Literature DB >> 24443971

Role of tRNA orthogonality in an expanded genetic code.

Tsotne Javahishvili1, Anthony Manibusan, Shaila Srinagesh, Darin Lee, Semsi Ensari, Mark Shimazu, Peter G Schultz.   

Abstract

Entities:  

Mesh:

Substances:

Year:  2014        PMID: 24443971      PMCID: PMC4167058          DOI: 10.1021/cb4005172

Source DB:  PubMed          Journal:  ACS Chem Biol        ISSN: 1554-8929            Impact factor:   5.100


× No keyword cloud information.
The ability to expand the universal genetic code depends on a high level of fidelity for unnatural amino acid (UAA) incorporation into proteins that rivals the natural level of translational precision. There are several levels of genomic and biochemical requirements for such an expanded code to work efficiently, based on relatively well understood mechanisms.[1] Some of these requirements are (a) low physiological levels of cross-talk among the endogenous and exogenous components of the translation machinery while supplying the cell with sufficient amounts of active synthetase and correctly processed tRNA, (b) chemically stable UAAs that are readily up-taken from the media, (c) tolerable read-thru levels of the genomic nonsense or frameshift codons, and (d) correct charging of tRNAs by their cognate aminoacyl-tRNA synthetases (aaRSs). Multiple structural elements have evolved in both the tRNAs and aaRSs that result in this high degree of accuracy in the tRNA recognition, acylation, and editing processes. We have exploited these specificity determinants to develop new tRNA/aaRS pairs that allow us to genetically encode amino acids with novel chemical and biological properties in both prokaryotic and eukaryotic organisms.[2,3] These unnatural amino acids are specified by unique stop or frameshift codons in the gene of interest.[4,5] To ensure high translational fidelity, any tRNA/aaRS pair encoding a new amino acid must be orthogonal to the host’s endogenous tRNAs and aminoacyl-tRNA synthetases, i.e., it cannot cross react to misincorporate the unnatural amino acids in place of any canonical amino acid, or the converse. The generation of such orthogonal tRNA/aaRS pairs is typically based on the distinct identity elements used by bacterial, archaeal, and eukaryotic tRNAs.[6] For example, the first base pair in the archaeal M. jannashii (Mj) tyrosine tRNA is C1:G72, which in addition to the discriminator base A73 is required for recognition of the cognate tRNA by the Mj tyrosyl-tRNA synthetase (Figure 1).[7−10] In contrast, the identity element in the acceptor stem of bacterial tRNAs is a G1:C72 base pair. Thus by transferring the archaeal tRNA-TyrRS pair to E. coli and engineering additional negative recognition elements into Mj tRNA for the bacterial aminoacyl-tRNA synthetases, one can generate a highly orthogonal pair that can be evolved to encode noncanonical amino acids with high translational fidelity. Indeed, amber codon suppressor tRNA/aaRS pairs evolved from the Mj tRNA/TyrRs pair have been used to site-specifically incorporate a large number of unnatural amino acids (UAAs) into proteins in bacteria, including photo-cross-linking, fluorescent, chemically reactive, and metal binding amino acids, with yields up to 10 g per liter.[13−17] However, recently we found that when the unnatural amino acid pAcF is site-specifically incorporated to produce a mutant recombinant fibroblast growth factor 21 (rhFGF-21) in E. coli, it is misincorporated for proline with roughly 0.5% frequency/proline. This observation has led us to develop new methods to further enhance the fidelity of unnatural amino acid incorporation and has provided new insights into those factors that influence the fidelity of the translation process.
Figure 1

Secondary structures of E. coli prolyl-tRNAs proM, K, and L, and Mj tRNA.[11,12] Anticodon loops are shown in bold. Nucleotides required for recognition by the respective canonical aaRSs, i.e., identity elements, are in red and numbered. Asterisks (*) denote the positions that were randomized to generate an amber suppressor tRNA library.[11,12] The homology between the suppressor tRNA used in our work and E. coli prolyl-tRNAs are shown in green. Critical identity elements, G72 and A73 for E. coli prolyl-tRNA synthetase and C1:G72 and A73 for Mj tyrosyl-tRNA synthetase, are shown in boxes.

Secondary structures of E. coli prolyl-tRNAs proM, K, and L, and Mj tRNA.[11,12] Anticodon loops are shown in bold. Nucleotides required for recognition by the respective canonical aaRSs, i.e., identity elements, are in red and numbered. Asterisks (*) denote the positions that were randomized to generate an amber suppressor tRNA library.[11,12] The homology between the suppressor tRNA used in our work and E. coli prolyl-tRNAs are shown in green. Critical identity elements, G72 and A73 for E. coli prolyl-tRNA synthetase and C1:G72 and A73 for Mj tyrosyl-tRNA synthetase, are shown in boxes.

p

The investigation of the misincorporation phenomenon of AcF was triggered by an observation of multiple conjugation products in a reaction between rhFGF-21-pAcF and a poly(ethylene glycol) (PEG) polymer. rhFGF-21-pAcF produced in high density bacterial fermentation (2.5 g per liter) using a pAcF specific tRNACUA/aaRS pair afforded other higher molecular weight PEGylated species in addition to the expected mono-PEGylated protein. The earliest processing stage in which the high molecular weight PEGylated species were observed was also investigated, and it was determined that unpurified protein from solubilized inclusion bodies, when subjected to PEGylation, also yielded multiple PEGylated products. Possible causes of the higher molecular weight protein species in the PEGylation reaction were systematically addressed and ruled out, including protein–protein aggregation, protein oligomerization via disulfide bond formation, and high molecular weight contaminants in the PEG raw material reagent. Subsequent reduced intact mass analysis of the mutant protein revealed a ∼17% containment of a +92 Da species (Figure 2).
Figure 2

LC–MS evaluation of solubilized rhFGF-21-pAcF inclusion bodies from plasmid constructs with, AXID1395, and without the Ambrx suppresion cassette, AXID2089. (A) Mass spectra of rhFGF-21-pAcF from AXID1395 grown in defined media exhibited multiple +92 Da species, suggesting misincorporation of pAcF for proline at proline codons. The expected intact mass is 19587.1 Da; the observed mass is 19587.6 Da. (B) Removal of the suppresion cassette enriches for truncated rhFGF-21; however, no masses were observed that correlated to misincorporation. The expected mass of truncated rhFGF-21 is 11992.5 Da; the observed mass is 11992.9 Da. Peaks labeled as “*” are Δ92 Da species. Plasmid map symbols: P, E. coli murein lipoprotein gene promoter; Mj tRNA, M jannaschii tyrosine tRNA evolved recognizing amber stop codon; Mj E9RS, tyrosyl-tRNA synthetase, specifically evolved to charge its cognate tRNA with pAcF; P, promoter of E. coli glutamyl-tRNA synthetase gene; T7term, transcription terminator sequence for bacteriophage T7 RNA Polymerase; rhFGF-21, recombinant gene encoding the mature human fibroblast growth factor 21 containing amber stop codon in the 108th positon (Q108am); PT7, promoter for bacteriophage T7 RNA Polymerase; ori, pBR322 origin of replication; knt, kanamycin nucleotidyltransferase.

LC–MS evaluation of solubilized rhFGF-21-pAcF inclusion bodies from plasmid constructs with, AXID1395, and without the Ambrx suppresion cassette, AXID2089. (A) Mass spectra of rhFGF-21-pAcF from AXID1395 grown in defined media exhibited multiple +92 Da species, suggesting misincorporation of pAcF for proline at proline codons. The expected intact mass is 19587.1 Da; the observed mass is 19587.6 Da. (B) Removal of the suppresion cassette enriches for truncated rhFGF-21; however, no masses were observed that correlated to misincorporation. The expected mass of truncated rhFGF-21 is 11992.5 Da; the observed mass is 11992.9 Da. Peaks labeled as “*” are Δ92 Da species. Plasmid map symbols: P, E. coli murein lipoprotein gene promoter; Mj tRNA, M jannaschii tyrosine tRNA evolved recognizing amber stop codon; Mj E9RS, tyrosyl-tRNA synthetase, specifically evolved to charge its cognate tRNA with pAcF; P, promoter of E. coli glutamyl-tRNA synthetase gene; T7term, transcription terminator sequence for bacteriophage T7 RNA Polymerase; rhFGF-21, recombinant gene encoding the mature human fibroblast growth factor 21 containing amber stop codon in the 108th positon (Q108am); PT7, promoter for bacteriophage T7 RNA Polymerase; ori, pBR322 origin of replication; knt, kanamycin nucleotidyltransferase. It was observed by peptide mapping of analyte enriched for the +92 Da species by RP -HPLC that the modification was present across multiple peptides and not limited to a specific site (Figure 3). Mass spectral analysis of the tryptic digest revealed that this contaminant corresponded to substitution of proline with pAcF at various sites (Table 1). Because rhFGF-21 has 22 endogenous prolines, misincorporation of pAcF for Pro at a 0.5% frequency afforded a clearly detectable impurity. To confirm this observation, wild-type (wt) rhFGF-21 was produced in the presence of the orthogonal tRNACUA/E9RS without any amber mutant in the rhFGF-21 gene, and the +92 species was still observed at roughly the same abundance. There was, however, a significant difference in relative misincorporation depending on the type of media that was used and the temperature of induction for rhFGF-21 expression, which could be due to previously reported effects of bacterial growth rates, relative amino acid and tRNA abundances and codon usage.
Figure 3

Peptide mapping analysis of rhFGF-21-pAcF enriched for the +92 Da species. Multiple new peaks with increased masses of +92 or +184 Da were observed to contain this modification when compared to the native tryptic peptides. The +184 Da modification applied to peptides that contained two sites of misincorporation. These mass shifts are consistent with the amino acid substitution of a pAcF and was observed across multiple site of rhFGF-21-pAcF.

Table 1

Theoretical Tryptic Digest of rhFGF-21-pAcFa

peak no.from–totryptic sequence
Tl1–18MHPIPDSSPLLQFGGQVR
T219–20QR
T321–37YLYTDDAQQTEAHLEIR
T438–57EDGTVGGAADQSPESLLQLK
T558–70ALKPGVIQILGVK
T671–73TSR
T774–97FLCQRPDGALYGSLHFDPEACSFR
T898–123ELLLEDGYNVYQSEAHGLPLHLPGNK
T9124–127SPHR
T10128–132DPAPR
T1l133–136GPAR
T12137–176FLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGR
T13177–182SPSYAS

Prolines are highlighted where the +92 Da species was observed by peptide mapping. The peak numbers T1–T13 correspond to the peptide mapping analysis in Figure 3.

Peptide mapping analysis of rhFGF-21-pAcF enriched for the +92 Da species. Multiple new peaks with increased masses of +92 or +184 Da were observed to contain this modification when compared to the native tryptic peptides. The +184 Da modification applied to peptides that contained two sites of misincorporation. These mass shifts are consistent with the amino acid substitution of a pAcF and was observed across multiple site of rhFGF-21-pAcF. Prolines are highlighted where the +92 Da species was observed by peptide mapping. The peak numbers T1–T13 correspond to the peptide mapping analysis in Figure 3. Misincorporation due to misrecognition at the level of codon–anticodon interactions is unlikely as there is no real bias of pAcF at different proline sites encoded by the canonical codons (Figure 4), and base pairing, including the wobble rule, does not allow the amber suppressing anticodon CUA to recognize any of the 4 proline codons (CCU, CCC, CCA, CCG). It is possible that the E. coli prolyl-tRNA synthetase aminoacylates tRNA with pAcF to a limited extent. However, these amino acids are quite distinct structurally. Moreover, attempts to increase endogenous proline levels to more effectively compete with pAcF for binding to prolyl-RS, either by adding exogenous proline to the media or by knocking out the putA gene encoding proline dehydrogenase (the first step in proline catabolism to glutamate), had little effect on the observed +92 species relative abundance. Increased osmotic stress by addition of 0.8 M NaCl resulted in an increase, rather than a decrease, in misincorporation of pAcF. These results suggested that it is unlikely that pAcF is a substrate for the endogenous prolyl-RS.
Figure 4

Intact mass analysis of rhFGF-21-pAcF with all proline codons changed to either CCT (A), CCA (B), or CCG (C). No differences in the abundance of +92 Da species were observed between the three proline codon site changes, suggesting an unbiased incorporation of pAcF. The expected mass of intact rh-FGF-21-pAcF is 19587.1 Da; the observed masses are 19587.8, 19587.6, and 19587.6 Da.

Intact mass analysis of rhFGF-21-pAcF with all proline codons changed to either CCT (A), CCA (B), or CCG (C). No differences in the abundance of +92 Da species were observed between the three proline codon site changes, suggesting an unbiased incorporation of pAcF. The expected mass of intact rh-FGF-21-pAcF is 19587.1 Da; the observed masses are 19587.8, 19587.6, and 19587.6 Da. An alternative explanation for misincorporation of pAcF at proline sites is that the M. jannaschii pAcF specific aaRS to some degree recognizes the E. coli proline tRNA family and aminoacylates these tRNAs with pAcF. Indeed, deletion of the Mj aaRS gene from a plasmid encoding wt rhFGF-21 and tRNACUA (plasmid AXID2103) eliminated misincorporation, whereas deletion of the suppressor tRNACUA (plasmid AXID2083) had no detectable effect on misincorporation (Figure 5). The bacterial tRNA family is the only set of tRNAs to have a C1:G72 base pair in their acceptor stem, which is the same identity element used by archaea (and distinct from the other E. coli tRNAs). In fact a single substitution at G72 in tRNA leads to a large decrease in aminoacylation by the endogenous prolyl-tRNA synthetase.[21−23] In addition the nucleotides between A14 and U18 are conserved between the E. coli tRNAPro family and the Mj tRNACUA as is the short variable loop.
Figure 5

Deconvoluted mass spectra of rhFGF-21-pAcF from plasmid constructs containing individual components of the suppression cassette. (A) In AXID2083 there was no evidence of misincorporation observed in the plasmid without the M. jannaschii E9RS synthetase . (B) In AXID 2103, the +92 Da species from truncated rhFGF21 was observed with the M. jannaschii E9RS synthetase and the absence of the modified M. jannaschii Tyr-tRNA in the plasmid construct, indicative of misincorporation. The expected mass of truncated rhFGF-21 is 11992.5 Da; the observed mass is 11992.9 Da for both constructs.

Deconvoluted mass spectra of rhFGF-21-pAcF from plasmid constructs containing individual components of the suppression cassette. (A) In AXID2083 there was no evidence of misincorporation observed in the plasmid without the M. jannaschii E9RS synthetase . (B) In AXID 2103, the +92 Da species from truncated rhFGF21 was observed with the M. jannaschii E9RS synthetase and the absence of the modified M. jannaschii Tyr-tRNA in the plasmid construct, indicative of misincorporation. The expected mass of truncated rhFGF-21 is 11992.5 Da; the observed mass is 11992.9 Da for both constructs. If misrecognition of tRNA by the pAcF aaRS is the cause of misincorporation, overexpression of the E. coli prolyl-tRNA synthetase gene (proS) should reduce or eliminate this phenomenon by competing with the Mj pAcF RS for the acylation of endogenous tRNA with proline rather than pAcF. To this end we subcloned the E. coli K-12 W3110 proS gene, which has a temperature-sensitive (≥34 °C) tryptophan to arginine mutation at residue 375, behind its own promoter in the plasmid AXID2191, and transformed the cell line W3110B57 with this expression plasmid.[19] At 30 °C there was no pAcF misincorporation detected due to increased expression of the mutant proS gene (Figure 6), nor was there any significant effect on mutant rhFGF21 expression levels. At 37 °C pAcF misincorporation was restored at proline residues in rhFGF-21am as the mutant ProS is not functional at this lethal temperature, i.e., only the wild-type protein is functional and translated from the transcript of the genomic copy of proS. Thus it appears that misincorporation of pAcF for proline in these experiments is due to a low level of misrecognition of tRNA by the pAcF aaRS.
Figure 6

LC–MS analyses of rhFGF-21-pAcF from the optimized expression plasmid, AXID2292 at (A) 30 °C and (B) 37 °C. The expected mass of intact rhFGF-21 is 19587.1 Da; the observed mass is 19587.4 Da for both constructs. Peaks labeled as “*” are Δ92 Da species. Map symbols: P, E. coli arabinose operon dual regulator gene; P ; arabinose operon promoter; Ec proS, E. coli wild type prolyl-tRNA synthetase gene.

LC–MS analyses of rhFGF-21-pAcF from the optimized expression plasmid, AXID2292 at (A) 30 °C and (B) 37 °C. The expected mass of intact rhFGF-21 is 19587.1 Da; the observed mass is 19587.4 Da for both constructs. Peaks labeled as “*” are Δ92 Da species. Map symbols: P, E. coli arabinose operon dual regulator gene; P ; arabinose operon promoter; Ec proS, E. coli wild type prolyl-tRNA synthetase gene. Why is misincorporation of the UAA observed only with proline? Proline is the only amino acid with a secondary amine, and as a consequence its incorporation into the growing polypeptide chain is 3–4 orders of magnitude slower than the incorporation of the other canonical amino acids.[24−26] Thus if the endogenous E. coli ProS misaminoacylates tRNA with any other canonical amino acid, that amino acid will be incorporated into peptide at the A site (assuming little EF-Tu bias) more rapidly than proline.[25] Therefore since binding to the A site by the tRNA-EF-Tu complex is reversible,[22,27] there will be an inherent bias for misincorporation by misacylated tRNA relative to other misacylated tRNAs. ProS has an active site that can broadly accept a range of small hydrophobic amino acids but contains an editing domain to ensure genetic code integrity. However, misincorporation can also occur by binding and aminoacylation of any of the tRNA by non-proline specific aaRSs. By mutation of the tRNA identity element from G1:C72 to the archaeal C1:G72 base pair, the E. coli tRNA increases its orthogonality to the other bacterial tRNA/aaRS pairs and further decreases the potential for misincorporation of another canonical amino acid at proline sites. This strategy, in addition to editing, EFTu binding, and post-aminoacylation enzymatic processing, likely represents yet another mechanism by which E. coli can ensure high fidelity in mRNA translation. However, it is also clear that this mechanism is not used universally, so other mechanisms likely exist to ensure high fidelity. Unfortunately, the C1:G72 base pair makes the bacterial tRNA similar to our archaeal Mj orthogonal tRNACUA/aaRS pair and leads to misincorporation. This misincorporation is overcome by overexpressing of the proS gene in the host strain. The cross-talk among the cellular components of the translation machinery (the last step in the Central Dogma) is widely accepted to have been evolutionary balanced so that it is not detrimental to the proteome or the cell itself. One of the results of this balancing act is the intrinsic intracellular ratio of the matured, fully processed tRNAs to their cognate synthetases (which almost certainly changes as cells go through various physiological states). In our synthetic strains with a 21 amino acide code, due to the overlapping recognition elements in both E. coli proline and M. jannaschii tyrosine tRNAs, M. jannaschii tyrosyl-tRNA synthetase aminoacylates available uncharged endogenous proline tRNAs. When the E. coli endogenous proS is overexpressed in the cell by increasing its copy number, the phenotype becomes undetectable by LC–MS/RP since the balance shifts toward the endogenous ProS and the remaining excess, if any, of the free proline tRNAs becomes insufficient for the misaminoacylation. Thus, in this case one consequence of adding additional translational components, i.e., an orthogonal tRNA/aaRS pair, is that the levels of the endogenous prolyl-tRNAs must be altered to ensure high fidelity in protein biosynthesis, underscoring the degree to which the protein translational machinery has been evolutionary optimized.

Methods

E. coli Cell Line Construction

The wild-type E. coli K-12 W3110 cell line with GenBank accession no. AP009048.1 was purchased from ATCC, Virginia (catalog no. 27325). Through homologous recombination the T7 RNA polymerase gene cassette was inserted into the W3110 genome.[18] In this newly created cell line the fhuA gene was replaced with dhfr (Trimethoprim resistance marker) to create the W3110B55 cell line. In W3110B55 the omp gene was replaced with the chloramphenicol resistance marker (cat) to create the W3110B57 cell line. In a similar manner the proS W375R::cat (point mutation for substitution of tryptophan with arginine) was generated to create a temperature-sensitive (ts) cell line W3110B60.[19] The W375R point mutation in proS conferred a lethal host phenotype at temperatures ≥34 °C.

Construction of Expression Plasmids

The expression plasmids were constructed using pET-20b (+) and pET-24 (+) plasmids (EMD4Biosciences, California). The amber codon suppression cassette consisting of the modified M. jannaschii tyrosyl tRNA synthetase was inserted at the BamHI site. The rhFGF-21am gene of interest (also known as AXP-000-028am) with the amber codon (TAG) within the ORF at glutamine position 108 was inserted downstream of the bacteriophage T7 promoter at the NdeI and KpnI restriction sites in this plasmid. The wild-type E. coli K-12 W3110 proS gene was inserted into the vector at the BglII restriction site. The temperature sensitive phenotype of the W3110B60 was complemented by the wild-type copy of the proS gene in the expression plasmid. AXID1395 corresponds to the amber expression plasmid with the Ambrx suppression elements (Mj tyrosine tRNA and Mj tyrosine tRNA synthetase, E9RS) and rhFGF-21-Q108am (AXP-000–028am). The AXID2089 plasmid has the rhFGF-21-Q108am gene but lacks the amber suppression elements. The AXID2083 plasmid contains the rhFGF-21-Q108am gene and the Mj tyrosine tRNA but lacks the Mj E9RS synthetase. The AXID2103 plasmid includes only the rhFGF-21-Q108am gene and the Mj E9RS synthetase. The AXID2292 plasmid encodes the rhFGF-21-Q108am, Mj tyrosine tRNA, Mj E9RS synthetase, and the E. coli K-12 W3110 proline synthetase (proS) under the arabinose promoter.

Production of pAcF Containing rhFGF-21

Chemically competent DH5α-T1 cells (Life Technologies, California) were transformed with the expression plasmid containing rhFGF-21am, the system components for pAcF incorporation, and the proS gene. Plasmid DNA from a single colony was extracted and used for transformation of chemically competent E. coli K-12 W3110B60 cells.[20] rhFGF-21-pAcF protein production was confirmed through SDS-PAGE and LC–MS analyses of a 500 mL shake flask experiment using defined medium (minimal medium supplemented with leucine, isoleucine, trace metals, and vitamins) with 50 μg/mL of kanamycin sulfate (Sigma, Missouri) at 37 °C. This result was further validated and confirmed through similar methods in high cell density fermentations consisting of batch and fed-batch phases.

High Cell Density Fermentations

The fermentation process for production of rhFGF-21-pAcF consists of two stages: (1) inoculum preparation and (2) fermentor production of rhFGF-21-pAcF. The inoculum is started from a single vial, thawed, diluted 1:1000 (v/v) into 50 mL of defined seed medium in a 250 mL baffled Erlenmeyer flask, and incubated at 37 °C and 250 rpm. The fermentor is batched with 4 L of chemically defined medium that utilizes glycerol as a carbon source. The seed culture is added to fermentor to an initial OD600nm of 0.05. Dissolved oxygen is maintained at 30% air saturation using agitation from 480 to 1200 rpm and oxygen enrichment with a head pressure of 6 psig and air flow of 5 slpm. The temperature and pH are controlled at 37 °C and 7.0, respectively. When the culture reaches an OD600nm of 35 ± 5, feeding commences at a rate of 0.25 mL/L/min. Consequently, l-Ala-pAcF dipeptide is added at 0.4 g/L. Fifteen minutes after the addition of dipeptide, the culture is induced with l-arabinose at a final concentration of 2 g/L. The culture is harvested at 6 h post induction.

Inclusion Body Preparation

Cell paste (150–250 μg) was resuspended with 1 mL of Bugbuster (EMD4Biosciences, California) and 2 μL of Lysonase (EMD4Biosciences, California) and incubated at 25 °C with shaking (Thermomixer) at 1400 rpm for 15 min. The sample was centrifuged at 16000g for 15 min, and the supernatant was removed by aspiration. The Bugbuster, Lysonase treatment and supernatant removal was repeated twice. The inclusion body was solubilized with 500 μL of 20 mM Tris, pH 8.0, 8 M Guanidine-HCl, and 0.1 M dithiothreitol (DTT). The sample was incubated at 45 °C with shaking at 1400 rpm for 30 min. Approximately 100 μL of the solubilized inclusion body was buffer exchanged into 1x PBS pH 7.4 using a Zeba spin column (Pierce, Illinois). The sample was diluted 1:1 with solubilization buffer and then applied to a 0.22 μm spin filter (Millipore, Massachusetts).

HPLC and Mass Spectrometry

Samples were applied onto a POROS R2 10 μm column, 2.1 mm × 30 mm (Applied Biosystems, California) using an Agilent 1200 HPLC in tandem with an Agilent 6510 Q-TOF. The column was equilibrated in 80% mobile phase A (0.05% TFA in 98% HPLC H2O/2% acetonitrile) and 20% mobile phase B (0.04% TFA in 90% acetonitrile and 10% HPLC H2O) with an increase to 65% mobile phase B over 15 min with a flow rate of 0.15 mL/min. The acquired spectra were deconvoluted using Agilent’s Bioconfirm software (Agilent Technologies, California). The TIC was also integrated with Chemstation settings for quantitation.

Peptide Mapping

The rhFGF-21-pAcF protein was reduced in 6 M guanidine-HCl, 0.1 M Tris, pH 8,0, 0.05 M DTT for 1 h at 37 °C. The reduced samples were alkylated with 0.1 M iodoacetamide at RT in the dark for 40 min followed by quenching with 0.1 M DTT. Samples were buffer exchanged into 50 mM Tris, 5 mM calcium chloride, pH 7.5 followed by trypsin addition at 1:20 (trypsin:protein) and incubated for 18 h at 37 °C. Peptide mapping samples were loaded onto an Agilent SB-C18 2.1 mm × 150 mm column with 100% mobile phase A (0.05% TFA in 98% HPLC H2O/2% acetonitrile) and eluted with a gradient of 0.5%/min with mobile phase B (0.04% TFA in acetonitrile) over 68 min. The flow rate was 0.2 mL/min, and column temperature was set to 50 °C.
  27 in total

1.  Major anticodon-binding region missing from an archaebacterial tRNA synthetase.

Authors:  B A Steer; P Schimmel
Journal:  J Biol Chem       Date:  1999-12-10       Impact factor: 5.157

Review 2.  Genomics and the evolution of aminoacyl-tRNA synthesis.

Authors:  B Ruan; I Ahel; A Ambrogelly; H D Becker; S Bunjun; L Feng; D Tumbula-Hansen; M Ibba; D Korencic; H Kobayashi; C Jacquin-Becker; N Mejlhede; B Min; G Raczniak; J Rinehart; C Stathopoulos; T Li; D Söll
Journal:  Acta Biochim Pol       Date:  2001       Impact factor: 2.149

3.  Slow peptide bond formation by proline and other N-alkylamino acids in translation.

Authors:  Michael Y Pavlov; Richard E Watts; Zhongping Tan; Virginia W Cornish; Måns Ehrenberg; Anthony C Forster
Journal:  Proc Natl Acad Sci U S A       Date:  2008-12-22       Impact factor: 11.205

Review 4.  Beyond the canonical 20 amino acids: expanding the genetic lexicon.

Authors:  Travis S Young; Peter G Schultz
Journal:  J Biol Chem       Date:  2010-02-10       Impact factor: 5.157

5.  Expanding the genetic code of Escherichia coli.

Authors:  L Wang; A Brock; B Herberich; P G Schultz
Journal:  Science       Date:  2001-04-20       Impact factor: 47.728

6.  A general approach for the generation of orthogonal tRNAs.

Authors:  L Wang; P G Schultz
Journal:  Chem Biol       Date:  2001-09

7.  Hydrolytic editing by a class II aminoacyl-tRNA synthetase.

Authors:  P J Beuning; K Musier-Forsyth
Journal:  Proc Natl Acad Sci U S A       Date:  2000-08-01       Impact factor: 11.205

8.  Functional replacement of the endogenous tyrosyl-tRNA synthetase-tRNATyr pair by the archaeal tyrosine pair in Escherichia coli for genetic code expansion.

Authors:  Fumie Iraha; Kenji Oki; Takatsugu Kobayashi; Satoshi Ohno; Takashi Yokogawa; Kazuya Nishikawa; Shigeyuki Yokoyama; Kensaku Sakamoto
Journal:  Nucleic Acids Res       Date:  2010-02-16       Impact factor: 16.971

9.  Evolution of amber suppressor tRNAs for efficient bacterial production of proteins containing nonnatural amino acids.

Authors:  Jiantao Guo; Charles E Melançon; Hyun Soo Lee; Dan Groff; Peter G Schultz
Journal:  Angew Chem Int Ed Engl       Date:  2009       Impact factor: 15.336

10.  Exclusive use of trans-editing domains prevents proline mistranslation.

Authors:  Oscar Vargas-Rodriguez; Karin Musier-Forsyth
Journal:  J Biol Chem       Date:  2013-04-05       Impact factor: 5.157

View more
  4 in total

1.  Improved Incorporation of Noncanonical Amino Acids by an Engineered tRNA(Tyr) Suppressor.

Authors:  Benjamin J Rauch; Joseph J Porter; Ryan A Mehl; John J Perona
Journal:  Biochemistry       Date:  2016-01-08       Impact factor: 3.162

2.  Resurrecting the Bacterial Tyrosyl-tRNA Synthetase/tRNA Pair for Expanding the Genetic Code of Both E. coli and Eukaryotes.

Authors:  James S Italia; Christopher Latour; Chester J J Wrobel; Abhishek Chatterjee
Journal:  Cell Chem Biol       Date:  2018-08-02       Impact factor: 8.116

3.  A PSMA-targeted bispecific antibody for prostate cancer driven by a small-molecule targeting ligand.

Authors:  Sung Chang Lee; Jennifer S Y Ma; Min Soo Kim; Eduardo Laborda; Sei-Hyun Choi; Eric N Hampton; Hwayoung Yun; Vanessa Nunez; Michelle T Muldong; Christina N Wu; Wenxue Ma; Anna A Kulidjian; Christopher J Kane; Vadim Klyushnichenko; Ashley K Woods; Sean B Joseph; Mike Petrassi; John Wisler; Jing Li; Christina A M Jamieson; Peter G Schultz; Chan Hyuk Kim; Travis S Young
Journal:  Sci Adv       Date:  2021-08-11       Impact factor: 14.136

4.  An orthogonal seryl-tRNA synthetase/tRNA pair for noncanonical amino acid mutagenesis in Escherichia coli.

Authors:  Claudio Zambaldo; Minseob Koh; Fariborz Nasertorabi; Gye Won Han; Abhishek Chatterjee; Raymond C Stevens; Peter G Schultz
Journal:  Bioorg Med Chem       Date:  2020-07-28       Impact factor: 3.461

  4 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.