected in either MDA or H2O2 between the transgenic lines (OE-3, OE-7, and OE-9) and the wild type (WT). The results obtained clearly show that the transformed gene had a net effect of enhancing salt stress tolerance by significantly reducing the damages caused by ROS.
Figure 4
Changes of malondialdehyde (MDA) and H2O2 in Gh_A07G0747 (GhTOM) transgenic lines under salt stress. (A) Determination of MDA accumulation in leaves of wild-type (WT) and both overexpressed (OE) lines (OE-3, OE-7, and OE-9) after 8-day salt stress; (B) Quantitative determination of H2O2 accumulation in leaves of WT and both OE lines (OE-3, OE-7, and OE-9) after 8-day salt stress. In (A,B), each experiment was repeated three times. Bar indicates standard error (SE). Different letters indicate significant differences between wild-type and OE lines (ANOVA; p < 0.05). CK: normal conditions.
The regulation of reactive oxygen species is carried out by enzymatic oxidants [26]. In lieu of this, we carried out the determination of various antioxidants (POD, CAT, and SOD) in the transgenic lines and the wild type under salt stress conditions. Under control conditions, no significant difference was observed in SOD, CAT, and POD activities between transgenic lines and the wild type (WT). When the plants were exposed to salt stress after 8 days, transgenic lines OE-3, OE-7, and OE-9 exhibited significant differences and high activities of SOD, CAT, and POD compared to the wild type (WT) (Figure 5). The results obtained for the antioxidants and the oxidants enzymes clearly demonstrated that the transformed gene Gh_A07G0747 (GhTOM) had an overall effect on ROS accumulation by inducing more antioxidant activity under salt stress conditions.
Figure 5
Activities of antioxidant enzymes catalase (CAT), superoxide dismutase (SOD), and peroxidase (POD) in WT and Gh_A07G0747 (GhTOM)—transgenic lines. Four weeks old WT and transgenic plants were salt-stressed for 8 days and then the leaf samples were taken and used to detect activities of CAT, SOD and POD. (A) CAT activity; (B) SOD activity; (C) POD activity. Data are means ± SE calculated from three replicates. Different letters indicate a significant difference between the WT and both transgenic lines (ANOVA; p < 0.05). Three independent experiments were carried out and the results were similar.
3.6. Over-Expression of Gh_A07G0747 (GhTOM) in Plants Confers Enhanced Salt Tolerance
Plant tolerance to salt stress has been found to be positively correlated with rate of root growth, and therefore primary root growth is an indicator of stress tolerance [59]. We examined the root length and survival rate of the transgenic lines and wild type under salt stress conditions. The Gh_A07G0747 (GhTOM) transgenic lines seedlings showed longer roots and had greener broader rosettes than the wild type under 150 mM NaCl and 200 mM NaCl (Figure 6). The survival rates among the transgenic lines were significantly higher compared to the wild type in 250 mM of NaCl, however under controlled conditions, no significant difference was observed between the transgenic lines and the wild type. The wild type leaves all changed to yellow, with no green pigmentation after 4 days of salt stress exposure (Figure 6). The ability of the transgenic lines to maintain their chlorophyll for a longer period under higher level of salt stress demonstrates that the gene had a significant and positive effect on enhancing salt tolerance in the transgenic lines.
Figure 6
Comparative analysis of Gh_A07G0747 (GhTOM) transgenic and WT plant lines under salt stress conditions. (A) Gh_A07G0747 (GhTOM) overexpressing and WT plants were grown vertically in 0.5 Murashige and Skoog (MS) medium supplemented with 0, 150, and 200 mM NaCl and incubated for 6 days. (B) Survival rate of transgenic and wild type; (C) Comparison of root length between transgenic lines and WT seedlings grown on 0.5 MS medium containing different concentrations of NaCl; (D) Comparison of survival rate between transgenic lines and WT seedlings grown on 0.5 MS medium containing different concentrations of NaCl after 4 days of salt stress. Each value is the mean ± SD (n = 3), the letters “a” and “b” indicate that there is significant difference between the Gh_A07G0747 (GhTOM) transgenic and the wild-type seeds, which were determined through t-tests (* p = 0.05).
3.7. Transcripts Investigation of Salt Stress-Responsive Genes
Several prior studies have recommended numerous good stress-related marker genes. Thus, in this study, we chose ABF4, SOS2, CBL1, and RD29A as salt stress-responsive marker genes and checked their transcripts in Gh_A07G0747 (GhTOM) and WT transgenic Arabidopsis treated with and without 250 mM NaCl for 4 days, in order to dissect the possible regulatory relationships of marker genes with Gh_A07G0747 (GhTOM). The qRT-PCR results showed that the RD29A gene exhibited the most significant upregulation compared to the rest, with the highest level of expression at 60 compared to the rest with maximum expression levels ranging from 4 to 6 (Figure 7).
Figure 7
Expression levels of salt stress-responsive genes (CBL1, ABF4, RD29A, and SOS2) in wild-type and transgenic lines. Arabidopsis ACTIN2 was used as the reference gene, mean values with ± SD. * p < 0.05 as calculated by Student’s t-test.
3.8. Analysis of Chlorophyll Content in Gh_A07G0747 (GhTOM) Transgenic Lines
The ability of the plant to carry out photosynthesis under salt stress conditions depends on its ability to regulate ROS production being released from respiring cells [60]. We determined the level of chlorophyll content on transgenic and wild type plants. Under normal conditions, Gh_A07G0747 (GhTOM) lines and WT showed no clear significant differences in chlorophyll content, but after 16 days, salt-stressed samples OE-3, OE-7, and OE-9 had significantly higher contents of chlorophyll as shown in (Figure 8). So, these significant levels in overexpressed transgenic plants strengthen the speculation that because of less damage to the photosynthetic apparatus, transgenic plants maintained a stay-green property, thus distinguishing its role in salt stress tolerance.
Figure 8
Phenotypes of wild-type (WT) and Gh_A07G0747 (GhTOM)-transgenic Arabidopsis plants in response to salt stress. (A) Salt tolerance of potted plants of wild-type and Gh_A07G0747 (GhTOM)—OE Arabidopsis. Four-week-old WT and transgenic OE (OE-3, OE-7, and OE-9) plants were grown in soil in pots for 8 and 16 days under salt stress; (B) Chlorophyll determination between the wild-type and the transgenic lines after 8 days of salt stress. Values are mean ± SE, n = 12, and significant differences between wild-type and OE lines are indicated by different letters.
3.9. Subcellular Localization of Gh_A07G0747 (GhTOM) Protein
To investigate the subcellular localization of Gh_A07G0747 (GhTOM), we fused the Gh_A07G0747 (GhTOM) gene in frame with GFP and transiently expressed this gene in onion epidermal cells. Previous work reported that the TOM genes are membranous and the same was predicted before using various bioinformatics tools. Thus, in order to determine the cellular location of Gh_A07G0747 (GhTOM), a GFP–Gh_A07G0747 (GhTOM) fusion vector (pBI121-Gh_A07G0747 (GhTOM)) driven by the 35S promoter was constructed and transformed into LBA4404 cells. As a negative control, transgenic LBA4404 cells expressing only GFP were used. As a positive control, transgenic LBA4404 cells expressing GFP–Gh_A07G0747 (GhTOM) was confirmed to be localized at the plasma membrane (Figure 9). The detection of the gene at the plasma membrane validated the previous findings and the results obtained from bioinformatics analysis. The plasma membrane is greatly affected by salttoxicity, affecting the osmotic balance and membrane stability [61].
Figure 9
Localization of Gh_A07G0747 (GhTOM) in onion epidermal cells. (A–C) Onion epidermal cells transformed with 35S::GFP; (D–F) Onion epidermal cells transformed with 35S::GFP–Gh_A07G0747 (GhTOM). (A,D) Light field with magnification of X400 to display morphology. (B,E) Dark field images for the detection of green fluorescent protein (GFP) fluorescence. (C,F) Superimposed light and dark field images.
4. Discussion
Among the most significant abiotic stresses with huge economic losses in plant productivity is salt stress [62]. The problem of salt stress is currently estimated to affect over 6% of the entire arable land globally [63]. Therefore, the only probable solution to drastically reduce the effect of salt stress in plants and improve productivity is by developing plant genotypes with enhanced tolerance to salinity. A number of studies have pointed out various stress tolerance genes with profound effects in enhancing abiotic tolerance in plants. Among them are members of G-protein-coupled receptor (GPCR) genes, in which TOM is a sub-family member. The relationship of TOM genes to GPCR is debatable, though various studies have shown that TOM1 and the distant homologs CAND3, CAND4, and CAND5 are candidate plant GPCRs [64]. TOM is known to belong to the domain of unknown function (DUF1084) with PF06454. A number of members of proteins which fall within the domain of unknown functions such as DUF143 have been found to be critical in ribosomal silencing mechanism, which prevents the synthesis of ribosomes, which in turns enhances the cells’ adaptability to low nutrient levels by seizing protein biosynthesis [65]. The proteins found to be members of the domain of unknown function have been found to be critical in both plants and animals when the cells are under starvation. The main cause of starvation in cells is mainly triggered by abiotic and biotic stresses.When plants are exposed to salt stress, the photosynthetic apparatus shuts down or is greatly reduced, affecting the normal function of the plant [66]. In this research work, we explored the possible roles of TOM genes in enhancing salt stress in plants by carrying out critical analysis of the abundance of these gene sub-families in the three cotton genomes. It was interesting to note that despite the fact that the main gene family, GPCR, has not been widely studied in plants as compared to animals, we were able to detect various members of TOM genes in varying proportions (16 genes in G. hirsutum, 9 in G. arboreum, and 11 in G. raimondii), the quantities of these genes in tetraploid cotton (AD) clearly indicated that these genes had undergone a period of gene loss or the genes had possibly acquired new functions even though they evolved through whole genome duplication (WGD) in the tetraploid cotton. Based on the various physiological characteristics of these members, the TOM genes were found to have low molecular weights ranging from 10.049 kDa to 44.279 kDa, with all their GRAVY values of less than one an indication that these proteins were hydrophobic in nature [67]. The identity of TOM genes and the hydrophobic nature is coherent with a number of salt stress tolerance genes such as CsRCI2A and CsRCI2E, which were isolated from Camelina sativa (L.) (a biodiesel crop with high tolerance to cold stress); the two genes were found to be highly induced due to salinity stress [68].The tobamovirus_1 (TOM1) gene is a critical gene which is required for the efficient multiplication of tobamoviruses, positive-strand RNA viruses infecting a wide variety of plants [69]. Although the gene is associated with a wide array of viruses, a study conducted on the variation levels of oxidant and antioxidant enzymes in compatible and incompatible hosts showed increased levels of peroxidase, salicylic acid, lipid peroxidation, protein oxidation, H2O2, and decreased CAT in incompatible host–tobamovirus interaction compared to compatible hosts [70]. The ability of the TOM1 gene to have a regulatory role under salt stress indicates that it is a functional member of the GPCR genes. In this study, the transformed plants exhibited significantly reduced levels of oxidant enzymes under salt stress and increased levels of antioxidants such as CAT, POD, and SOD. Salt stress causes injury to the plasma membrane as a result of an increased production of reactive oxygen species [71]. The ability of the transgenic plant to induce more of the antioxidant enzymes demonstrates the signalling cascades played by the Gh_A07G0747 (GhTOM) gene in plants under salt stress conditions. In addition, increased production of ROS leads to increased oxidative stress, causing peroxidation of membrane lipids, which leads to increased levels of MDA within the plant cell [72]. In the analysis of MDA concentration between the transgenic and wild-type groups, there was a significant reduction in the levels of MDA in transgenic lines compared to the wild type, which demonstrated that the transgenic lines suffered less damage under salt stress conditions. Similar results have also been obtained in transformed Arabidopsis plants with cotton gene such as GHSOS1; the level of oxidant enzymes were found to be significantly reduced in the transgenic lines as compared to the wild-type [73].We carried out an expression analysis of the transgenic lines together with wild types. Gene expression profiles provide valuable information for determining the possible functions or action of the genes under stress conditions [74]. The transformed cotton gene was detected in all tissues in varying proportions, but was significantly abundant in stamen, leaf, and petal, in which we encourage further research in order to elucidate the exact role played the transformed gene in these organs. Reproduction is necessary for the continuity of the plant; thus, the ability to produce viable seeds is a survival strategy of many plants under extreme conditions. The stamen and petals are components of the reproductive organs, and could possibly aid in the fertilization and development of viable seeds. The expression levels of the various candidate genes of GPCRs are known to be highly correlated with abiotic stress tolerance [22,23,75,76,77,78]. In the present study, there was a significant difference in the expression levels of Gh_A07G0747 (GhTOM) in the leaves under salt treatment, but levels were extremely low in wild-type under the same condition. The limitation of plant growth by abiotic stress cannot be directed to a single physiological process. The dominant physiological process is photosynthesis. Plant growth as biomass production is a measure of the overall net photosynthesis, and therefore, abiotic stresses affecting growth also affect photosynthesis. Salt stress causes either short or long-term effects on photosynthesis. The leaf is the primary organ for photosynthesis; the photosynthetic pathways are enzymatically controlled and pH sensitive. Salt stress inhibits photosystem 2 (PS2) activity—PS2 primarily mediates non-cyclic electron transport from water to plastoquinone (PQ) [79]. The higher expression of the transformed gene could possibly aid in the maintenance of the photosystem 2 mechanism under salt stress conditions. In addition, salt-sensitive plants have been found to have low chlorophyll concentration. For instance, chlorophyll contents have been found to be significantly reduced in in salt-susceptible plants such as tomato [80] and potato [81], among other crops. The opposite has been observed among salt tolerant plants, which have been found to exhibit higher chlorophyll concentration (e.g., in pearl millet) [82]. To investigate if Gh_A07G0747 (GhTOM) affects the expression of salt stress genes in plants, we used four salt genes which have been extensively studied in modal plants, ABF4, SOS2, CBL1, and RD29A, and analysed their expression levels in the Gh_A07G0747 (GhTOM) transgenic Arabidopsis lines OE-3, OE-7, and OE-9, as well as the wild type. The results indicated that the expression levels of ABF4, SOS2, CBL1, and RD29A genes were significantly higher in the transgenic plant lines, as compared to the wild type under salt stress conditions. The calcineurin B-like protein1 (CBL1) has been shown to be a member of the calcineurin B-like calcium sensor proteins family, and has been found to interact with CBL-interacting protein kinase 23 (CIPK23). The CBL1 genes could possibly be acting as a regulatory subunit of a plant calcineurin-like activity controlling the calcium signalling pathways under certain salt stress conditions. The CBL1 expression level has been investigated and was found to be highly increased under various abiotic stress factors, such as high salinity, cold, and water deficit [83]. Calcineurin B-like proteins (CBLs) are mainly members of Ca2+ ion sensor proteins that mainly interact with a group of serine/threonine kinases denoted as CBL-interacting protein kinases (CIPKs) to form complexes known as calcineurin B-like proteins_CBL-interacting protein kinases (CBL-CIPK) [83,84]. CBL–CIPK complexes are mainly involved in relaying plant responses to many environmental signals (e.g., salt, drought), and are also involved in the regulation of ion fluxes [85,86,87]. The salt gene, ABF4 (ABRE-binding factor 4) is a transcription factor which mainly interacts with ABA (abscisic acid) responsive elements (ABREs) and primarily functions as transcriptional activator in ABRE-dependent transcription in Arabidopsis [88]. The upregulation of ABF4 in Arabidopsis has been found to respond to ABA treatment, drought, and salinity stress [89]. A number of studies have shown that RD29A (responsive to desiccation 29A) and RD29B (responsive to desiccation 29B) are induced by conditions such as dehydration, low temperature, high salinity, or by treatment with exogenous ABA. The induction of the two genes occurs because the promoter regions of RD29A contains the cis-acting dehydration-responsive element (DRE) while RD29B possesses two ABA-responsive elements (ABREs) in its promoter regions, which are essential for their expression under stress condition [90,91].In this investigation, we found that overexpression of Gh_A07G0747 (GhTOM) enhanced the expression levels of all four salt genes (ABF4, SOS2, CBL1, and RD29A) in the transgenic plants under normal growth conditions and under salt stress conditions, which gave an indication that Gh_A07G0747 (GhTOM) had a regulatory role in the transgenic plant and could possibly be functioning as regulatory transcriptome in enhancing salt stress tolerance in transgenic Arabidopsis.Primary plant root growth under salt condition is known to be one of the phenotypic traits of salt tolerance genotypes [92]. The transgenic plants exhibited longer roots compared to the wild type under salt stress conditions; the enhanced root lengths improved their capacity for increased water intake and conduction of water up the plants [93]. We were able to locate Gh_A07G0747 (GhTOM) in the plasma membrane. The plasma membrane is an important organelle responsible for maintaining osmotic balance within the plant [94]. The gene could possibly be responsible for maintaining the cell membrane integrity under salt stress conditions. Salt stress has been found to cause the main primary photosynthetic organelle to be highly disorganized; the number and size of plastoglobuli increase, and their starch content decreases [95]. In the mesophyll of sweet potato leaves, chloroplast thylakoid membranes have been found to be swollen, and most are lost under severe salt stress [96]. Therefore, the localization of the transformed gene within the plasma membrane could be of great significance in regulating the injuries caused as result of salttoxicity, by either increasing the level of antioxidant enzymes or through Na+ ion extrusion and transportation from roots to the shoots, a similar role to one which has been found to be played by the salt stress tolerance enhancing cotton gene known as GhSOS1, a plasma membrane Na+/H+ antiporter gene [73].
5. Conclusions
We identified a total of 36 genes in all three cotton genomes, 16 of G. hirsutum, 9 G. arboreum, and 11 genes of G. raimondii. All genes were found to be disrupted by introns. However, the mean intron lengths of the genes ranged from 172.5 to 788.8, while the mean exon lengths ranged from 70.8 to 200.2. It was found that the introns affected the functionality of the genes due the high energy demand during the splicing [97]. However, most of the stress-related genes have intron interruptions. Therefore, the expression of the genes cannot be affected by the intron disruption alone—the intron–exon ratio could possibly be playing a major role in regulating the process of gene expression. TOM1 is a unique protein, and is a member of proteins of unknown function (domain of unknown function). Its ability to confer salt stress tolerance in transgenic Arabidopsis could be a breakthrough, even though it has been reported that proteins of unknown functions are mainly mobilized when cells are faced with starvation. The results obtained in this research provide a solid foundation for the exploration of the various members of the GPCRs in plants, for their possible role in enhancing abiotic and biotic stress tolerance. The GPCRs have been intensively studied in animals, but limited studies have been done in plants. To date, no consensus has been reached on the various members of the plant GPCRs. Several investigations have provided conflicting information on whether TOM1 and their distant homologous similar proteins such as CAND3/4/5 are truly members of the plant GPCRs [98]. Their key position in cellular signal transduction means that GPCRs act as critical regulators. Moreover, the fact that their dysfunction can result in several diseases has made GPCRs the targets of the majority of all currently prescribed drugs [8]. It seems that the signals are mostly perceived at the level of membrane, and therefore transmembrane events are the likely routes for signal generation and transduction. The low level of oxidants such as MDA and H2O2 and increased levels of antioxidants such as CAT, SOD, and POD in the overexpressed lines OE-3, OE-7, and OE-9 compared to the wild type clearly indicate the significant role played by the novel gene Gh_A07G0747 (GhTOM) in enhancing salt tolerance in Arabidopsis. In addition, the chlorophyll content was significantly higher in the transgenic lines, which indicated that the genes had a greater contributory role in maintaining low-level oxidations and maintenance of the photosystem 2 process of the photosynthetic pathways within the plant. Based on the results obtained in this research work, we infer that the transformed genes, which are a member of GPCRs, can be exploited further in order to understand the exact roles in various plant biochemical and physiological pathways in enhancing tolerance to salinity.
Authors: Richard O Magwanga; Joy N Kirungu; Pu Lu; Xiu Yang; Qi Dong; Xiaoyan Cai; Yanchao Xu; Xingxing Wang; Zhongli Zhou; Yuqing Hou; Regina Nyunja; Stephen G Agong; Jinping Hua; Baohong Zhang; Kunbo Wang; Fang Liu Journal: Physiol Plant Date: 2019-02-13 Impact factor: 4.500