Literature DB >> 28765632

Efficient increase of ɣ-aminobutyric acid (GABA) content in tomato fruits by targeted mutagenesis.

Satoko Nonaka1,2, Chikako Arai3, Mariko Takayama1, Chiaki Matsukura1,2, Hiroshi Ezura4,5.   

Abstract

γ-Aminobutyric acid (GABA) is a non-proteinogenic amino acid that has hypotensive effects. Tomato (Solanum lycopersicum L.) is among the most widely cultivated and consumed vegetables in the world and contains higher levels of GABA than other major crops. Increasing these levels can further enhance the blood pressure-lowering function of tomato fruit. Glutamate decarboxylase (GAD) is a key enzyme in GABA biosynthesis; it has a C-terminal autoinhibitory domain that regulates enzymatic function, and deleting this domain increases GAD activity. The tomato genome has five GAD genes (SlGAD1-5), of which two (SlGAD2 and SlGAD3) are expressed during tomato fruit development. To increase GABA content in tomato, we deleted the autoinhibitory domain of SlGAD2 and SlGAD3 using clustered regularly interspaced short palindromic repeats (CRISPR)/CRISPR-associated protein (Cas)9 technology. Introducing a stop codon immediately before the autoinhibitory domain increased GABA accumulation by 7 to 15 fold while having variable effects on plant and fruit size and yield. This is the first study describing the application of the CRISPR/Cas9 system to increase GABA content in tomato fruits. Our findings provide a basis for the improvement of other types of crop by CRISPR/Cas9-based genetic modification.

Entities:  

Mesh:

Substances:

Year:  2017        PMID: 28765632      PMCID: PMC5539196          DOI: 10.1038/s41598-017-06400-y

Source DB:  PubMed          Journal:  Sci Rep        ISSN: 2045-2322            Impact factor:   4.379


Introduction

Lifestyle is closely related to human health. Diet, physical activity, stress, smoking, and drinking are the major causes of diseases such as high blood pressure, diabetes, hyperlipidaemia, and obesity. High blood pressure is a risk factor for heart diseases and stroke, both of which are leading causes of death worldwide. In addition, as the estimated number of patients with high blood pressure reached 1.13 billion in 2015[1], its prevention and control are globally required. The ɣ-aminobutyric acid (GABA) is a non-proteinogenic amino acid, which is widely found in bacteria, animals, and plants. Several studies in humans and experimental animals have shown that administration of exogenous GABA is effective in lowering blood pressure of hypertensive patients but not of normotensive one[2-4]. Since dietary therapy is used more preferentially than medication as an initial treatment for patients with mild high blood pressure or high-normal blood pressure, intake of GABA through daily diet may help reduce their symptoms. To this end, many have attempted to increase GABA content in a variety of local foods, such as tea, rice and fermented foods, (i.e. fermented milk, tempeh, yogurt and soy sauce)[5-9]. As these GABA-enriched products brought anti-hypotensive effects in experimental animals or human[7, 9–11], daily intake of GABA-enriched foods would be an effective way to prevent hypertension. To further promote the consumption of GABA-enriched foods in daily life, the selection of materials for enrichment of GABA may be important, because food culture generally differs among countries. It is considered that the ideal material is such a thing consumed worldwide and has high potential to produce GABA. Tomato is one of the most produced vegetables in the world and widely consumed in daily diet. In addition, tomato contains relatively higher levels of GABA than other major crops[12], probably due to its higher productivity and/or capacity to store GABA. In cultivated tomato, GABA is intensively accumulated in green-stage fruits (comprising up to 50% of the total free amino acids), but when fruits reach the red stage, GABA levels decline to less than 20% of the total free amino acids[13, 14]. To understand the molecular mechanisms underlying the changes in GABA accumulation in tomato fruits, we previously isolated GABA metabolism-related genes from tomato cultivar ‘Micro-Tom’[15]. In higher plants, GABA is predominantly metabolized through a pathway called the ‘GABA shunt’, which partially bypasses the tricarboxylic acid (TCA) cycle[16]. In this pathway, GABA is biosynthesized from glutamate by glutamate decarboxylase (GAD), and then catabolized to succinate by GABA transaminase (GABA-T) and succinic semialdehyde dehydrogenase (SSADH) in sequential reactions. We found that at least three GAD genes (SlGAD1–3), three GABA-T genes (SlGABA-T1–3), and one SSADH gene (SlSSADH) are expressed during tomato fruit development[17]. Loss of function analyses revealed that the expression of SlGAD2 and/or SlGAD3, and SlGABA-T1 is important for GABA biosynthesis and catabolism, respectively[14, 18]. Thus, GABA levels in tomato can be increased by genetically manipulating SlGAD2, SlGAD3 or SlGABA-T1 expression. For example, when SlGAD3 was overexpressed using the tomato fruit ripening-specific E8 promoter/Arabidopsis heat shock protein (HSP) 18.2 terminator expression cassette, the GABA level of red-stage fruits increased to up to six- or seven-fold that of wild-type (WT) tomato[19]. On the other hand, when SlGABA-T1 expression was suppressed by RNA interference under the control of the cauliflower mosaic virus (CaMV) 35S promoter/nopaline synthase terminator expression cassette, the GABA level in red-stage fruits increased to up to 9.2-folds that of WT tomato[14]. It is noteworthy that the fruit specific overexpression of a mutant SlGAD3, in which 87 C-terminal nucleotides (corresponding to 29 amino acids) were deleted, was even more effective in increasing the GABA level (11- to 18-folds that of WT red-stage tomato)[19]. This was likely the consequence of an increased GAD activity because plant GADs generally have an autoinhibitory domain at the C-terminus. This domain is composed of 30–50 amino acids and, in many cases, it also functions as the calmodulin (CaM)-binding domain (CaMBD). It is considered that this domain inhibits GAD activity at the physiological pH by folding its active site, and this autoinhibition is suppressed when the active site is unfolded by conformational changes via an acidic pH or by binding of Ca2+/CaM to the CaMBD at the physiological pH[20]. Thus, it is assumed that removal of this domain allows the enzyme to exert constitutive activity, resulting in high GABA accumulation. As enhanced GABA productivity by C-terminal truncation of GAD has been reported in several plant species[21-23], this trait would be widely applicable for improving GABA accumulation in plant cells. Concerning the development of breeding materials, the application of mutagenesis has been more acceptable than that of transgenesis. Thus, we previously attempted to isolate SlGAD3 mutants from a ‘Micro-Tom’ ethyl methanesulfonate (EMS) mutant population[15]. Although approximately 4,500 lines of EMS mutant alleles were screened by Targeting Induced Local Lesions In Genomes (TILLING), an efficient tool for screening point mutations[24], no mutation was found around any C-terminal region of SlGAD3 (Ezura et al., unpublished results). The Clustered, Regularly Interspaced, Short Palindromic Repeats/CRISPR-associated protein 9 (CRISPR/Cas9) system is a powerful tool for targeted mutagenesis in various organisms[25-28]. This system allows inducing double-strand breaks (DSBs) at a specific genome region and mutations, preferentially via the error-prone non-homologous end-joining (NHEJ) pathway. Although it requires designing a 20 bp-target sequence at the genome region before the protospacer-adjacent motif (PAM) sequence (5′-NGG for the type II CRISPR/Cas9 system)[29], the advantages with respect to ease of construction and high mutagenesis efficiency have accelerated the use of this system in various areas of research. In tomato, the CRISPR/Cas9 system has also been applied to successfully induce mutations at target sites[30-32]. In the present study, we induced mutations at the C-terminal region of two tomato GAD genes (SlGAD2 and SlGAD3) utilizing the CRISPR/Cas9 system to produce GABA-enhanced tomato fruits. Insertions and deletions were frequently detected at the target sites of the SlGAD2- and SlGAD3-targeted lines. In addition, the GABA content was greatly increased in the leaves and red-stage fruits of some mutant lines carrying the mutant allele that produced the GAD protein without the C-terminal domain.

Results

CRISPR/Cas9 target sites in SlGAD2 and SlGAD3

To breed a tomato line with high GABA content, the C-terminal regions of SlGAD2 and SlGAD3 were targeted by CRISPR/Cas9 technology. To select target sequence, we compared 10 amino acid sequences from five plant species (Fig. 1a). The 30 and 48 amino acids at the C terminus as target sites were selected for SlGAD2. In SlGAD3, the 37 amino acid was used as a target for CRISPR/Cas9. We used an Escherichia coli protein expression system to evaluate the activity of these three SlGADs (referred to as SlGAD2ΔC30, SlGAD2ΔC48, and SlGAD3ΔC37) at pH 5.8 (the optimal value for GAD activity) and pH 7.0 (the pH in plant cells) (Fig. 1b). C-terminal truncation increased SlGAD activity at pH 5.8 and 7.0 in the absence of Ca2+/CaM, which is an enhancer of GAD activity (Fig. 1b). SlGAD2ΔC30, SlGAD2ΔC48, and SlGAD3ΔC37 activity was 2.2, 2.7, and 14.6 times higher, respectively, at pH 5.8 and 10.2, 16.5, and 12.9 times higher, respectively, at pH 7.0 than that of full-length SlGADs. Based on these results, we predicted that inducing the stop codon at 30 and 48 amino acids for SlGAD2 and 37 amino acids for SlGAD3 via CRISPR/Cas9 would lead to increased GABA accumulation in tomato fruits.
Figure 1

Determination of the target sites within SlGADs’ C-terminal regions. (a) Multiple sequence alignment of the C-terminal region of 10 plant GADs. The C-terminal of MdGAD1-3, AtGAD1, PhGAD, OsGAD1-2, SlGAD1-3 from Malus domestica (apple), Arabidopsis thaliana, Oryza sativa (rice), and Solanum lycopersicum (tomato), respectively, which were obtained in a previous study, were compared. The conserved tryptophan (W) residue and lysine (K) clusters involved in CaM-binding[19, 48] are indicated by an asterisk and a black line, respectively. The two glutamate (E) residues functioned as pseudo-substrates and are likely involved in autoinhibition in PhGAD[43] are indicated as black circle. Accession Numbers: MdGAD1, KC812242; MdGAD2, KC812243; MdGAD3, KC812244; AtGAD1, AY094464.1; AtGAD2, U49937.1; PhGAD, L16977; SlGAD1, AB359913; SlGAD2, AV359914.1; SlGAD3, AB359915.1; OsGAD1, AB056060; OsGAD2; AB056061. (b and c) GAD activity of SlGAD2ΔC30 and SlGAD2ΔC48, and SlGAD3Δ37, respectively, in in vitro assays. Crude extracts from Escherichia coli were used in GAD enzymatic assays and Ca2+ was not included in reaction buffers. SlGAD2 and SlGAD3 are full-length GADs, whereas SlGAD2ΔC30, SlGAD2ΔC48, and SlGAD3ΔC37 are truncated GADs at C-terminal positions 30, 48, and 37, respectively. Bars represent the standard deviation (n = 3) and asterisks indicate statistical differences in according to the Tukey-Kramer’s test between full-length GADs (*P < 0.05 and **P < 0.01).

Determination of the target sites within SlGADs’ C-terminal regions. (a) Multiple sequence alignment of the C-terminal region of 10 plant GADs. The C-terminal of MdGAD1-3, AtGAD1, PhGAD, OsGAD1-2, SlGAD1-3 from Malus domestica (apple), Arabidopsis thaliana, Oryza sativa (rice), and Solanum lycopersicum (tomato), respectively, which were obtained in a previous study, were compared. The conserved tryptophan (W) residue and lysine (K) clusters involved in CaM-binding[19, 48] are indicated by an asterisk and a black line, respectively. The two glutamate (E) residues functioned as pseudo-substrates and are likely involved in autoinhibition in PhGAD[43] are indicated as black circle. Accession Numbers: MdGAD1, KC812242; MdGAD2, KC812243; MdGAD3, KC812244; AtGAD1, AY094464.1; AtGAD2, U49937.1; PhGAD, L16977; SlGAD1, AB359913; SlGAD2, AV359914.1; SlGAD3, AB359915.1; OsGAD1, AB056060; OsGAD2; AB056061. (b and c) GAD activity of SlGAD2ΔC30 and SlGAD2ΔC48, and SlGAD3Δ37, respectively, in in vitro assays. Crude extracts from Escherichia coli were used in GAD enzymatic assays and Ca2+ was not included in reaction buffers. SlGAD2 and SlGAD3 are full-length GADs, whereas SlGAD2ΔC30, SlGAD2ΔC48, and SlGAD3ΔC37 are truncated GADs at C-terminal positions 30, 48, and 37, respectively. Bars represent the standard deviation (n = 3) and asterisks indicate statistical differences in according to the Tukey-Kramer’s test between full-length GADs (*P < 0.05 and **P < 0.01).

Selection of the T0 lines with mutated target sites

According to above result, we constructed CRISPR/Cas9 vectors (TG2C30, TG2C48, and TG3C37). These vectors were introduced into tomato via Agrobacterium-mediated transformation[33]. Fourteen, 16, and 35 tomato lines with single or double copies of transgenes were found for TG2C30, TG2C48, and TG3C37, respectively (Supplementary Fig. 1). To detect the mutation, the target site on each transgenic line was cloned into a pGEM-T vector (Promega, Madison, WI, USA) and the resulting 257 sequence clones were checked by Sanger sequencing. Data was summarized in Table 1. Transgenic TG2C30, TG2C48, and TG3C37 lines contained 11, 10, and 9 mutation lines, respectively and each target site contained 6, 14, and 10 types of mutation, respectively. Only one of the 31 lines sequenced (TG2C48 #4) lacked mutations (3.33%; 1/31); the remaining lines presented mutations 3- or 4-bp upstream of PAM. Most (59.9%, 154/257) of the sequenced clones presented deletions ranging from a single to more than 200 nucleotides and 18.3% (47/257) insertions of a single nucleotide; simultaneous insertions and deletions reached 1.2% (3/257), and WT genotypes reached 20.6% (53/257). The most inserted nucleotide was T (55.3%), followed by A (29.8%), G (12.8%), and C (2.1%). The zygosity of the 31 T0 plants was predicted from clone sequences (Table 1 ), and the alleles of the target site were classified into four groups: if only one type of mutation was detected, lines were presumed to be homozygous (16.1%, 5/31); if there were two types of mutation, they were considered as bi-allelic (41.9%, 13/31); if a line had one type of mutation and a WT allele, it was classified as heterozygous (6.5%, 2/31); and if more than three types of mutation and the WT were present, we considered that the line was chimeric (32.3%, 10/31). If no mutation was detected, then the line was presumed to be WT (3.2%, 1/31).
Table 1

CRISPR/Cas9-induced mutations in target genes.

LineT0 T1
ZygosityGenotypeMutation segregationT-DNA
TG2C30
 #17Bi-allele5d50, 2d32d50, 2d32+: 2−
 #9Chimera4WT, 2d3, 1i1(A)13WT9+: 4−
 #13Chimera4WT, 2d1, 1d317WT13+: 4−
 #24Homozygote10d313d310+: 3−
 #14Homozygote8d116d116+
 #27Homozygote12d412 h11+: 1−
 #10Bi-allele6d3, 2d1NTNT
 #4Homozygote9d4NTNT
 #5Homozygote9d4NTNT
 #7Bi-allele4d3, 3d2NTNT
 #18Bi-allele3d3, 3i1(A)NTNT
Total homozygote plant (-CRISPR/Cas9)33 (5)
TG2C48
 #56Chimera4WT, 2d1, 1d5, 1i1(G)4i1(G), 1d27, 13 h, 6WT19+: 11−
 #57Chimera3d43, 2d2, 1d7, 1i1(A)13d43, 2i1(G), 1i1(C), 15 h27+: 11−
 #13Hetero11WT, 1i1(G)5d1, 2d7, 1i1(G), 6 h, 1WT8+: 10−
 #10Bi-allele7d254, 3d66d254, 4d6, 6 h15+: 3−
 #17Chimera2WT, 2d1a, 1d1b, 1i1(C)NTNT
 #12Chimera10WT, 1d3, 1i1(T)NTNT
 #4WT12WTNTNT
 #7Chimera4d66, 3d12, 3d18, 3d48NTNT
 #11Bi-allele5d2, 3d1NTNT
 #33Hetero2WT, 1i1(T)NTNT
 #52Chimera4WT, 3i1(G), 2d9NTNT
Total homozygote plant (-CRISPR/Cas9)39 (13)
TG3C37
 #21Chimera4d53, 4i1(T), 1d114i1(T), 3d53, 17 h15+: 11−
 #3Bi-allele6d4, 2(d6i1)4d4, 3(d6i1), 13 h12+: 9−
 #4Bi-allele9i1(A), 2i1(T)7i1(T), 6i1(A), 6 h15+: 8−
 #6Bi-allele4i1(T), 1i1(G)5i1(G), 3i1(T), 11 h19+: 1−
 #15Chimera6i1(T), 1d1i1, 1d27NTNT
 #10Bi-allele4d3, 3i1(T)NTNT
 #8Bi-allele5i1(T), 3d3NTNT
 #23Bi-allele2d6, 2d123NTNT
 #9Bi-allele4d6, 3d3NTNT
Total homozygote plant (-CRISPR/Cas9)35 (12)

The zygosities, such as homozygote, bi-allele and heterozygote, were estimated on T0 plant. WT, wild-type sequence with no mutation detected. “d” and “i” mean deletion and insertion, respectively. (A,T,G,C) after “i” indicated the inserted base pair. “il (T) means “T” was inserted on target site.

In T0 generation, “d#” or “i#” is # of base pair were deleted or were inserted on target site. Numbers before “d” or “i” mean the number of clones we checked. “d1i1” means 1 bp was deleted and inserted at the same time.

“a” and “b” in Superscript mean different type of 1 base pair deletion. In T1 generation, numbers before “d” or “i” means plant number with mutation in each lines. All “d” and “i” are homozygous. “h” is heterozygous. “NT” means not-tested. “+” and “−” are with or without T-DNA insertion. The number before “+” or “−” is plant numbers.

CRISPR/Cas9-induced mutations in target genes. The zygosities, such as homozygote, bi-allele and heterozygote, were estimated on T0 plant. WT, wild-type sequence with no mutation detected. “d” and “i” mean deletion and insertion, respectively. (A,T,G,C) after “i” indicated the inserted base pair. “il (T) means “T” was inserted on target site. In T0 generation, “d#” or “i#” is # of base pair were deleted or were inserted on target site. Numbers before “d” or “i” mean the number of clones we checked. “d1i1” means 1 bp was deleted and inserted at the same time. “a” and “b” in Superscript mean different type of 1 base pair deletion. In T1 generation, numbers before “d” or “i” means plant number with mutation in each lines. All “d” and “i” are homozygous. “h” is heterozygous. “NT” means not-tested. “+” and “−” are with or without T-DNA insertion. The number before “+” or “−” is plant numbers.

Characterization of the mutations induced at the C-Terminal region of T0

To verify the introduction of a stop codon immediately upstream of autoinhibitory domain, its nucleic acid sequence was translated to the corresponding amino acid sequence. Mutant lines were thus classified into four types, depending on their C-terminal amino acid sequence (Table 2, Supplementary Fig. 2): Type 1 had a stop codon immediately upstream of the autoinhibitory domain (i.e., they lacked a C-terminal); Type 2 had a conserved or defective autoinhibitory C-terminal domain, and the size of the C-terminal was almost identical to that of WT; Type 3 contained both Type 1 and Type 2 C-terminals; and Type 4 contained terminals that were both remarkably short and identical to WT C-terminals (Supplementary Fig. 2 ). Type 3 mutants were the most frequent (15/31 lines), followed by Type 2 (9/31 lines), Type 1 (4/31 lines), and Type 4 (2/31 lines), which were the rarest. Type frequency varied according to target site: Type 2 was most frequent in TG2C30 (7/11 lines), Type 3 in TG2C48 (8/11 lines), and Type 1 in TG3C37 (4/9 lines).
Table 2

Amino acid sequence of Target site (T0 generation).

LineGenotypeAmino acid sequence
GAD2WTDIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* Type of C-terminalGABA
TG2C30
#17d3DIV(10aa)RVKAKLAVAEEAAAANGIDSVAHH-TDREWELQVTEAWKKFVADKKKNKTMGVC* 3Higher
d50DIV(10aa)RVKAKLAVAEEAAAANGIDSVEEVCC*
#9WTDIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* 3Higher
d3DIV(10aa)RVKAKLAVAEEAAAANGIDSVAHQ-TDREWELQVTEAWKKFVADKKKNKTMGVC*
i1(A)DIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKNG*
#13WTDIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* 2Higher
d3DIV(10aa)RVKAKLAVAEEAAAANGIDSVAHH-TDREWELQVTEAWKKFVADKKKNKTMGVC*
d1DIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKRIENGSYRLLKHGRSLLLIKRRIRLWEFVN*
#24d3DIV(10aa)RVKAKLAVAEEAAAANGIDSVAHQ-TDREWELQVTEAWKKFVADKKKNKTMGVC* 2Same
#10d3DIV(10aa)RVKAKLAVAEEAAAANGIDSVAHQ-TDREWELQVTEAWKKFVADKKKNKTMGVC* 2Same
d1DIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKRIENGSYRLLKHGRSLLLIKRRIRLWEFVN*
#14d1DIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKRIENGSYRLLKHGRSLLLIKRRIRLWEFVN* 2Same
#27d4DIV(10aa)RVKAKLAVAEEAAAANGIDSVAH-KRIENGSYRLLKHGRSLLLIKRRIRLWEFVN* 2Same
#4d4DIV(10aa)RVKAKLAVAEEAAAANGIDSVAH-KRIENGSYRLLKHGRSLLLIKRRIRLWEFVN* 2Same
#5d4DIV(10aa)RVKAKLAVAEEAAAANGIDSVAH-KRIENGSYRLLKHGRSLLLIKRRIRLWEFVN* 2N.D.
#7d3DIV(10aa)RVKAKLAVAEEAAAANGIDSVAH-KTDREWELQVTEAWKKFVADKKKNKTMGVC* 3N.D.
d2DIV(10aa)RVKAKLAVAEEAAAANGIDSVAHQNG*
#18d3DIV(10aa)RVKAKLAVAEEAAAANGIDSVAHQ-TDREWELQVTEAWKKFVADKKKNKTMGVC* 3N.D.
i1(A)DIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKNG*
GAD2WTDIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* Type of C-terminalGABA
TG2C48
#56WTDIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* 3Higher
d1DIV(10aa)RVKAKLPWPRRRPRRTVSTAWHIIKRIENGSYRLLKHGRSLLLIKRRIRLWEFVN*
i1(G)DIV(10aa)RVKAKLGRGRGGGRGERYRQRGTS*
d5DIV(10aa)RVKASRGRGGGRGERYRQRGTS*
#57d43DIV(10aa)RTVSTAWHIIKRIENGSYRLLKHGRSLLLIKRRIRLWEFVN* 3Higher
d7DIV(10aa)RVKAPWPRRRPRRTVSTAWHIIKRIENGSYRLLKHGRSLLLIKRRIRLWEFVN*
d2DIV(10aa)RVKAKLRGRGGGRGERYRQRGTS*
i1(A)DIV(10aa)RVKAKLDRGRGGGRGERYRQRGTS*
#13WTDIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* 3Higher
i1(G)DIV(10aa)RVKAKLGRGRGGGRGERYRQRGTS*
#17WTDIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* 3Higher
d1a DIV(10aa)RVKAKLPWPRRRPRRTVSTAWHIIKRIENGSYRLLKHGRSLLLIKRRIRLWEFVN*
d1b DIV(10aa)RVKAKLAWPRRRPRRTVSTAWHIIKRIENGSYRLLKHGRSLLLIKRRIRLWEFVN*
i1(C)DIV(10aa)RVKAKLARGRGGGRGERYRQRGTS*
#12WTDIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* 3Higher
d3DIV(10aa)RVKAKP-VAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC*
i1(T)DIV(10aa)RVKAKLVRGRGGGRGERYRQRGTS*
#10d6DIV(10aa)RVKA--TVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* 4Same
d254DIV*
#4WTDIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* Same
#7d12DIV--(13aa)----TVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* 2Same
d18DIV(10aa)RVKAK------AAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC*
d48DIV-6AA-------------AAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC*
d66DIVKVLHELD-----------------NSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC*
#11d1DIV(10aa)RVKAKLPWPRRRPRRTVSTAWHIIKRIENGSYRLLKHGRSLLLIKRRIRLWEFVN* 3n.d.
d2DIV(10aa)RVKAKLRGRGGGRGERYRQRGTS*
#33WTDIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* 3n.d.
i1(T)DIV(10aa)RVKAKLGRGRGGGRGERYRQRGTS*
#52WTDIV(10aa)RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* 3n.d.
i1(G)DIV(10aa)RVKAKLGRGRGGGRGERYRQRGTS*
d9DIV(10aa)RVKA---VAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC*
GAD3WTTLADRLVSDIVKVLHELPNAKKVEDNLMINNEKKTEIEVQRAIAEFWKKYVLARKASIC* Type of C-terminalGABA
TG3C37
#21i1(T)TLADRLVSDIVKVLHELPNAKKVGG* 1Higher
d11TLADRLVSDIVKVLHELPNAK*
d53TLADRLVSDIVKVLHELPN*
#3d4TLADRLVSDIVKVLHELPNAKWRII* 1Higher
d5TLADRLVSDIVKVLHELPNAIGG*
#4i1(A)TLADRLVSDIVKVLHELPNAKKDGG* 1Higher
i1(T)TLADRLVSDIVKVLHELPNAKKVGG*
#6i1(T)TLADRLVSDIVKVLHELPNAKKVGG* 1Higher
i1(G)TLADRLVSDIVKVLHELPNAKKVGG*
#15d1+i1TLADRLVSDIVKVLHELPNAKKLEDNLMINNEKKTEIEVQRAIAEFWKKYVLARKASIC* 3Higher
d27TLADRLVSDIVKVLHELPNA---------NNEKKTEIEVQRAIAEFWKKYVLARKASIC*
i1(T)TLADRLVSDIVKVLHELPNAKKVGG*
#10d3TLADRLVSDIVKVLHELPNAK-MEDNLMINNEKKTEIEVQRAIAEFWKKYVLARKASIC* 3Higher
i1(T)TLADRLVSDIVKVLHELPNAKKVGG*
#8d3TLADRLVSDIVKVLHELPNAK-VEDNLMINNEKKTEIEVQRAIAEFWKKYVLARKASIC* 3Higher
i1(T)TLADRLVSDIVKVLHELPNAKKVGG*
#23d6TLADRLVSDIVKVLHELPNAK--EDNLMINNEKKTEIEVQRAIAEFWKKYVLARKASIC* 4Same
d123TLADRWKKYVLARKASIC*
#9d3TLADRLVSDIVKVLHELPNAK-MEDNLMINNEKKTEIEVQRAIAEFWKKYVLARKASIC* 2Same
d6TLADRLVSDIVKVLHELPNA--MEDNLMINNEKKTEIEVQRAIAEFWKKYVLARKASIC*

WT, wild-type sequence with no mutation detected. “d” and “i” means deletion and insertion, respectively. “*” was stop codon. The same sequence as Wild Type is expressed in Bold. The changed sequence by the mutation via CRISPR/Cas9 was in Regular. is the putative auto inhibitory domain and CaMd domain. The target site is in Italic. “a” and “b” in Superscript mean different one base-pair deletion. “Higher” showed higher GABA content comparing with WT. “Same level” indicated almost the same contain level as WT. n.d. means no data. GABA content was measured using fruits at the Br +10 stage (red).

Amino acid sequence of Target site (T0 generation). WT, wild-type sequence with no mutation detected. “d” and “i” means deletion and insertion, respectively. “*” was stop codon. The same sequence as Wild Type is expressed in Bold. The changed sequence by the mutation via CRISPR/Cas9 was in Regular. is the putative auto inhibitory domain and CaMd domain. The target site is in Italic. “a” and “b” in Superscript mean different one base-pair deletion. “Higher” showed higher GABA content comparing with WT. “Same level” indicated almost the same contain level as WT. n.d. means no data. GABA content was measured using fruits at the Br +10 stage (red).

Evaluation of GABA accumulation in red stage fruit of T0 mutant lines

We examined the effect of the SlGAD mutations on GABA accumulation in red-stage tomato fruits (10 days after the Breaker stage). The GABA accumulation was measured by the GABase assay method, which is a simple test to detect GABA (Fig. 2). In TG2C30, three of the eight mutant lines (#17, #9, #13) showed 2 to 10 times more GABA than the WT, and the highest-accumulation line presented 232.9 ± 7.4 mg/100 g fresh weight (FW) (n = 3, Fig. 2a). Five lines of TG2C48 (#56, #57, #13, #17, #12) showed 1.5 to 3.6 more GABA that the WT, with the highest value corresponding to 108.5 ± 26.57 mg/100 g FW (Fig. 2b). Seven lines of TG3C37 (#21, #3, #4, #6, #15, #10, #8) had higher GABA accumulation than the WT, reaching 203.3 ± 31.7 mg/100 g FW (Fig. 2c). The other lines in TG2C30 (#24, #10, #14, #27, #4), TG2C48 (#10, #4, #7), and TG3C37 (#23, #9) showed similar GABA levels to WT.
Figure 2

GABA content of T0 red-stage tomato fruits. GABA content was measured by the GABase enzymatic method using fruits at the Breaker-stage +10 days in the T0 generation. Mutations were detected at the target site of CRISPR/Cas9 in all lines. Bars indicate standard deviation (n = 3) and asterisks statistical differences according to the Tukey-Kramer’s test between mutated and control lines (*P < 0.05 and **P < 0.01). ‘C’ indicates the control plant with wild type (WT) genotype. (a,b and c) show GABA content in TG2C30, TG2C48, and TG3C37 mutated lines, respectively.

GABA content of T0 red-stage tomato fruits. GABA content was measured by the GABase enzymatic method using fruits at the Breaker-stage +10 days in the T0 generation. Mutations were detected at the target site of CRISPR/Cas9 in all lines. Bars indicate standard deviation (n = 3) and asterisks statistical differences according to the Tukey-Kramer’s test between mutated and control lines (*P < 0.05 and **P < 0.01). ‘C’ indicates the control plant with wild type (WT) genotype. (a,b and c) show GABA content in TG2C30, TG2C48, and TG3C37 mutated lines, respectively.

Relationship between C-terminal mutation types and GABA accumulation in T0

The mutation types of the C-terminal were reflected in the GABA accumulation levels of the T0 generation (Table 2, Supplementary Fig. 2). Type 1 and Type 3 mutants showed higher GABA accumulation whereas Type 2 and Type 4 mutants showed similar levels to the WT. These results indicated that a truncated C-terminal region immediately upstream of the autoinhibitory domain effectively increased GABA accumulation.

Genotype and zygosity in T1 plants

The zygosity and genotype of target sites in the T1 generation were examined as previously described[34]. Since this method used PCR product of target site and sequencing directly, homozygotic and WT genotypes was clearly identified whereas bi-allelic, heterozygous, and chimeric lines were not (identified as ‘h’ in Table 1). Six TG2C30 (#9, #13, #14, #17, #24, and #27), four TG2C48 (#13, #10, #56, and #57), and four TG3C37 (#3, #4, #6, and #21) lines that exhibited high GABA levels in the T0 generation and/or had enough seeds were used for experiments. Among these lines, 44.0% (107/243) were homozygotes, 15.2% (37/243) were WT, and 40.7% (99/243) were ‘h’. The 107 homozygous T1 plants had three genotypes: deletion ranging from a single to more than 200 nucleotides (66.4%, 71/107), single-nucleotide insertion (30.8%, 33/107), and simultaneous insertion and deletion (2.8%, 3/107).

Structure of GADs C-terminal in the homozygous mutant line of T1

Amino acid sequences of mutation lines in T1 homozygous are summarized in Table 3. Because all of these plants were homozygous, the structure of their C-terminal was classified into Type 1 or Type 2; this was further divided in two groups: C-terminal Type 2a had a conserved autoinhibitory domain and Type 2b was a defective autoinhibitory domain in C-terminal, which had almost the same size as that of WT (Supplementary Fig. 3 ). The most frequent mutation was Type 1 (21/38 plants), the second was Type 2a (10/38 plants), and the rarest was Type 2b (7/38 plants). Type frequency differed according to the target site. In TG2C30, the most frequent mutation was Type 2a (5/7 plants), in TG2 C48 it was Type 2b (7/17 plants), and in TG3C37 it was Type 1 (all plants).
Table 3

Amino acid sequence of Target site (T1 generation).

LineGenotypeAmino sequence
GAD2WTDIV-10AA-RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* Type of C-terminalGABA
TG2C30
#17-2d50DIV-10AA-RVKAKLAVAEEAAAANGIDSVEEVCC* 1Higher
#17-4d50DIV-10AA-RVKAKLAVAEEAAAANGIDSVEEVCC*
#17-1d3DIV-10AA-RVKAKLAVAEEAAAANGIDSVAHH-TDREWELQVTEAWKKFVADKKKNKTMGVC* 2aSame
#17-3d3DIV-10AA-RVKAKLAVAEEAAAANGIDSVAHH-TDREWELQVTEAWKKFVADKKKNKTMGVC*
#9-3WTDIV-10AA-RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* 2aSame
#9-5WTDIV-10AA-RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC*
#9-7WTDIV-10AA-RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC*
GAD2WTDIV-10AA-RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* Type of C-terminalGABA
TG2C48
#13-6i1DIV-10AA-RVKAKLGRGRGGGRGERYRQRGTS* 1Higher
#56-6i1DIV-10AA-RVKAKLGRGRGGGRGERYRQRGTS* 1Higher
#56-18i1DIV-10AA-RVKAKLGRGRGGGRGERYRQRGTS*
#56-19i1DIV-10AA-RVKAKLGRGRGGGRGERYRQRGTS*
#56-24i1DIV-10AA-RVKAKLGRGRGGGRGERYRQRGTS*
#13-1WTDIV-10AA-RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* 2aSame
#56-1WTDIV-10AA-RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* 2aSame
#56-13WTDIV-10AA-RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC*
#56-17WTDIV-10AA-RVKAKLAVAEEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC*
#56-12d27DIV-10AA----------EEAAAANGIDSVAHHKTDREWELQVTEAWKKFVADKKKNKTMGVC* 2aSame
#13-4d7DIV-10AA-RVKAPWPRRRPRRTVSTAWHIIKRIENGSYRLLKHGRSLLLIKRRIRLWEFV* 2bLower
#13-16d7DIV-10AA-RVKAPWPRRRPRRTVSTAWHIIKRIENGSYRLLKHGRSLLLIKRRIRLWEFV*
#13-3d1DIV-10AA-RVKAKLPWPRRRPRRTVSTAWHIIKRIENGSYRLLKHGRSLLLIKRRIRLWEFV* 2bLower
#13-9d1DIV-10AA-RVKAKLPWPRRRPRRTVSTAWHIIKRIENGSYRLLKHGRSLLLIKRRIRLWEFV*
#13-14d1DIV-10AA-RVKAKLPWPRRRPRRTVSTAWHIIKRIENGSYRLLKHGRSLLLIKRRIRLWEFV*
#13-17d1DIV-10AA-RVKAKLPWPRRRPRRTVSTAWHIIKRIENGSYRLLKHGRSLLLIKRRIRLWEFV*
#13-18d1DIV-10AA-RVKAKLPWPRRRPRRTVSTAWHIIKRIENGSYRLLKHGRSLLLIKRRIRLWEFV*
GAD3WTTLADRLVSDIVKVLHELPNAKKVEDNLMINNEKKTEIEVQRAIAEFWKKYVLARKASIC* Type of C-terminalGABA
TG3C37
#21-1i1TLADRLVSDIVKVLHELPNAKKVGG* 1Higher
#21-5i1TLADRLVSDIVKVLHELPNAKKVGG*
#21-7i1TLADRLVSDIVKVLHELPNAKKVGG*
#21-16i1TLADRLVSDIVKVLHELPNAKKVGG*
#21-18d53TLADRLVSDIVKVLHELPN* 1Higher
#21-19d53TLADRLVSDIVKVLHELPN*
#21-26d53TLADRLVSDIVKVLHELPN*
#3-1d6i1TLADRLVSDIVKVLHELPNAIGG* 1Higher
#3-6d6i1TLADRLVSDIVKVLHELPNAIGG*
#3-8d6i1TLADRLVSDIVKVLHELPNAIGG*
#3-4d4TLADRLVSDIVKVLHELPNAKWRII* 1Higher
#3-10d4TLADRLVSDIVKVLHELPNAKWRII*
#3-12d4TLADRLVSDIVKVLHELPNAKWRII*
#3-13d4TLADRLVSDIVKVLHELPNAKWRII*

Genotype of all plants in this table were homozygous. WT, wild-type sequence with no mutation detected. “d” and “i” means deletion and insertion, respectively. “*” was stop codon. The same sequence as Wild Type is expressed in Bold. The changed sequence by the mutation via CRISPR/Cas9 was in Regular. is the putative auto inhibitory domain and CaMd domain. The target site is in Italic. “a” and “b” in Superscript mean different one base-pair deletion. “Higher” meant higher GABA content comparing with WT. “Lower” shows lower GABA content than WT. “Same level” indicated almost the same contain level as WT. GABA content was measured by HPLC, using leaf (TG3C30 and TG2C48) and fruits at the Br +10 stage (red) (TG3C37).

Amino acid sequence of Target site (T1 generation). Genotype of all plants in this table were homozygous. WT, wild-type sequence with no mutation detected. “d” and “i” means deletion and insertion, respectively. “*” was stop codon. The same sequence as Wild Type is expressed in Bold. The changed sequence by the mutation via CRISPR/Cas9 was in Regular. is the putative auto inhibitory domain and CaMd domain. The target site is in Italic. “a” and “b” in Superscript mean different one base-pair deletion. “Higher” meant higher GABA content comparing with WT. “Lower” shows lower GABA content than WT. “Same level” indicated almost the same contain level as WT. GABA content was measured by HPLC, using leaf (TG3C30 and TG2C48) and fruits at the Br +10 stage (red) (TG3C37).

Plant size, flowering, and fruit yield in the T1 generation

The phenotype of 38 homozygous plants from six lines whose red-stage fruit showed high GABA content in T0 (Fig. 2) were analyzed in the T1 generation. This included 22 plants that were null CRISPR/Cas9 segregates. All TG2C30, TG2C48, and TG3C37 plants except for TG2C30 (genotype d50; #17-2, #17-4) and TG2C48 (genotype i1; #56-6, #56-18, #56-19, #56-24, #13-6) were slightly smaller than WT (Fig. 3 and Table 4). A similar trend was observed in the TG2C30 lines (#9-3, #9-5, #9-7) with the WT genotype. All of these lines were produced by regeneration, which could affect plant size in the T1 generation. TG2C30 (genotype d50; #17-2, #17-4) and TG2C48 (genotype i1; #56-6, #56-18, #56-19, #56-24, #13-6) plants were remarkably small (Table 4). Flowering was delayed in TG2C48 (#56-19), and there were no flower buds produced by TG2C30 (genotype d50; #17-2 and #17-4) and TG2C48 (genotype i1; #56-6, #56-18, #56-19, #56-24, and #13-6). Differences in the flowering were not observed between the TG2C30 (genotype d3; #17-1, #17-3), TG2C48 (genotype d1; #13-3, #13-4, #13-14, #13-17 and genotype d7; #13-9, #13-16, #13-18), all lines of TG3C37 and WT lines (Table 4). Red-stage (Breaker +10 days) fruit number per plant in the TG2C30 (genotype d3; #17-1, #17-3), TG2C48 (genotype d1; #13-3, #13-9, #13-14, #13-17, #13-18), and all lines of TG3C37 was almost the same as WT (Table 4), and red-stage fruit size was similar to or slightly larger than WT (Supplemental Fig. 4). Thus, fruit yield was not significantly affected in these lines. On the other hand, fruit number was low in TG2C30 (genotype d50; #17-2, #17-4) and TG2C48 (Genotype i1; #56-6, #56-18, #56-19, #56-24, #13-6) relative to WT.
Figure 3

Plant size in 25-week-old plants in the T1 generation. All plants were homozygous. Genotype ‘WT’ was identical to that of wild type, as no mutation was detected. ‘d’ and ‘i’ indicate deletion and insertion, respectively. Line ‘WT’ indicates a wild type plant. White bars correspond to 5 cm.

Table 4

Characterization of T1 generation.

LineGenotypePlant NumberFruit NumberDays until flowering (Days)Height (mm)GABA accumulation (mg/gFW)
LeafFruit
WT551<49.7 ± 2.099.2 ± 6.64.9 ± 0.92 (n = 15)10.04 ± 2.0 (n = 15)
TG2C30 9WT13112<64.5 ± 6.388.1 ± 7.22.79 ± 0.58 (n = 9)n.t.
17d3221<n.t.n.t.2.9 ± 1.86 (n = 6)n.t.
d5020n.t.n.t.98.2 ± 24.31** (n = 6)n.t.
TG2C48 56WT657<57.7 ± 4.692.8 ± 5.33.8 ± 1.43 (n = 9)n.t.
i14485.0 ± 7.4**63.6 ± 6.8*130.62 ± 41.03** (n = 12)n.t.
d27113<n.t.n.t.3.92 ± 1.07 (n = 3)n.t.
13WT19<n.t.n.t.2.05 ± 0.86 (n = 3)n.t.
d1560<52.6 ± 3.477.4 ± 2.30.32 ± 0.11 (n = 15)n.t.
d7220<n.t.n.t.0.31 ± 0.12 (n = 6)n.t.
i110n.t.n.t.139.55 ± 44.65** (n = 3)n.t.
TG3C37 21i1437<74.5 ± 3.5108.9 ± 7.15.18 ± 2.26 (n = 12)78.0 ± 11.31** (n = 12)
d53328<57.3 ± 10.096.0 ± 6.25.27 ± 1.00 (n = 9)88.72 ± 15.9** (n = 9)
3d4438<50.0 ± 5.477.2 ± 4.13.77 ± 1.77 (n = 12)78.75 ± 20.75** (n = 12)
d6i1326<63.3 ± 10.471.8 ± 7.33.17 ± 0.75 (n = 9)94.94 ± 32.44 (n = 9)

Genotype of all plants in this table were homozygous. In “Genotype”, WT was same as wild-type sequence with no mutation detected. “d” and “i” means deletion and insertion, respectively. In column of “Days until flowering” and “Height”, data represent means ± SD, the repetition was same as plant number. GABA content data showed means ± SD (repetition). Asterisk and dagger indicated statistical differences in Tukey-Kramer’s test and Student’s t-test (*P > 0.05, **P > 0.01, †P > 0.01), respectively. “n.t.” was non-tested.

Plant size in 25-week-old plants in the T1 generation. All plants were homozygous. Genotype ‘WT’ was identical to that of wild type, as no mutation was detected. ‘d’ and ‘i’ indicate deletion and insertion, respectively. Line ‘WT’ indicates a wild type plant. White bars correspond to 5 cm. Characterization of T1 generation. Genotype of all plants in this table were homozygous. In “Genotype”, WT was same as wild-type sequence with no mutation detected. “d” and “i” means deletion and insertion, respectively. In column of “Days until flowering” and “Height”, data represent means ± SD, the repetition was same as plant number. GABA content data showed means ± SD (repetition). Asterisk and dagger indicated statistical differences in Tukey-Kramer’s test and Student’s t-test (*P > 0.05, **P > 0.01, †P > 0.01), respectively. “n.t.” was non-tested.

GABA accumulation in leaves of T1 plants

Plant size was markedly reduced in TG2 C30 (genotype d50; #17-2 and #17-4) and TG2C48 (genotype i1; #56-6, #56-18, #56-19, #56-24, and #13-6) (Fig. 3 and Table 4). Previous studies in Arabidopsis thaliana reported that GABA accumulation affected cell elongation and decreased plant size[35]. Accordingly, we speculated that the observed reduction in plant size was caused by high GABA levels. To verify this possibility, we measured the GABA content in leaves by high-performance liquid chromatography (HPLC). TG2C30 (genotype d50; #17-2, #17-4) and TG2C48 (genotype i1; #56-6, #56-18, #56-19, #56-24, #13-6) had 16.5- to 36-fold higher GABA levels than WT plants, with the highest value corresponding to 179.01 ± 25.16 mg/100 g FW (Fig. 4b). On the other hand, TG2C48 (genotype d1; #13-3, #13-4, #13-14, #13-17 and genotype d7; #13-9, #13-16, #13-18) had levels that were lower than that of the WT. GABA content in the other lines TG2C30 (genotype d3; #17-1, #17-3), TG2C48 (genotype d1; #13-3, #13-9, #13-14, #13-17, #13-18), and all lines of TG3C37 were comparable to that in WT (Fig. 4). Only lines that had a smaller plant size had high GABA levels in the leaves; this was associated with decreased flowering and fruit yield.
Figure 4

Leaf GABA content in the T1 generation. GABA content of leaves was measured by HPLC. All lines were homozygous. Bars indicate standard deviation (n = 3) and asterisks indicate statistical differences in relation to control according to the Tukey-Kramer’s test (*P < 0.05 and **P < 0.01). ‘C’ is the control plant with WT genotype. (a,b and c) show GABA content in TG2C30, TG2C48, and TG3C37 mutated lines, respectively.

Leaf GABA content in the T1 generation. GABA content of leaves was measured by HPLC. All lines were homozygous. Bars indicate standard deviation (n = 3) and asterisks indicate statistical differences in relation to control according to the Tukey-Kramer’s test (*P < 0.05 and **P < 0.01). ‘C’ is the control plant with WT genotype. (a,b and c) show GABA content in TG2C30, TG2C48, and TG3C37 mutated lines, respectively.

Correlation between GAD C-terminal structure and GABA accumulation

The structure of the C-terminal was correlated with GABA accumulation (Table 3, Supplementary Fig. 3). Type 1 mutants with the truncated C-terminal had higher GABA accumulation than the WT, whereas Type 2a mutants, with the conserved autoinhibitory domain, had a similar GABA accumulation to that of the WT; Type 2b showed a reduced GABA accumulation. These results indicated that the truncation of the autoinhibitory domain in the C-terminal region (Type 1) increased GABA accumulation, and that in Type 2b the presence of additional meaningless amino acids strongly reduced GABA accumulation.

GABA accumulation in red-stage fruits of T1 plants

TG3C37 included only Type 1 mutants with potentially higher GABA content. We examined the effect of this mutation in red-stage (Breaker +10 days) fruit suitable for harvest by HPLC analysis of GABA levels. All TG3C37 lines had greater-than-WT GABA accumulation. TG3C37 #3 produced seven to 15 times more GABA than WT plants, with a maximum value of 125.73 ± 6.17 mg/100 g FW (Fig. 5). GABA accumulation in TG3C37 #21 was 8.75 to 11.6 times higher than in WT, with the highest value being 97.84 ± 17.46 mg/100 g FW (Fig. 5). All of the lines with high GABA content in the fruit had a stop codon immediately upstream of the autoinhibitory domain and close to C37 (ΔC34, ΔC36, and ΔC40). Taken together with the results of the in vitro enzyme assay of SlGAD3ΔC37 (Fig. 1c), we conclude that C-terminal truncation of SlGAD3 increases enzymatic activity, leading to GABA accumulation in the tomato fruit.
Figure 5

Red-stage fruit GABA content in the T1 generation. GABA content of red-stage fruits (Breaker-stage +10 days) was measured by HPLC. All lines were homozygous for TG3C37. Bars indicate standard deviation (n = 3) and asterisks indicate statistical differences in relation to control according to the Tukey-Kramer’s test (*P < 0.05 and **P < 0.01). ‘C’ is the control plant with WT genotype.

Red-stage fruit GABA content in the T1 generation. GABA content of red-stage fruits (Breaker-stage +10 days) was measured by HPLC. All lines were homozygous for TG3C37. Bars indicate standard deviation (n = 3) and asterisks indicate statistical differences in relation to control according to the Tukey-Kramer’s test (*P < 0.05 and **P < 0.01). ‘C’ is the control plant with WT genotype.

Discussion

Our results found that SlGAD2 and SlGAD3 lacking the C-terminal had an increased activity (Fig. 1b,c). Thus, the C-terminal of SlGAD2 also includes the autoinhibitory domain, and tomato has at least two kinds of active GADs. The activity of SlGAD2 is almost 10 times higher than that of SlGAD3 at pH 5.8 (Fig. 1b,c). The alignment of SlGAD2 and SlGAD3 amino acid sequences (Supplementary Fig. 5) showed these are well conserved, except for the C-terminal region, as SlGAD2 presented additional sequence immediately upstream of autoinhibitory domain compared to SlGAD3. In apple (Malus domestica), MdGAD1 showed higher activity than MdGAD2[36] and MdGAD1 also had additional sequence immediately upstream of the autoinhibitory domain (Supplementary Fig. 6). These results suggest that this additional sequence immediately upstream of the autoinhibitory domain might affect the strength of GAD activity. The correlation between the C-terminal mutation Types and GABA accumulation was observed in the T0 generation (Table 2, Supplementary Fig. 2). It was found through the analysis of the Types of C-terminal mutation and GABA accumulation that at least one truncated C-terminal effectively increased GABA accumulation. This means that heterozygous GADs with truncated C-terminal might increase GABA accumulation in the T0 generation. In tomato breeding, F1 hybrids are frequently used. The analysis of the C-terminal in the T0 generation and GABA accumulation suggested that the F1 hybrid lines would exhibit high GABA content. Thus, either parental line with a truncated GAD C-terminal introduced by CRISPR/Cas9 may be effectively used for high-GABA-content tomato breeding. The result of our experiment, in T1 generation, clearly showed that completely removal of the C-terminal region (Type 1) increased the GABA accumulation and defective C-terminal (Type 2b) caused the reduction (Table 3, Supplementary Fig. 4). The C-terminal has functions for autoinhibitory domain activated via Ca2+/CaM[20, 21, 37]. Thus, our results suggest that although the removal of the C-terminal increased GAD activity[21] (Fig. 1a), deficiencies in this domain would lead to the complete loss of GAD activity and reduce GABA accumulation in tomato. In cell environmental conditions, i.e., at pH 7.0, the C-terminal of GAD works as ‘cover’ for the active site of the enzyme, but under GABA-required conditions, such as response to biotic or abiotic stresses and growth and development, the autoinhibitory domain is released via the active site is uncover via Ca2+/CaM binding[20, 37]. Our study suggests that lines with the defective C-terminal (Type 2b) might have lost the function of Ca2+/CaM binding, keeping the active site ‘covered’, resulting in low GABA accumulation. SlGAD2 with lacking the C terminus (Type 1) suppressed plant growth, flowering, and fruit yield (Table 4), which was associated with abnormally high GABA levels in the leaves. In contrast, SlGAD3 with truncation of C terminal (Type 1) showed leaf GABA accumulation that was comparable to WT. The effect of this mutation on plant size was less than that of SlGAD2 lacking the C terminus. Moreover, this mutation increased GABA accumulation in fruits without decreasing flowering and fruit yield (Fig. 3 and Table 4). We therefore conclude that SlGAD3 is a more suitable CRISPR/Cas9 target site than SlGAD2 for increasing GABA levels in tomato fruits. The differential effects of mutations in the two genes are likely due to their distinct expression patterns: SlGAD2 and SlGAD3 were most highly expressed in leaves and in fruits, respectively (Supplemental Fig. 7). Remarkably smaller plant size in TG2C30 (genotype d50) and TG2C48 (genotype i1) with (Type 1) was caused by increased GABA accumulation in leaves (Fig. 4a,b). Altered concentrations of GABA and related metabolites in vivo can lead to severe developmental defects such as short stems caused by the failure of parenchyma cell elongation[21-23]. GAD is the entry enzyme of the GABA shunt that catalyses the decarboxylation of glutamic acid (Glu) to GABA[38]; increasing this activity can lead to a major change in carbon-nitrogen (C-N) balance that favours N[23]. Moreover, high levels of GABA in A. thaliana decreased the expression of genes encoding secreted and cell wall-related proteins[35]. SlGAD2 activation via removal of the autoinhibitory domain may thus enhance Glu-to-GABA decarboxylation and alter C-N balance, and high GABA content in leaves could inhibit the expressions of genes related to cell elongation, thereby decreasing plant size. The CRISPR/Cas9 system is more effective than the TILLING platform for introducing mutations at specific sites, for instance in the 30–50 amino acids of the SlGAD C terminus. In tomato, 0.5% and 1.0% EMS populations harbour one mutation per 1,710 and 737 kb, respectively. The overall mutation frequency (one mutation per 1,237 kb)[24] affects an average of three alleles per screened kilobase; thus, the TILLING platform is more useful for screening relatively wide regions within the genome. In a previous study using 4,588 lines of EMS mutant alleles, we isolated a GAD mutant with the TILLING platform (Ezura et al., unpublished data). Although lines with four SlGAD2 and two SlGAD3 mutations were identified, each mutation was located around the N terminus of SlGAD2 or SlGAD3. SlGAD2 and SlGAD3 genes are 6.7 kb and 2.0 kb, respectively; given the average mutation frequency, we likely isolated the maximum number of mutant lines for each gene, and it would have been difficult to isolate SlGAD2ΔC and SlGAD3ΔC in these EMS populations using the TILLING platform. The present study showed that screening 14 to 35 transgenic lines with the CRISPR/Cas9 vector was sufficient to introduce mutations at the C terminus of SlGADs, demonstrating its superiority for introducing site-specific or small-area mutations. Transgenic strategies have been employed to increase GABA accumulation in tomato fruits[18, 19]. Although overexpressing full-length SlGAD3 containing 155 mg/100 g FW GABA did not affect fruit ripening, overexpressing SlGAD3 lacking the C terminus (268 mg/100 g FW) inhibited the development of fruits with a red-ripe coloration from those with an orange colour[19]. From these previous results, we estimated that the maximum concentration of GABA in a normal ripe fruit is 155 mg/100 g FW. The targeted mutagenesis through the CRISPR/Cas9 system deleted the autoinhibitory domain of C-terminal in SlGAD3 and increased the GABA accumulation up to 125 mg/100 g FW (15 times higher than WT) in fruit with normal-red ripening. This result means that the targeted mutagenesis is useful strategy to increase GABA accumulation as well as transgenic. Regarding breeding, the application of mutagenesis would be more acceptable than transgenesis. Because after the segregation of CRISPR/Cas9 vector, it would be un-distinguished the product via conventional mutation technique and targeted mutagenesis. Therefore, inducing a mutation in the C-terminal of SlGAD3 via CRISPR/Cas9 seems to be a more useful method than the transgenic strategy with respect to both fruit phenotype and public acceptance in near feature. We succeeded in producing a high-GABA-accumulation tomato line (up to 125 mg/100 g FW in red ripe tomato fruits) using the targeted mutagenesis through the CRISPR/Cas9 system. The daily intake of 10–20 mg of GABA effectively reduces blood pressure in adults with mild hypertension[11, 39, 40]. This amount of GABA is equivalent to the level present in 10–20 g FW of C-terminal-removed tomato, which corresponds to 3–6 ‘Micro-Tom’ fruits and to one-tenth of a large tomato fruit. Therefore, the removal of SlGAD3 C-terminal by targeted mutagenesis seems to be sufficient to increase GABA accumulation and for promoting health. The removal of the C-terminal in GADs increased their activity in many plant species, such as petunia, rice, and tomato[19, 22, 41], and the overexpression of truncated C-terminal in GADs remarkably increased GABA accumulation in tobacco, rice, A. thaliana, and tomato[19, 21–23]. In apple, the activity of MdGAD1 and MdGAD2 is regulated by their C-terminal with a Ca2+/CaM binding site[36]. In the present study, the mutation introduced into the C-terminal of SlGADs, which regulates their enzymatic activity[42, 43], using the targeted mutagenesis, CRISPR/Cas9 system, produced high-GABA-accumulation tomato line. Thus, removing the C-terminal of GAD effectively increases GABA accumulation in a wide variety of crops. Therefore, our study suggests that the utilization of targeted mutagenesis targeting the C-terminal of GADs would be effective to breed high-GABA-accumulation varieties in wide range of crops. This strategy might contribute to recover from diseases associated with lifestyle, such as high blood pressure, via dietary products.

Methods

Plant materials and growth conditions

Tomato (Solanum lycopersicum L.) ‘Micro-Tom’ seeds were provided by the National Bioresource Project[15]. Seeds of WT and T1 generation were germinated on moistened filter paper, transplanted into soil, and grown in a culture room at 25 °C, under fluorescent light (60 µmol/m2/s) in a 16:8 h light:dark photoperiod. A standard nutrient solution (Otsuka A; Otsuka Chemical Co., Ltd, Osaka, Japan) was supplied. Plant height was measured on the first flowering day. Leaves were sampled during vegetative growth. Fruits were harvested 10 days after the Breaker-stage.

Vector construction and tomato transformation

The vectors for the CRISPR/Cas9 system (pZD_AtU6_Hpger_Cas9_NPTII and pDeCas9_Kan)[44, 45] were kindly provided by Prof. Holger Puchta (Botanical Institute II, Karlsruhe Institute of Technology, Karlsruhe, Germany) and Prof. Seiichi Toki [National Agriculture and Food Research Organization (NARO), Japan], respectively. The pZD_AtU6_Holger_Cas9_NPTII vector was used to introduce the mutation in the C-terminal of SlGAD2 at nucleotide 90 (corresponding to 30 amino acids), whereas pDeCas9_Kan was used to develop SlGAD2ΔC48 and SlGAD3ΔC37. The modification of these plasmids was performed following methods presented in previous studies[30, 44, 45]. Constructed vectors were introduced into A. tumefaciens GV2260[46] via electroporation. Using a highly efficient protocol[33], CRISPR/Cas9 expression was introduced into the tomato genome. Only diploid plants were screened and used in the following experiments.

Determination of GAD activity in in vivo assays

SlGAD2ΔC30, SlGAD2ΔC48, and SlGAD3ΔC37 were cloned into pET-32a vectors (Promega), which were transformed into the E. coli strain BL21(DE3) pLysS. Expression was induced by 1 mM isopropyl-β-D(-)-thiogalactopyranoside. The recombinant protein, with a histidine (His) tag, was purified by HisTrap™FF (GE Healthcare, Buckinghamshire, UK). The activity of GAD was measured according to previous study[22], by directly measuring GABA production after GAD reactions. The production of GABA was measured by the GABase method, as described below.

Measuring GABA content by the GABase method

Leaves and Breaker stage +10 days fruits were harvested and immediately frozen in liquid nitrogen. Frozen leaves and fruits were ground in liquid nitrogen, and free amino acids were extracted from 50 mg of frozen powdered samples with 8% (w/v) trichloroacetic acid. Samples were centrifuged at 10,000 × g for 20 min at 4 °C, and the supernatant was transferred to a new tube: 400 µl of pure diethyl ether were added, and samples were vortexed for 10 min. The mixture was centrifuged at 10,000 × g for 10 min at 4 °C and, after removing the supernatant, diethyl ether was added and the sample was vortexed for another 10 min. A second centrifugation at 10,000 × g for 10 min at 4 °C was performed and, after removing the supernatant, the samples were left under a draft for 1 h to completely remove diethylene. The GABA content was measured using the GABase method described by Jakoby[47], with a slight modification according to Akihiro et al.[17], or using the HPLC method, as described by Koike et al.[14], using completely dried samples dissolved in 0.01N HCl.

Statistical analysis

Mean values were compared using the Tukey-Kramer’s test. Data are expressed as means ± S.D. The Tukey-Kramer’s test was used to detect significant differences between the control. The level of statistical significance was set at*P < 0.05 and **P < 0.01. Supplementary Information
  40 in total

1.  The Metabolism and Functions of [gamma]-Aminobutyric Acid.

Authors:  A. W. Bown; B. J. Shelp
Journal:  Plant Physiol       Date:  1997-09       Impact factor: 8.340

2.  Tomato Glutamate Decarboxylase Genes SlGAD2 and SlGAD3 Play Key Roles in Regulating γ-Aminobutyric Acid Levels in Tomato (Solanum lycopersicum).

Authors:  Mariko Takayama; Satoshi Koike; Miyako Kusano; Chiaki Matsukura; Kazuki Saito; Tohru Ariizumi; Hiroshi Ezura
Journal:  Plant Cell Physiol       Date:  2015-05-25       Impact factor: 4.927

3.  Blood-pressure-lowering effect of a novel fermented milk containing gamma-aminobutyric acid (GABA) in mild hypertensives.

Authors:  K Inoue; T Shirai; H Ochiai; M Kasao; K Hayakawa; M Kimura; H Sansawa
Journal:  Eur J Clin Nutr       Date:  2003-03       Impact factor: 4.016

4.  Production of yogurt with enhanced levels of gamma-aminobutyric acid and valuable nutrients using lactic acid bacteria and germinated soybean extract.

Authors:  Ki-Bum Park; Suk-Heung Oh
Journal:  Bioresour Technol       Date:  2006-10-18       Impact factor: 9.642

5.  Targeted enhancement of glutamate-to-γ-aminobutyrate conversion in Arabidopsis seeds affects carbon-nitrogen balance and storage reserves in a development-dependent manner.

Authors:  Aaron Fait; Adriano Nunes Nesi; Ruthie Angelovici; Martin Lehmann; Phuong Anh Pham; Luhua Song; Richard P Haslam; Johnathan A Napier; Gad Galili; Alisdair R Fernie
Journal:  Plant Physiol       Date:  2011-09-15       Impact factor: 8.340

6.  The production of a new tempeh-like fermented soybean containing a high level of gamma-aminobutyric acid by anaerobic incubation with Rhizopus.

Authors:  Hideyuki Aoki; Ichiyo Uda; Keiko Tagami; Yuji Furuya; Yasushi Endo; Kenshiro Fujimoto
Journal:  Biosci Biotechnol Biochem       Date:  2003-05       Impact factor: 2.043

7.  C-terminal extension of rice glutamate decarboxylase (OsGAD2) functions as an autoinhibitory domain and overexpression of a truncated mutant results in the accumulation of extremely high levels of GABA in plant cells.

Authors:  Kazuhito Akama; Fumio Takaiwa
Journal:  J Exp Bot       Date:  2007-06-11       Impact factor: 6.992

8.  A common structural basis for pH- and calmodulin-mediated regulation in plant glutamate decarboxylase.

Authors:  Heinz Gut; Paola Dominici; Stefania Pilati; Alessandra Astegno; Maxim V Petoukhov; Dmitri I Svergun; Markus G Grütter; Guido Capitani
Journal:  J Mol Biol       Date:  2009-07-04       Impact factor: 5.469

9.  Activating glutamate decarboxylase activity by removing the autoinhibitory domain leads to hyper γ-aminobutyric acid (GABA) accumulation in tomato fruit.

Authors:  Mariko Takayama; Chiaki Matsukura; Tohru Ariizumi; Hiroshi Ezura
Journal:  Plant Cell Rep       Date:  2016-10-04       Impact factor: 4.570

10.  Tomato TILLING technology: development of a reverse genetics tool for the efficient isolation of mutants from Micro-Tom mutant libraries.

Authors:  Yoshihiro Okabe; Erika Asamizu; Takeshi Saito; Chiaki Matsukura; Tohru Ariizumi; Cécile Brès; Christophe Rothan; Tsuyoshi Mizoguchi; Hiroshi Ezura
Journal:  Plant Cell Physiol       Date:  2011-09-30       Impact factor: 4.927

View more
  40 in total

1.  CRISPR/Cas9 editing of carotenoid genes in tomato.

Authors:  Caterina D'Ambrosio; Adriana Lucia Stigliani; Giovanni Giorio
Journal:  Transgenic Res       Date:  2018-05-24       Impact factor: 2.788

Review 2.  Diverse role of γ-aminobutyric acid in dynamic plant cell responses.

Authors:  Maryam Seifikalhor; Sasan Aliniaeifard; Batool Hassani; Vahid Niknam; Oksana Lastochkina
Journal:  Plant Cell Rep       Date:  2019-02-09       Impact factor: 4.570

Review 3.  CRISPR/Cas9 technology for improving agronomic traits and future prospective in agriculture.

Authors:  Muhammad Junaid Rao; Lingqiang Wang
Journal:  Planta       Date:  2021-09-08       Impact factor: 4.116

Review 4.  CRISPR-Based Genome Editing for Nutrient Enrichment in Crops: A Promising Approach Toward Global Food Security.

Authors:  Dileep Kumar; Anurag Yadav; Rumana Ahmad; Upendra Nath Dwivedi; Kusum Yadav
Journal:  Front Genet       Date:  2022-07-14       Impact factor: 4.772

Review 5.  Genome editing and beyond: what does it mean for the future of plant breeding?

Authors:  Tien Van Vu; Swati Das; Goetz Hensel; Jae-Yean Kim
Journal:  Planta       Date:  2022-05-19       Impact factor: 4.540

Review 6.  CRISPR/Cas- and Topical RNAi-Based Technologies for Crop Management and Improvement: Reviewing the Risk Assessment and Challenges Towards a More Sustainable Agriculture.

Authors:  Fabiano Touzdjian Pinheiro Kohlrausch Távora; Francisco de Assis Dos Santos Diniz; Camila de Moraes Rêgo-Machado; Natália Chagas Freitas; Fabrício Barbosa Monteiro Arraes; Eduardo Chumbinho de Andrade; Leila Lourenço Furtado; Karen Ofuji Osiro; Natália Lima de Sousa; Thiago Bérgamo Cardoso; Liliane Márcia Mertz Henning; Patrícia Abrão de Oliveira Molinari; Sérgio Enrique Feingold; Wayne B Hunter; Maria Fátima Grossi de Sá; Adilson Kenji Kobayashi; Alexandre Lima Nepomuceno; Thaís Ribeiro Santiago; Hugo Bruno Correa Molinari
Journal:  Front Bioeng Biotechnol       Date:  2022-06-28

7.  Efficient transient protein expression in tomato cultivars and wild species using agroinfiltration-mediated high expression system.

Authors:  Ken Hoshikawa; Satoshi Fujita; Na Renhu; Kentaro Ezura; Tsuyoshi Yamamoto; Satoko Nonaka; Hiroshi Ezura; Kenji Miura
Journal:  Plant Cell Rep       Date:  2018-10-17       Impact factor: 4.570

Review 8.  Genome editing in fruit, ornamental, and industrial crops.

Authors:  Fabiola Ramirez-Torres; Rishikesh Ghogare; Evan Stowe; Pedro Cerdá-Bennasser; Maria Lobato-Gómez; Bruce A Williamson-Benavides; Patricia Sarai Giron-Calva; Seanna Hewitt; Paul Christou; Amit Dhingra
Journal:  Transgenic Res       Date:  2021-04-06       Impact factor: 3.145

Review 9.  Advances in application of genome editing in tomato and recent development of genome editing technology.

Authors:  Xuehan Xia; Xinhua Cheng; Rui Li; Juanni Yao; Zhengguo Li; Yulin Cheng
Journal:  Theor Appl Genet       Date:  2021-06-02       Impact factor: 5.574

10.  Lycopene Is Enriched in Tomato Fruit by CRISPR/Cas9-Mediated Multiplex Genome Editing.

Authors:  Xindi Li; Yanning Wang; Sha Chen; Huiqin Tian; Daqi Fu; Benzhong Zhu; Yunbo Luo; Hongliang Zhu
Journal:  Front Plant Sci       Date:  2018-04-26       Impact factor: 5.753

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.