Literature DB >> 24590383

Elapid snake venom analyses show the specificity of the peptide composition at the level of genera Naja and Notechis.

Aisha Munawar1, Maria Trusch2, Dessislava Georgieva3, Diana Hildebrand4, Marcel Kwiatkowski5, Henning Behnken6, Sönke Harder7, Raghuvir Arni8, Patrick Spencer9, Hartmut Schlüter10, Christian Betzel11.   

Abstract

Elapid snake venom is a highly valuable, but till now mainly unexplored, source of pharmacologically important peptides. We analyzed the peptide fractions with molecular masses up to 10 kDa of two elapid snake venoms-that of the African cobra, N. m. mossambica (genus Naja), and the Peninsula tiger snake, N. scutatus, from Kangaroo Island (genus Notechis). A combination of chromatographic methods was used to isolate the peptides, which were characterized by combining complimentary mass spectrometric techniques. Comparative analysis of the peptide compositions of two venoms showed specificity at the genus level. Three-finger (3-F) cytotoxins, bradykinin-potentiating peptides (BPPs) and a bradykinin inhibitor were isolated from the Naja venom. 3-F neurotoxins, Kunitz/basic pancreatic trypsin inhibitor (BPTI)-type inhibitors and a natriuretic peptide were identified in the N. venom. The inhibiting activity of the peptides was confirmed in vitro with a selected array of proteases. Cytotoxin 1 (P01467) from the Naja venom might be involved in the disturbance of cellular processes by inhibiting the cell 20S-proteasome. A high degree of similarity between BPPs from elapid and viperid snake venoms was observed, suggesting that these molecules play a key role in snake venoms and also indicating that these peptides were recruited into the snake venom prior to the evolutionary divergence of the snakes.

Entities:  

Mesh:

Substances:

Year:  2014        PMID: 24590383      PMCID: PMC3968365          DOI: 10.3390/toxins6030850

Source DB:  PubMed          Journal:  Toxins (Basel)        ISSN: 2072-6651            Impact factor:   4.546


1. Introduction

Elapid snake venoms contain a large number of pharmacologically active peptides, influencing important physiological functions, like blood coagulation and the cardiovascular and nervous systems [1]. Venom peptides are a rich and potent source of the prototypes of novel drugs. Their high target specificity, structural stability, relative ease of chemical synthesis and the possibility to improve the drug efficacy by chemical modifications are very suitable for pharmaceutical application and for the design of novel medicines. In this connection, the partnership of the Australian biopharmaceutical company, QRxPharma Ltd (North Sydney, Australia), and its subsidiary, Venomics Pty Ltd (VPL) (North Sydney, Australia), with the University of Queensland for the development of novel drug prototypes from elapid snake venom is a remarkable example of collaboration between science and the pharmaceutical industry. As a result, three novel compounds acting on the hemostatic system are in preclinical development [2,3]. There exists a number of other examples of the successful application of the knowledge about venom peptide structure and function for pharmaceutical purposes. Probably the most impressive example is the development of the well-known anti-hypertensive drug, Captopril® [4] and other derivatives [5]—angiotensin-converting enzyme (ACE) inhibitors designed on the basis of the B. jararaca venom peptide structure. The necessity of new generation medicines and the application of the venom peptide structure for drug design are discussed in a review published recently [6]. Venom peptides are a novel alternative to a number of contemporary existing drugs. For this reason, further studies on the snake venom peptidome are of pharmaceutical and clinical significance. At present, there is a demand to develop a new generation of anti-hypertensive drugs without or with lesser side effects. This can be achieved by selective blocking of one of the two domains of ACE [7]. Snake venom peptide structures can serve as models for respective drug design investigations. The crystal structure of BPPb (snake venom bradykinin-potentiating peptide, a selective inhibitor of the C-domain of ACE) in complex with the C-domain of human ACE illustrates that the inhibitor binds at the active site in a Zn-independent manner, revealing new modes of active site interactions compared to the so far described ACE-inhibitor complex structures [8]. This study describes a comparative venom peptide analysis of two elapid snakes: Naja mossambica mossambica (representative of the genus, Naja) and N. scutatus from Kangaroo Island (genus Notechis). Both snakes are widely recognized species of the genera, Naja and Notechis. Naja species belong to the most widespread group of snakes known as cobras, found in Africa and Asia. Notechis (tiger snakes) is a large group of snakes distributed in Australia. They are among the most venomous in the world [9].

2. Results

2.1. Purification and Identification of Peptides from N. m. mossambica Venom

Figure 1A shows the fractionation of the N. m. mossambica venom. SDS-PAGE (Sodium dodecyl sulfate-polyacrylamide gel electrophoresis) demonstrated the presence of peptides below 10 kDa in Peaks 4–10 (Figure 2). Peak 5 showed inhibitory activity towards subtilisin (StmPr1), chymotrypsin and trypsin. The fractions marked as 8 and Peak 10 showed inhibitory activity towards ACE. Peak 5 was further purified with a Resource S column at pH 5.5 by liquid chromatography (Figure 3), and three main peaks were observed. Fraction 18 showed inhibitory activity towards subtilisin, chymotrypsin and trypsin. Matrix-assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF-MS) and electrospray ionization time of flight mass spectrometry (ESI-TOF-MS) showed the presence of a 6819.28 Da peptide in the first peak. The MALDI-TOF mass spectrometric analysis showed the presence of peptides with molecular masses of 6726 Da and 6837 Da in Peaks 2 and 3, respectively.
Figure 1

(A) Size-exclusion chromatography of N. m. mossambica venom on a Superdex C-75 10/300 column at pH 5.0; (B) size-exclusion chromatography of the N. scutatus from Kangaroo Island venom on a Superdex G-75 16/60 column at pH 5.0.

Figure 2

SDS-PAGE (Sodium dodecyl sulfate-polyacrylamide gel electrophoresis) of the fractions, 1–7, from the size exclusion chromatography of N. m. mossambica venom.

Figure 3

Further purification by fast protein liquid chromatography (FPLC) of Peak 5 (Figure 1A) with a Resource-S column (1 mL) at pH 5.5.

(A) Size-exclusion chromatography of N. m. mossambica venom on a Superdex C-75 10/300 column at pH 5.0; (B) size-exclusion chromatography of the N. scutatus from Kangaroo Island venom on a Superdex G-75 16/60 column at pH 5.0. SDS-PAGE (Sodium dodecyl sulfate-polyacrylamide gel electrophoresis) of the fractions, 1–7, from the size exclusion chromatography of N. m. mossambica venom. Further purification by fast protein liquid chromatography (FPLC) of Peak 5 (Figure 1A) with a Resource-S column (1 mL) at pH 5.5. Purification of the peptides from Peak 5 (Figure 1A) is described in detail to illustrate the approach used for the purification of peptides from N. m. mossambica venom. The same procedure was adopted to isolate and characterize the peptides listed in Table 1. A peptide with a molecular mass of 6895.4 Da was identified in Peak 6 and peptides with masses of 872.5–1276.6 Da were identified in Peaks 8 and 10.
Table 1

Pharmacologically active peptides isolated from the Naja mossambica mossambica venom. Abbreviations used: ACE, angiotensin-converting enzyme; BPP, bradykinin-potentiating peptide; Z, pyroglutamyl residue; X, isoleucine/leucine; SEC, size-exclusion chromatography. The molecular masses of the peptides were determined by matrix-assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF-MS) or electrospray ionization time of flight mass spectrometry (ESI-TOF-MS). The larger peptides were digested by trypsin and the resulting peptides analyzed by LC/ESI-ion trap MS. The identified tryptic peptides are shown in bold. Small peptides were directly analyzed by MALDI-TOF/TOF MS.

Fraction number (SEC)Observed m/zScore/sequence coverageSequence Inhibitory activityHomology with peptide from Peptide family
5975.1823 (M + H)7+274/70%LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTNKCNBacterial subtilisin (StmPr1), chymotrypsin and 20S proteasomeP01467: Naja mossambicaSnake venom three-finger toxin (CTX M1)
5, 66896.40 (M + H)+71/48%LKCNRLIPPFWKTCPEGKNLCYKMTMRLAPKVPVKRGCIDVCPKSSLLIKYMCCNTNKCN P01470: Naja mossambicaSnake venom three-finger toxin (CTX M3)
56727.402 (M + H)+119/93%LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN P01452: Naja mossambicaSnake venom three-finger toxin (CTX M4)
8873.4511 (M + H)+32ZQKFSPR P85314: Bothrops moojeniZinc metalloproteinase
8901.4614 (M + H)+30ZQRFSPR Q072L5: Bothrops asperZinc metalloproteinase/disintegrin
8779.3983 (M + H)+22ZXWPRPACEP0C7R6: Agkistrodon piscivorus piscivorusBPP
101214.6581 (M + H)+51ZXWPRPQXPPACEP0C7S6: Crotalus atroxBPP
101276.6380 (M + H)+45ZQWPPGHHXPPACEP0C7J9: Crotalus adamanteusBPP
101063.5611 (M + H)+20TPPAGPDVGPR Q27J49: Lachesis muta mutaBradykinin inhibitor peptide
101230.6743 (M + H)+18QXWPRPQXPPACEP0C7S6: Crotalus atroxBPP
101277.6380 (M + H)+26ZEWPPGHHXPPACEQ27J49: Lachesis muta muta BPP
Pharmacologically active peptides isolated from the Naja mossambica mossambica venom. Abbreviations used: ACE, angiotensin-converting enzyme; BPP, bradykinin-potentiating peptide; Z, pyroglutamyl residue; X, isoleucine/leucine; SEC, size-exclusion chromatography. The molecular masses of the peptides were determined by matrix-assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF-MS) or electrospray ionization time of flight mass spectrometry (ESI-TOF-MS). The larger peptides were digested by trypsin and the resulting peptides analyzed by LC/ESI-ion trap MS. The identified tryptic peptides are shown in bold. Small peptides were directly analyzed by MALDI-TOF/TOF MS. Three peptide cytotoxins (cardiotoxins), cytotoxin 1 (P01467, CTX M1), cytotoxin 3 (P01470, CTX M3) and cytotoxin 4 (P01452, CTX M4) were identified in the N. m. mossambica venom (Table 1). The cytotoxins were identified by analysis of tryptic digests using LC/ESI ion trap MS and subsequent database search. Fraction 18 of Peak 1 (Figure 3) contained cytotoxin 1 (P01467), Peak 2, cytotoxin 4, and Peak 3 was a mixture of cytotoxins 1 and 3. Cytotoxin 3 (P01470) was also identified in Peak 6 (Figure 1A). The identified fragments matching the toxin sequences are shown in bold in Table 1. Figure 4A shows a sequence alignment of the three cytotoxins. The different amino acid residues are shaded grey, and the cysteine residues are highlighted in black. Cytotoxins 1 and 3 show 93% sequence identity with each other. The three cytotoxins have different amino acids at positions 5 and 28. Lys 16 of cytotoxin 1 (P01467) is substituted by glutamic acid in the other two toxins.
Figure 4

(A) Sequence alignment of cytotoxin 1 (P01467), cytotoxin 3 (P01470) and cytotoxin 4 (P01452) isolated from N. m. mossambica venom. The cysteine residues are shaded black, and the disulfide bonds are indicated. The variable amino acid residues are shaded grey; (B) the sequence alignment of the Kunitz inhibitors isolated from the N. scutatus (Kangaroo Island) venom shows a variation in the reactive site residues. The same peptides, named protease inhibitor tigerin 1 (Q61TB3) and tigerin 3 (B5KL32), were found by transcriptome analysis in the Notechis scutatus scutatus venom gland [10].

(A) Sequence alignment of cytotoxin 1 (P01467), cytotoxin 3 (P01470) and cytotoxin 4 (P01452) isolated from N. m. mossambica venom. The cysteine residues are shaded black, and the disulfide bonds are indicated. The variable amino acid residues are shaded grey; (B) the sequence alignment of the Kunitz inhibitors isolated from the N. scutatus (Kangaroo Island) venom shows a variation in the reactive site residues. The same peptides, named protease inhibitor tigerin 1 (Q61TB3) and tigerin 3 (B5KL32), were found by transcriptome analysis in the Notechis scutatus scutatus venom gland [10]. CTX M4 shows 68% sequence identity in comparison to the other two cytotoxins. The differences in amino acids are in the three loop regions. CTX M1 and CTX M3 have proline at position 30, and therefore, they belong to the P-type cytotoxins, while CTX M4 has SER 28 and can be classified as an S-type cytotoxin [11]. The differences in amino acid residues suggest the functional diversity of these polypeptides. Fraction 18 of Peak 1 (Figure 3) containing CTX M1 inhibited subtilisin (StmPr1) and chymotrypsin, while CTX M3 did not inhibit any of the tested enzymes. CTX M1 was also found to inhibit the chymotryptic-like activity of the 20S proteasome strongly. From the ESI-TOF-MS spectrum (Figure 5), the molecular weight of cytotoxin 1 (P01467) in fraction 18 (Figure 3) was calculated to be 6819.3 Da.
Figure 5

ESI-TOF-MS spectrum of cytotoxin-1, P01467 (isolated from N. m. mossambica venom) showing multiply charged ions.

ESI-TOF-MS spectrum of cytotoxin-1, P01467 (isolated from N. m. mossambica venom) showing multiply charged ions. Eight single charged ions of m/z 873–1277 (M + H)+ were also identified in Naja m. mossambica venom (Table 1). The sequences of all peptides were determined by MALDI-TOF/TOF mass spectrometry. The MALDI-TOF/TOF of representative peptides with m/z 1214.6581 (M + H)+ and m/z 1276.6380 (M + H)+ is shown in Figure 6. The sequence annotation pictures of the MALDI-TOF/TOF spectra were prepared with the Bruker software ProteinScape, version 3.0. Five of these peptides belong to the BPP family. One bradykinin inhibitor peptide, previously isolated from Lachesis muta muta and Agkistrodon bilineatus venoms, was also identified. The other two peptides are small fragments of a snake venom metalloproteinase. The peptide, ZXWPRPQXPP, is a modified form of QXWPRPQXPP, which was isolated from the Crotalus atrox venom, with the N-terminal Q modified to pyroglutamate. ZEWPPGHHXPP and ZQWPPGHHXPP are homologous peptides with a single amino acid substitution. ZXWPRP is another form of ZXWPRPQXPP lacking the C-terminal QXPP.
Figure 6

MALDI TOF/TOF MS of the representative peptides isolated from N. m. mossambica. (A) At m/z 1214.6581 (M + H)+; (B) at m/z 1276.6380 (M + H)+.

2.2. Purification and Identification of Peptides from N. scutatus (Kangaroo Island) Venom

Figure 1B shows the fractionation of the N. scutatus venom. The peaks were analyzed by SDS-PAGE (Figure 7) and the fractions containing peptides with molecular masses <10 kDa (Peaks 4–8) were collected for further analysis. Inhibitory activities towards trypsin, plasma kallikrein, plasmin and angiotensin-converting enzyme were found in Peak 4. These fractions were pooled and the peptides separated by reverse phase chromatography (Figure 8). Samples were subjected to MALDI-TOF-MS and tryptic digest analysis. The inset of Figure 8 shows the MALDI-TOF-MS of fraction eluting at 19.3 min. The sequences and observed masses of the peptides are summarized in Table 2. The peptides identified by tryptic digestion are shown in bold. The data allowed the classification of the peptides from both snakes into protein/peptide families using three indexes: molecular masses, enzyme inhibitory activity and amino acid sequences. Two short neurotoxins with molecular masses of 6647.9 Da and 6687.7 Da (Table 2) were purified by reverse phase chromatography. These neurotoxins have been reported previously at a transcript level in the venom of other Australian elapid snakes: Notechis scutatus scutatus and Austrelaps superbus, respectively [12]. They are 60-amino acid polypeptides with high homology. Two Kunitz/basic pancreatic trypsin inhibitor (BPTI) peptides (Table 2) were also identified. They are 59-amino acid polypeptides and have been reported before at the transcript level as tigerin 1 (Q61TB3) and tigerin 3 (B5KL32) in the venom gland of Notechis scutatus scutatus [10]. We found that tigerin 1 (Q61TB3) shows inhibitory activity towards trypsin and kallikrein and also weakly inhibits plasmin, while tigerin 3 (B5KL32) inhibits only trypsin. Both Kunitz-type peptides did not inhibit either factor Xa or thrombin. Sequence analysis showed that the residues at the reactive site are different in the two toxins (Figure 4B). A natriuretic peptide, NP, with a molecular mass of 3347.7 Da, having inhibitory activity towards ACE, was also identified. Low molecular weight peptides, with m/z in the range 600–1600 (M + H)+, were separated by reverse phase chromatography. Fractions containing low molecular weight peptides with m/z in the range 600–1600 (M + H)+ strongly inhibited ACE. The molecular mass range suggests that they are probably novel BPPs. The MALDI-TOF/TOF MS analysis and subsequent database search by the Inhouse Mascot server did not retrieve any sequences. The ESI-QTOF-MS analysis of these peptide fractions showed the presence of glycopeptides. Signals were observed for the following glycan moieties: hexose, N-acetylhexosamine and N-acetylneuraminic acid. However, it was not possible to determine the peptide sequence of the glycopeptides, because the collision-induced dissociation technique fragments the carbohydrate moiety. The limited amount of material unfortunately did not allow for performing different mass spectrometric experiments, such as electron transfer dissociation, which would, in principle, provide the sequence information of the peptide, by fragmentation of the amino acids, and preserve the glycosylation on the peptide backbone [13]. Only one communication on the isolation of snake venom glycopeptides has been published so far: that on the venom composition of Dendroaspis angusticeps [14]. The isolated glycopeptides have a high proportion of proline residues with molecular masses ranging from 1.3 kDa to 2.4 kDa [14].
Figure 7

SDS-PAGE of fractions 1–6 from the size exclusion chromatographic separation (Figure 1B) of the crude venom of N. scutatus (Kangaroo Island).

Figure 8

Purification of Peak 4 (Figure 1B) with a SOURCE™ 5RPC column by HPLC. Inset shows MALDI-TOF-MS of the peptide (tigerin-3, B5KL32) eluting at 19.319 min.

Table 2

Pharmacologically active peptides isolated from N. scutatus venom. Abbreviations used: ACE, angiotensin-converting enzyme; NP, natriuretic peptide; X, Leucine/isoleucine. All peptides were purified from Peak 4 of Figure 1B. The molecular masses of the peptides were determined by MALDI-TOF-MS. Tryptic peptides of larger peptides were analyzed by LC/ESI-ion trap MS. The peptides identified by tryptic digestion are shown in bold. Fractions containing glycopeptides were analyzed by ESI-Q-TOF MS.

Observed m/z (M + H)+Score/sequence coverageSequence determinedInhibitory activityHomology with peptide fromPeptide family
6647.921*185/44%MTCCNQQSSQPKTTTTCAESSCYKKTWRDHRGTITERGCGCPNVKPGVQINCCKTDECNN A8HDK0: Notechis scutatus scutatusSnake venom three-finger toxin
6687.729121/27%MTCCNQQSSQPKTTTTCAESSCYKKTWRDHRGTIIERGCGCPNVKPGIQLVCCETNECNN A8S6A4: Austrelaps superbusSnake venom three-finger toxin
6810.5591569/65%KDRPHFCHLPHDTGPCNRNTQAFYYNPVYHTCLKFIYGGCQGNSNNFKTIDECKRTCAATrypsinB5KL32: Notechis scutatus scutatusKunitz/BPTI
6694.233231/45%KDHPEFCELPADSGPCRGILHAFYYHPVHRTCLEFIYGGCYGNANNFKTIDECKRTCAATrypsin, plasma kallikrein, plasminQ6ITB3: Notechis scutatus scutatusKunitz/BPTI
3347.68854/30%SGSEVAKIGDGCFGLPLDRIGSASGMGCRSVPKPACEQ3SAE8: Notechis scutatus scutatusNP
1154.556 QNPPKPXSGES Q3SAX8: Oxyuranus scutellatus scutellatusNP
764.201 (M + H)2+ Glycopeptide
681.251 Glycopeptide

Notes: * The mass measured by us by MALDI mass spectrometry is 6647.921 (M + H)+, whereas the calculated one is 6639.4 Da. Clearly, there is a discrepancy between the calculated and the measured mass. The identity of A8HDK0 was obtained by analyzing tryptic peptides with LC-MS followed by a Mascot search. Since the Mascot score for the identification of A8HDK0 was reasonable, it can be assumed that this protein was present in the corresponding fraction. Several reasons are possible, also in combination, which may explain the discrepancy of the measured and calculated mass: 1. We obtained a sequence coverage of 44%. Thus, we do not have any information about the rest of the protein. The missing peptides may include posttranslational modifications, which also might explain why we missed these peptides in the search result of MASCOT. 2. An exchange of amino acids cannot be excluded. 3. Mistakes in the protein database can also not be excluded. The same explanation can be taken into account for other mass differences.

MALDI TOF/TOF MS of the representative peptides isolated from N. m. mossambica. (A) At m/z 1214.6581 (M + H)+; (B) at m/z 1276.6380 (M + H)+. SDS-PAGE of fractions 1–6 from the size exclusion chromatographic separation (Figure 1B) of the crude venom of N. scutatus (Kangaroo Island). Purification of Peak 4 (Figure 1B) with a SOURCE™ 5RPC column by HPLC. Inset shows MALDI-TOF-MS of the peptide (tigerin-3, B5KL32) eluting at 19.319 min. Pharmacologically active peptides isolated from N. scutatus venom. Abbreviations used: ACE, angiotensin-converting enzyme; NP, natriuretic peptide; X, Leucine/isoleucine. All peptides were purified from Peak 4 of Figure 1B. The molecular masses of the peptides were determined by MALDI-TOF-MS. Tryptic peptides of larger peptides were analyzed by LC/ESI-ion trap MS. The peptides identified by tryptic digestion are shown in bold. Fractions containing glycopeptides were analyzed by ESI-Q-TOF MS. Notes: * The mass measured by us by MALDI mass spectrometry is 6647.921 (M + H)+, whereas the calculated one is 6639.4 Da. Clearly, there is a discrepancy between the calculated and the measured mass. The identity of A8HDK0 was obtained by analyzing tryptic peptides with LC-MS followed by a Mascot search. Since the Mascot score for the identification of A8HDK0 was reasonable, it can be assumed that this protein was present in the corresponding fraction. Several reasons are possible, also in combination, which may explain the discrepancy of the measured and calculated mass: 1. We obtained a sequence coverage of 44%. Thus, we do not have any information about the rest of the protein. The missing peptides may include posttranslational modifications, which also might explain why we missed these peptides in the search result of MASCOT. 2. An exchange of amino acids cannot be excluded. 3. Mistakes in the protein database can also not be excluded. The same explanation can be taken into account for other mass differences.

3. Discussion

Elapid species of the superfamily Colubroidea [15] are among the most toxic snakes of the world ([2,9] and the references therein). However, their venoms are poorly known from a toxicological and drug discovery point of view [2]. The analyses of the N. m. mossambica and N. scutatus venom peptide compositions revealed specificity at the genus level. The Naja m. mossambica venom peptidome contains cytotoxic-type three-finger toxins, bradykinin-potentiating peptides and a bradykinin inhibitor, but lacks Kunitz/BPTI inhibitors. At the same time, the peptide fraction analysis of N. scutatus venom revealed the presence of Kunitz/BPTI inhibitors, neurotoxic-type three-finger toxins and natriuretic peptides. Neurotoxins have been isolated from N. m. mossambicavenom [16]. We did not find representatives of this group of toxins in the venom of the snake mentioned above. It is known that the venom composition depends on the diet of the snake, the geographical region, ontogenetic variations, etc. ([17] and the references therein). Furthermore, very low quantities of the respective toxins in the venom can prevent their identification. α-neurotoxins make up only 0.4%–12.6% of the venom proteins of the Naja species [18]. The Naja species possesses cardiotoxins, 60–62 residue basic peptides, pharmacologically distinct from the so-called “short neurotoxins” [19,20]. Cytotoxins predominate in Naja venom toxins and constitute 72.8% of the Naja nigricollis total venom proteins [18]. The three-finger toxins found in elapid venoms constitute a superfamily of non-enzymatic polypeptides, consisting of 60–74 amino acids [1,21]. Three-finger cardiotoxins have been reported exclusively in cobra venom. These toxins form ion pores in the lipid membranes [22]. The structure of CTXs was investigated by crystallographic [19,23] and NMR [24] methods. The cytotoxin 1 (P01467) that we have isolated from Naja. m. mossambica venom (Table 1) shows inhibitory activity towards the 20S proteasome, a 700 kDa multi-catalytic complex constituting the proteolytic core of the 26S proteasome complex. The complex possesses three active sites: chymotrypsin-like, trypsin-like and peptidyl-glutamyl peptide hydrolyzing (PGPH)-like ([25] and the references therein). Proteasomes are present in the cell nucleus and cytoplasm, and their main function is to maintain the concentration of specific proteins and to degrade damaged, oxidized or misfolded proteins [26]. The cells use ubiquitin-proteasome systems to maintain cellular homeostasis [27]. It can be supposed that after envenomation, the Naja m. mossambica venom cytotoxin 1 (P01467) might be involved in the disturbance of cellular processes by inhibiting a vital catalytic machinery of the cell, the 20S proteasome. Inhibition of this complex could be one of the mechanisms involved in cytotoxin-mediated cell death. Cytotoxin 1 (P01467) can serve as a promising candidate for cancer therapy, as the proteasome is an important target for the treatment of cancer [28,29]. Already, CTX III isolated from Naja naja atra venom was reported to have anticancer activity against human breast cancer cells [30]. The N. scutatus peptidome contains three-finger α-neurotoxins (Table 2). Neurotoxins are responsible for neurological effects as a result of envenomation by Australian snakes [12]. They inhibit nicotinic acetylcholine receptors (nAChRs) [12,17]. The snakes use venom hypotensive peptides to weaken their prey. Bradykinin-potentiating peptides are natural inhibitors of angiotensin converting enzymes, which play a key role in blood pressure regulation [5]. The pharmaceutical industry developed a large number of antihypertensive drugs, like captopril and other derivatives, designed using the BPP structure [7]. However the synthetic ACE inhibitors, used at present, cause serious side effects, which could be ascribed to their inability to discriminate between the C- and N- domains of the enzyme. C-domain-specific inhibitors could have the same effect as the currently available drugs, but with low or no side effects, due to decreased bradykinin and substance P levels [5]. The structure of novel BPPs, like that identified in N m. mossambica venom (Table 1), might help to design more specific C-domain ACE inhibitors, since this region of the enzyme is the major site of angiotensin-1 processing. It was demonstrated by Fry and Wüster [31] that snake venom toxins evolved from the recruitment of body proteins into the venom. Comparison of BPPs from elapid (this work) and viperid [32] snake venoms showed a high similarity, suggesting the recruitment of these peptides into the snake venom before the split of the two families. A possible reason for this is the important role of BPPs in prey immobilization. Hypotension is usually associated with poisoning upon snake envenomation [33,34,35]. Natriuretic peptides (NPs), like that described in Table 2, have profound effects on the cardiovascular system [36]. Their structures are promising for the design of novel medicines with vasodilator, natriuretic and diuretic properties [37]. The physiological role of the Kunitz/BPTIs (bovine pancreatic trypsin inhibitors) in snake venom is not completely understood. It was proposed that they participate in the processes of coagulation, fibrinolysis and inflammation through protease inactivation [38]. The sequence analysis of the two Kunitz inhibitors, isolated from the venom ofN. scutatus, showed that the reactive site residues are different in the two peptides. The P1 residue is considered to be the most critical site defining the specificity and inhibitory interaction with serine proteases [39,40]. The amino acid sequence of the Kunitz/BPTI inhibitors, isolated from N. scutatus venom, was found also by analyzing the transcriptome of the Notechis scutatus scutatus venom gland [10]. The sequences are compared in Figure 4B. The amino acid residues at position P1 of the two inhibitors are different: a positively charged Arg in the first peptide and a neutral Asn in the second (Figure 4B). Other amino acids at the primary binding loop (P3P2P1P1′P2′P3′P4′) can also interact with proteolytic enzymes [41]. The sequences of this loop in the two inhibitors are quite different, PCRGILH and TGPCNRNTQ, respectively. Previous studies have shown that at least one of the residues at P2′ or P4′ should have a basic histidine residue to form a complex with kallikrein ([42] and the references therein). The first polypeptide has a histidine at the P4′ position (Figure 4B), and this explains its inhibitory activity towards kallikrein, as we have observed (Table 2). The second has a glutamine at the same position (Figure 4B), and we did not observe the inhibition of kallikrein by this peptide. It can be concluded that the different amino acid residues at the primary binding loop of both Kunitz/BPTI inhibitors are responsible for their inhibitory specificity towards serine proteases. A search in the UniProt database indicated that the sequence motif, NRN, at P1P1′P2′ position was found only in the Notechis scutatus scutatus venom Kunitz inhibitor, a species related toN.scutatus. The observed high affinity of the isolated polypeptide inhibitor towards kallikrein could be used for the design of specific inhibitors of plasma kallikrein to treat diseases, such as hereditary angioedema and septicemia, related to the increased blood levels of this enzyme [43].

4. Experimental Section

4.1. Material

Crude venoms from N. m. mossambica and N.scutatus from Kangaroo Island were a kind gift from Venom Supplies, Australia. The venoms were filtered to remove potential mucosal contaminants, lyophilized and stored at −20 °C until required.

4.2. Fractionation of the Crude Venoms and Purification of Peptides

The crude venoms were fractionated by size-exclusion chromatography (SEC). Twenty five milligrams of N. m. mossambica and 40 mg of the N.scutatus venom were dissolved in 0.1 M ammonium acetate, pH 5.0, and applied on a Superdex G-75 column previously equilibrated with the same buffer. The chromatography was performed using the same mobile phase at a flow rate of 1 mL/min. The UV absorbance of the eluate was monitored at 220 and 280 nm. Fractions were collected and analyzed by SDS-PAGE in 15% glycine gel or 18% Tris/Tricine gel. The gels were stained with Coomassie Blue. The collected fractions were further separated and peptides purified by liquid chromatography as follows: The peptides of Peak 5 (Figure 1A) were separated on a Resource S-1 mL cation-exchange column using NaCl gradient, 0 to 50% B, at a flow rate of 1 mL/min. Buffer A was 0.05 M sodium acetate, pH 5.5, and Buffer B was 0.05 M sodium acetate containing 1.0 M NaCl, pH 5.5. The peptides of Peaks 8 and 9 (Figure 1A) were separated by RPC (Reverse Phase Chromatography) using a C18 column (150/4.6). A linear gradient of 0%–75% B was used for elution at a flow rate of 0.8 mL/min. Zero-point-zero-five percent formic acid was used as Solvent A and acetonitrile as Solvent B. Peak 4 (Figure 1B) was fractionated on a SOURCE™ 5RPC column (150/4.6) by a linear gradient of 5%–75% at a flow rate of 1 mL/min for 55 min. Solvent A was 0.1% formic acid, and Solvent B was acetonitrile. Peptides inhibiting ACE were isolated by the filtration of the fractions of Peak 4 (Figure 1B) through a 3-kDa Amicon membrane. Peptides of the filtrate were further fractionated on a Chromolith C18 column (100/4.6) with a linear gradient of 0.3% B to 60% B, at a flow rate of 1 mL/min for 40 min. Zero-point-two percent formic acid was used as Solvent A and acetonitrile as Solvent B.

4.3. Enzyme Inhibition Assays

The inhibitory activity of snake venom peptides was tested towards trypsin, thrombin, recombinant subtilisin (Stmpr1), chymotrypsin, factor Xa, plasmin, plasma kallikrein and the angiotensin I converting enzyme. All enzymes were purchased from Sigma, except Stmpr1 (which was supplied in terms of collaboration). All substrates were purchased from Bachem. The measurements were performed at room temperature applying a micro-plate reader (infinite 200 PRO®, TECAN). Twenty microliters of each fraction were incubated with the respective protease for 15 min, and the residual protease activity was determined using the corresponding substrate. Bz-Phe-Val-Arg-pNA-HCl was the substrate for trypsin and thrombin, Suc-Ala-Ala-Pro-Phe-pNA for subtilisin and chymotrypsin, Z-D-Arg-Gly-Arg-pNA-HCl for factor Xa, Bz-Arg-pNA for plasmin and Bz-Pro-Phe-Arg-pNA for kallikrein. The release of 4-nitroaniline (pNA) was monitored at 405 nm. The inhibition of the 20S proteasome was measured with Z-Gly-Gly-Leu-7-amido-4-methyl-coumarin (AMC) as a substrate. The release of the 7-amido-4-methyl-coumarin (AMC) group was followed spectrofluorometrically at λex = 360 nm and λem = 480 nm. The angiotensin I-converting enzyme activity in the presence of venom peptides was determined by a fluorescence resonance energy transfer assay using Abz-Phe-Arg-Lys(Dnp)-Pro-OH as a substrate [44]. The hydrolysis of the peptide bond between the fluorescent group (o-aminobenzoic acid, Abz) and the quencher (2,4 dinitrophenyl group, Dnp) generates a fluorescence emission, which was followed at λex = 320 nm and λem = 420 nm.

4.4. Mass Spectrometric Analyses

Snake venom peptides with molecular masses in the range 3.5–7 kDa were subjected to tryptic digestion in the presence of 6 M urea. One-point-three microliters of 100 mM dithiothreitol were added to 50 µL of the urea solution containing the respective peptide, and the mixture was incubated at 60 °C for 10 min. Then, 1.3 μL of 300 mM iodoacetamide were added, and the solution was incubated for 30 min in the dark. Four hundred twenty five microliters, 100 mM NaHCO3, pH 8.3, and 5 µL (0.25 µg/µL) of trypsin solution (sequencing grade modified trypsin; Promega, Madison, WI, USA) were added to the peptide solution, and the mixture was incubated at 37 °C for 16 h. The reaction was quenched by the addition of formic acid to a final pH of 3.0. Peptide identification was performed on a ESI-ion trap mass spectrometer (LC/MSD trap XCT Ultra, Agilent Technologies, Palo Alto, CA, USA), equipped with HPLC chip cube technology (Agilent Technologies). The HPLC-chip (large capacity chip, Agilent Technologies) integrating two on-chip columns, an enrichment column (internal volume: 160 nL) and a separation column (150 mm, both 5 µm Zorbax 300 SB-C18 material), as well as a nanospray emitter. A capillary pump attached to a microwell plate autosampler was used for the sample injection. Gradient elution was performed with a Nanoflow LC pump (1100 series Nanoflow LC System for MS, Agilent Technologies). Agilent ChemStation and MSD Trap Control software were used for system control and data acquisition. Mobile phase gradients consisted of 0.2% formic acid (Solvent A) and acetonitrile (Solvent B). For the analysis of tryptic bovine serum albumin (BSA) peptides, 1 µL of a 100 fmol/µL sample in Solvent A was injected. Samples were loaded from the autosampler onto the enrichment column of the HPLC-chips with a mobile phase of 2% Solvent B at a flow rate of 3 µL/min. The separation was performed with a gradient of 2%–40% Solvent B in 40 min at a flow rate of 400 nL/min. Data were acquired in the positive ion mode, applying a voltage of −1.8 kV at the electrospray inlet capillary, a nitrogen drying gas flow of 4 L/min and a temperature of 325 °C at the transfer capillary for desolvation. The mass spectrometer was operated in a data-dependent mode in which the three most intense ions in the precursor ion scan were subjected to subsequent automated MS/MS. Doubly charged ions were preferably selected for fragmentation. The isolation width was set to 4 m/z and the MS/MS fragmentation amplitude to 1.25 V. Active exclusion was enabled after three cycles of MS/MS; the precursor ion was released from the exclusion after 1 min. The generic files for database searching were generated by Data Analysis software for 6300 Series Ion Trap LC/MS version 3.4; for precursor ion selection, a threshold of 100,000 and a retention time window of 0.5 min were applied, and the absolute number of compounds was restricted to 1000 per MS/MS experiment. Protein identification was performed with a Mascot online search [45] MS/MS datasets were used to search the spectra against the subset “other lobe-finned fish and tetrapod clade” of the Swiss-Prot database [46]. Carbamidomethyl (C) and oxidation (M) were fixed as variable modifications, and the MS/MS tolerance was set to ± 0.6 Da. MALDI-TOF and MALDI-TOF-TOF analyses were performed on an ultrafleXtreme instrument (BrukerDaltonics, Bremen, Germany) equipped with a smartbeam-II laser with a repetition rate of 1 kHz. The spots were measured automatically by an autoXecute method within the FlexControl software (version 3.3). In MS mode, spectra were acquired in a mass range of m/z 800–3500 by summing up 1500 laser shots. Mass spectra were externally calibrated using a peptide calibration mixture II (BrukerDaltonics) within the m/z range between m/z 1046 and m/z 3147. For acquiring MS/MS spectra, up to 20 precursor masses were selected meeting the following criteria: peak intensity above 500 and a signal-to-noise ratio greater than 10. The primary mass choice range was set to m/z 1000–2500, while the secondary mass choice range was m/z 800–3500. MS/MS spectra were obtained with laser-induced dissociation (LID) summing up 2000 laser shots. The spectra were processed using FlexAnalysis software (version 3.3). Samples were spotted on a MALDI target plate (MTP Anchor Chip 384, BrukerDaltonics) using cyano-4-hydroxycinnamic acid matrix. Samples mixed with 2,5-dihydroxybenzoic acid matrix were spotted on ground steel target (BrukerDaltonics). FlexAnalysis (version 3.3, BrukerDaltonics) was used to process the MS spectra. Further data analysis was performed using BioTools (Version3.2, BrukerDaltonics) and Mascot Inhouse Search. Mascot [45] version 2.1.03 was used to analyze the spectra against the subset “other lobe-finned fish and tetrapod clade” of the Swiss-Prot database. ESI-TOF-MS analysis was performed on an LC/ESI-TOFMS instrument (Agilent 6224 ESI-TOF, Agilent Technologies). The injection volume was 5 µL for each sample. Data acquisition was carried out using the Agilent MassHunter software (version B.03.01) in positive ESI mode. The parameters were: gas temperature, 325 °C; drying gas flow, 10 L/min; nebulizer gas, 15 psig; VCap, 4000 V; fragmentor voltage, 200 V; Skimmer, 65 V; Oct 1 RF Vpp 750 V; mass range, 110–3200 m/z; permanent lock mass calibration (m/z 121.0509 and m/z 922.009); acquisition rate 1, 03 spectra/s. ESI-QTOF analysis was performed on a Q-TOF-2 electrospray mass spectrometer (Waters, Eschborn, Germany). The experiments were carried out in the positive ion mode (ES (+)). Nanoflow capillaries were drawn and coated with gold (done in-house). The capillaries were loaded with a 2-μL sample, and low pressure nitrogen gas was used to initiate the flow through the capillary. The capillary tip was set to a potential of 0.66 kV, and the cone voltage was set to 34 V. The source temperature was 20 °C. For MS/MS experiments using collision-induced dissociation (CID) experiments, ions were selected within a precursor mass window of ± 1 Da in the quadrupole analyzer and fragmented in the collision cell using a collision gas (Ar) and collision energies of 27 to 30 eV. The cycle time was about 1.1 s with a scan duration of 1 s. Raw data were acquired and analyzed using the software, MassLynx 3.5 (Micromass, Manchester, UK). MS/MS spectra were automatically processed with the micromass charge state de-encryption algorithm (MaxEnt-3). Glycan analysis was performed manually. The MALDI-TOF, MALDI-TOF-TOF MS and ESI-TOF experiments were performed under the supervision of Dr. M. Trusch at the Department of Organic Chemistry, University of Hamburg. ESI-QTOF analysis and analysis of the tryptic digest were performed under the supervision of Prof. Dr. H. Schlüter at University Medical Centre Hamburg-Eppendorf, Hamburg.

5. Conclusions

The comparative analyses of the peptide composition of two elapid venoms, one from Elapinae, the other from Acanthophiinae, indicates that both contain pharmacologically interesting peptides. Our data also indicate that there are sub-family specificities in the peptide composition of these venoms. The N.scutatus venom contains Kunitz-type inhibitors, which were not detected in the Naja mossambica mossambica sample. Three-finger toxins were found in both venoms. However, the N. scutatus venom contains only neurotoxin-type three-finger peptides and lacks cytotoxin-type three-finger peptides, which constitute the main peptide composition of N. m. mossambica venom. Interestingly, hypotensive peptides are present in both venoms, indicating that during evolution, these peptides were conserved, due to their essential functions in snake venoms. Although the two Kunitz/BPTI inhibitors isolated from N. scutatusvenom are homologues to each other, they display differences in the reactive bond loop residues, suggesting that nature has engineered these peptides to perform a variety of functions by incorporating subtle mutations at exposed binding loops. The data obtained indicate that peptides are important constituents of snake venoms and functions, by impairing or affecting vital components of the prey’s homeostasis. Among the identified molecules, several can, in principle, possess potential pharmacological applications and can serve as tools or as prototypes for drug design studies, with the advantage that unlike other active components of the venom, peptides are much easier to synthesize and less prone to inducing an immune response.
  46 in total

Review 1.  Venoms as a platform for human drugs: translating toxins into therapeutics.

Authors:  Glenn F King
Journal:  Expert Opin Biol Ther       Date:  2011-09-23       Impact factor: 4.388

Review 2.  The application of toxins and venoms to cardiovascular drug discovery.

Authors:  Wayne C Hodgson; Geoffrey K Isbister
Journal:  Curr Opin Pharmacol       Date:  2008-12-26       Impact factor: 5.547

3.  Common evolution of waprin and kunitz-like toxin families in Australian venomous snakes.

Authors:  L St Pierre; S T Earl; I Filippovich; N Sorokina; P P Masci; J De Jersey; M F Lavin
Journal:  Cell Mol Life Sci       Date:  2008-12       Impact factor: 9.261

4.  Down-regulation of the JAK2/PI3K-mediated signaling activation is involved in Taiwan cobra cardiotoxin III-induced apoptosis of human breast MDA-MB-231 cancer cells.

Authors:  Kuei-Li Lin; Jung-Chen Su; Ching-Ming Chien; Pei-Wen Chuang; Long-Sen Chang; Shinne-Ren Lin
Journal:  Toxicon       Date:  2010-02-06       Impact factor: 3.033

5.  High-resolution crystal structures of Drosophila melanogaster angiotensin-converting enzyme in complex with novel inhibitors and antihypertensive drugs.

Authors:  Mohd Akif; Dimitris Georgiadis; Aman Mahajan; Vincent Dive; Edward D Sturrock; R Elwyn Isaac; K Ravi Acharya
Journal:  J Mol Biol       Date:  2010-05-19       Impact factor: 5.469

6.  Snake venomics of African spitting cobras: toxin composition and assessment of congeneric cross-reactivity of the pan-African EchiTAb-Plus-ICP antivenom by antivenomics and neutralization approaches.

Authors:  Daniel Petras; Libia Sanz; Alvaro Segura; María Herrera; Mauren Villalta; Daniela Solano; Mariángela Vargas; Guillermo León; David A Warrell; R David G Theakston; Robert A Harrison; Nandul Durfa; Abdulsalam Nasidi; José María Gutiérrez; Juan J Calvete
Journal:  J Proteome Res       Date:  2011-01-31       Impact factor: 4.466

7.  Snake venomic of Crotalus durissus terrificus--correlation with pharmacological activities.

Authors:  Dessislava Georgieva; Michaela Ohler; Jana Seifert; Martin von Bergen; Raghuvir K Arni; Nicolay Genov; Christian Betzel
Journal:  J Proteome Res       Date:  2010-05-07       Impact factor: 4.466

8.  Dendroaspis natriuretic peptide binds to the natriuretic peptide clearance receptor.

Authors:  Douglas G Johns; Zhaohui Ao; Bradley J Heidrich; Gerald E Hunsberger; Taylor Graham; Lisa Payne; Nabil Elshourbagy; Quinn Lu; Nambi Aiyar; Stephen A Douglas
Journal:  Biochem Biophys Res Commun       Date:  2007-04-19       Impact factor: 3.575

9.  Crystal structure of textilinin-1, a Kunitz-type serine protease inhibitor from the venom of the Australian common brown snake (Pseudonaja textilis).

Authors:  Emma-Karin I Millers; Manuela Trabi; Paul P Masci; Martin F Lavin; John de Jersey; Luke W Guddat
Journal:  FEBS J       Date:  2009-04-28       Impact factor: 5.542

10.  A continuous fluorescence resonance energy transfer angiotensin I-converting enzyme assay.

Authors:  Adriana K Carmona; Sylva L Schwager; Maria A Juliano; Luiz Juliano; Edward D Sturrock
Journal:  Nat Protoc       Date:  2006       Impact factor: 13.491

View more
  7 in total

Review 1.  Advances in venomics: Modern separation techniques and mass spectrometry.

Authors:  Tarek Mohamed Abd El-Aziz; Antonio G Soares; James D Stockand
Journal:  J Chromatogr B Analyt Technol Biomed Life Sci       Date:  2020-09-17       Impact factor: 3.205

2.  Protein Identification of Venoms of the African Spitting Cobras, Naja mossambica and Naja nigricincta nigricincta.

Authors:  Ottilie Katali; Loide Shipingana; Peter Nyarangó; Mirva Pääkkönen; Erastus Haindongo; Timothy Rennie; Peter James; John Eriksson; Christian John Hunter
Journal:  Toxins (Basel)       Date:  2020-08-14       Impact factor: 4.546

Review 3.  Snake Venom Peptides: Tools of Biodiscovery.

Authors:  Aisha Munawar; Syed Abid Ali; Ahmed Akrem; Christian Betzel
Journal:  Toxins (Basel)       Date:  2018-11-14       Impact factor: 4.546

4.  Isolation and characterization of Bradykinin potentiating peptides from Agkistrodon bilineatus venom.

Authors:  Aisha Munawar; Anum Zahid; Amr Negm; Ahmed Akrem; Patrick Spencer; Christian Betzel
Journal:  Proteome Sci       Date:  2016-01-14       Impact factor: 2.480

5.  Isolation and biochemical characterization of bradykinin-potentiating peptides from Bitis gabonica rhinoceros.

Authors:  Tamara M Fucase; Juliana M Sciani; Ingrid Cavalcante; Vincent L Viala; Bruno B Chagas; Daniel C Pimenta; Patrick J Spencer
Journal:  J Venom Anim Toxins Incl Trop Dis       Date:  2017-06-26

6.  Proteomic Investigations of Two Pakistani Naja Snake Venoms Species Unravel the Venom Complexity, Posttranslational Modifications, and Presence of Extracellular Vesicles.

Authors:  Aisha Manuwar; Benjamin Dreyer; Andreas Böhmert; Anwar Ullah; Zia Mughal; Ahmed Akrem; Syed Abid Ali; Hartmut Schlüter; Christian Betzel
Journal:  Toxins (Basel)       Date:  2020-10-22       Impact factor: 4.546

7.  Identification, Characterization and Synthesis of Walterospermin, a Sperm Motility Activator from the Egyptian Black Snake Walterinnesia aegyptia Venom.

Authors:  Tarek Mohamed Abd El-Aziz; Lucie Jaquillard; Sandrine Bourgoin-Voillard; Guillaume Martinez; Mathilde Triquigneaux; Claude Zoukimian; Stéphanie Combemale; Jean-Pascal Hograindleur; Sawsan Al Khoury; Jessica Escoffier; Sylvie Michelland; Philippe Bulet; Rémy Beroud; Michel Seve; Christophe Arnoult; Michel De Waard
Journal:  Int J Mol Sci       Date:  2020-10-21       Impact factor: 5.923

  7 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.