| Literature DB >> 28408902 |
Yu Luo1, Denise T F McLean1, Gerard J Linden2, Danny F McAuley1, Ronan McMullan1, Fionnuala T Lundy1.
Abstract
Amongst the recognized classes of naturally occurring antimicrobials, human host defense peptides are an important group with an advantage (given their source) that they should be readily translatable to medicinal products. It is also plausible that truncated versions will display some of the biological activities of the parent peptide, with the benefit that they are less costly to synthesize using solid-phase chemistry. The host defense peptide, LL-37, and two truncated mimetics, KE-18 and KR-12, were tested for their inhibitory effects and antibiofilm properties against Candida albicans, Staphylococcus aureus, and Escherichia coli, microorganisms commonly implicated in biofilm-related infections such as ventilator-associated pneumonia (VAP). Using in silico prediction tools, the truncated peptides KE-18 and KR-12 were selected for minimum inhibitory concentration (MIC) and antibiofilm testing on the basis of their favorable cationicity, hydrophobic ratio, and amphipathicity compared with the parent peptide. Two methods were analyzed for determining peptide efficacy against biofilms; a crystal violet assay and an XTT [2,3-bis-(2-methoxy-4-nitro-5-sulfophenyl)-2H-tetrazolium-5-carboxanilide] assay. The biocidal activities (measured by MIC) and antibiofilm activities (measured by a crystal violet assay) appeared to be independent. LL-37 had no biocidal action against C. albicans (MIC > 250 μg/ml) but significant effects in both biofilm-prevention and biofilm-inhibition assays. KE-18 and KR-12 yielded superior MIC values against all three microorganisms. Only KE-18 had a significant effect in the biofilm-prevention assay, which persisted even at sub-MICs. Neither of the truncated peptides were active in the biofilm-inhibition assay. KE-18 was shown to bind lipopolysaccharide as effectively as LL-37 and to bind lipoteichoic acid more effectively. None of the peptides showed hemolytic activity against human erythrocytes at the concentrations tested. KE-18 should be considered for further development as a natural peptide-derived therapeutic for prevention of multi-species biofilm-related infections such as VAP.Entities:
Keywords: KE-18; LL-37; antimicrobial peptide; biofilm; human
Year: 2017 PMID: 28408902 PMCID: PMC5374219 DOI: 10.3389/fmicb.2017.00544
Source DB: PubMed Journal: Front Microbiol ISSN: 1664-302X Impact factor: 5.640
Amino acid sequences, overall net charge, and hydrophobic ratios of LL-37, KE-18, and KR-12 [charge and hydrophobic ratios were determined using the “calculation and prediction” feature of the Antimicrobial Peptide Database (http://aps.unmc.edu/AP/main.php)].
| Peptide | Sequence | Charge | Molecular mass | Hydrophobic ratio |
|---|---|---|---|---|
| LL-37 | [LL-37, 37 aa] | +6 | 4493.33 | 35% |
| KE-18 | KEFKRIVQRIKDFLRNLV | +4 | 2302.80 | 44% |
| KR-12 | KRIVQRIKDFLR | +4 | 1571.93 | 41% |
Minimum inhibitory concentration (MIC) values of LL-37, KE-18, and KR-12 against Candida albicans, Staphylococcus aureus, and Escherichia coli.
| Microorganism | MIC (μg/ml) | ||
|---|---|---|---|
| LL-37 | KE-18 | KR-12 | |
| >250 | 84 (±1) | 5 (±2) | |
| 19.3 (±5) | 7.2 (±0.6) | 8.4 (±6.3) | |
| 9.8 (±5.4) | 2.1 (±1) | 2.1 (±0.7) | |
Hemolytic activities of LL-37, KE-18, and KR-12 against human erythrocytes.
| Peptide/positive control | Concentration | Average % hemolysis |
|---|---|---|
| LL-37 | 175 μg/ml | 4.47 (±0.35) |
| KE-18 | 175 μg/ml | 1.17 (±0.18) |
| KR-12 | 175 μg/ml | 0.45 (±0.10) |
| Triton X-100 | 1% (v/v) | 100 |