Literature DB >> 23382933

A novel inhibitor of α9α10 nicotinic acetylcholine receptors from Conus vexillum delineates a new conotoxin superfamily.

Sulan Luo1, Sean Christensen, Dongting Zhangsun, Yong Wu, Yuanyan Hu, Xiaopeng Zhu, Sandeep Chhabra, Raymond S Norton, J Michael McIntosh.   

Abstract

Conotoxins (CTxs) selectively target a range of ion channels and receptors, making them widely used tools for probing nervous system function. Conotoxins have been previously grouped into superfamilies according to signal sequence and into families based on their cysteine framework and biological target. Here we describe the cloning and characterization of a new conotoxin, from Conus vexillum, named αB-conotoxin VxXXIVA. The peptide does not belong to any previously described conotoxin superfamily and its arrangement of Cys residues is unique among conopeptides. Moreover, in contrast to previously characterized conopeptide toxins, which are expressed initially as prepropeptide precursors with a signal sequence, a ''pro'' region, and the toxin-encoding region, the precursor sequence of αB-VxXXIVA lacks a ''pro'' region. The predicted 40-residue mature peptide, which contains four Cys, was synthesized in each of the three possible disulfide arrangements. Investigation of the mechanism of action of αB-VxXXIVA revealed that the peptide is a nicotinic acetylcholine receptor (nAChR) antagonist with greatest potency against the α9α10 subtype. (1)H nuclear magnetic resonance (NMR) spectra indicated that all three αB-VxXXIVA isomers were poorly structured in aqueous solution. This was consistent with circular dichroism (CD) results which showed that the peptides were unstructured in buffer, but adopted partially helical conformations in aqueous trifluoroethanol (TFE) solution. The α9α10 nAChR is an important target for the development of analgesics and cancer chemotherapeutics, and αB-VxXXIVA represents a novel ligand with which to probe the structure and function of this protein.

Entities:  

Mesh:

Substances:

Year:  2013        PMID: 23382933      PMCID: PMC3559828          DOI: 10.1371/journal.pone.0054648

Source DB:  PubMed          Journal:  PLoS One        ISSN: 1932-6203            Impact factor:   3.240


Introduction

Nicotinic acetylcholine receptors (nAChRs) are pentameric ligand-gated ion channels used throughout the animal kingdom for neurotransmission. These receptors are assembled from α,β,γ,δ and/or ε subunits to form multiple receptor subtypes with distinct pharmacological properties [1]. Elucidation of the precise structure and function of various nAChRs is challenging owing to the scarcity of ligands selective for specific receptor subtypes. In an effort to address this, we have systematically examined components of the venoms of carnivorous cone snails for selective nAChR-targeted ligands. Molluscs of the genus Conus are comprised of >700 species. These marine snails hunt primarily polychaete worms, molluscs or fish. Each cone species produces a cocktail of >100 different compounds that enables prey capture. Despite extensive work, the vast majority of these compounds remains uncharacterized. Conopeptides are produced in the venom duct of Conus and used offensively to immobilize prey. Their potency and selectivity for various ion channels and receptors have made them excellent pharmacological probes and drug leads [2]–[3]. The term conotoxin is used to describe the subset of Conus peptides that are rich in Cys residues. Conotoxins are synthesized initially as precursor proteins that are subsequently processed into the mature toxin. Previously characterized Conus peptides have been grouped into gene superfamilies based on similarities in their precursor signal sequences [4]. Within each superfamily, the toxins are grouped according to cysteine frameworks that influence their final three-dimensional structure. The toxins are also grouped according to receptor or ion channel target into pharmacological families. Within a given family of conotoxins there is, characteristically, hypervariation in non-Cys residues, which is believed to enable selective action on a given target subtype. Post-translational modification or chemical synthetic modification provides further diversity [5]–[6]. Toxins characterized to date can be classified into one of 17 superfamilies (see Table 1) [7]–[8]. The current study characterizes a new conotoxin, from the worm-hunting Conus vexillum, with a unique Cys framework. As the precursor sequence does not align with any of the previously-reported gene superfamilies, this peptide represents a first-in-class compound (see (Table S1)). Total chemical synthesis was carried out to enable pharmacological and structural characterization of this novel toxin. The peptide acts as an antagonist of nicotinic acetylcholine receptors, with greatest potency at the α9α10 nAChR, a subtype expressed in a variety of tissues ranging from immune cells to sperm [9]–[10].
Table 1

Protein precursor sequences of Conus gene superfamilies [46]–[61].

Super-familyPeptidePrecursor Sequence (Signal, N-terminal pro-regions, ↓Mature peptide and ↓C-terminal pro-regions)Reference
BαB-VxXXIVAMETLTLLWRASSSCLLVVLSHSLLRLLG↓VRCLEKSGAQPNKLFRPPCCQKGPSFARHSRCVYYTQSRE This Study
Aα-LtIAMGMRMMFIMFMLVVLATTVVTFTSDRALDAMNAAASNKA SRLIALAVR↓GCCARAACAGIHQELC↓GGGR46,47,48
DαD-VxXXBMPKLAVVLLVLLILPLSYFDAAGGQAVQGDWRGNRLARD LQRGGR↓DDESECIINTRDSPWGRCCRTRMCGSMCCPRNGCTCVYHWRRGHGCSCPG 49,50
I1 ArXIAMKLCATFLLVLVTLPLVTGEKSSERSLSGAILRGVR↓RTCS RRGHRCIRDSQCCGGMCCQGNRCFVAIRRCFHLPF 51
I2 BeTXMMFRVTSVGCLLLVIVFLNLVVPTSA↓C RAEGTYCENDS QCCLNECCWGGCGHPCRHP↓GKRSKLQEFFRQR 52
I3 Ca11.3MKLVLAIVVILMLLSLSTGAEMSDNHASRSATALRDRLLSP K↓ASICYGTGGRCTKDKHCCGWLCCGGPSVGCVVSVAPCK 53
JFe14.1MPSVRSVTCCCLLWMMLSVQLVTPGSPGTAQLSGHRTAR↓SPGSTICKMACRTGNGHKYPFCNCR↓GKRDVVSSSMAV31
Kim23aMIMRMTLTLFVLVVMTAASASGDALTEAKR IPYCGQTGA ECYSWCIKQDLSKDWCCDFVKDIRMNPPADKCP 8
LC14.1aMNVTVMFLVLLLLTMPLTDGFNIRATNGGELFGPVQRDAG NVLDHGFQRRR↓DCPPWCPTSHCNAGTC 54
Mψ-PrIIIEMSKLGVLLTICLLLFPITALPVDGDQPADRPVERMQDNISS EQHPFFEKR↓AARCCTYHGSCLKEKCRRKYCC↓GR55
O1 SO3MKLTCMVIVAVLLLTACQLITADDSRGTQKHRTLRSKTKL SMSTR↓C KAAGKPCSRIAYNCCTGSCRSGKC↓G56
O2 BeB54MEKLTILLLVAAVLMSTQALIQSDGEKRQQAKINFLS.R↓K STAESWWEGECKGWSVYCSWDWECCSGECTRYYCELW 17
O3 CaFr179MSGLGIMVLTLLLLVFMEASHQDAGEKQATQRDAINVRR RRSLARR↓TVTEECEEDCEDEEKHCCNTNNGPSCARLCF↓G17
PGmIXAMHLSLARSAVLMLLLLFALGNFVVVQSGLITRDVDNGQL TDNRRNLQTEWNPLSLFMSRR↓SCNNSCQSHSDCASHCICTFRG CGAVN↓G57
SαS-GVIIIAMMSKMGAMFVLLLLFTLASSLQEGDVQARKTRLKSDFYR ALARDDR↓GCTRTCGGPKCTGTCTCTNSSKCGCRYNVHPSGWGCGCACS↓G58
TVcVBVILLLLIASAPSVDAQPKTKDDVPLAPLHDNAKSALQHLNQ R↓CC QTFYWCCGQ↓GK59
VViXVAMMPVILLLLLSLAIRCADGKAVQGDSDPSASLLTGDKNHD LPVKR↓DCTTCAGEECCGRCTCPWGDNCSCIEW↓GK60
YCaXVIIAMQKATVLLLALLLLLPLSTAQDAEGSQEDAAQREVDIATR↓C GGTGDSCNEPAGELCCRRLKCVNSRCCPTTDGC 61

Materials and Methods

Ethics Statement

No specific permits were required for the described field studies. No specific permissions were required for Tanmen Qionghai, Hainan Province, China, which is not privately-owned or protected in any way. The field studies did not involve endangered or protected species.

Materials

Specimens of Conus vexillum were collected from the South China Sea off Tanmen Qionghai, Hainan Province, China. Venom ducts were frozen and stored at −80°C. Creator SMART cDNA Library Construction Kit was from CLONTECH Laboratories, Inc. Acetylcholine chloride, atropine, and bovine serum albumin (BSA) were from Sigma. The reverse-phase HPLC analytical Vydac C18 column (5 µm, 4.6 mm×250 mm) and preparative C18 Vydac column (10 µm, 22 mm×250 mm) were from Shenyue. Reagents for peptide synthesis were from GL Biochem. Acetonitrile was from Fisher. Trifluoroacetic acid (TFA) was from Tedia. All other chemicals used were of analytical grade. Clones of rat α2–α7 and β2–β4, as well as mouse muscle α1β1δε cDNAs were kindly provided by S. Heinemann (Salk Institute, San Diego, CA). Clones for α9 and α10 were generously provided by A.B. Elgoyen (Instituto de Investigaciones en Ingeniería Genética y Biología Molecular, Buenos Aires, Argentina). Clones of β2 and β3 subunits in the high expressing pGEMHE vector were kindly provided by C.W. Luetje (University of Miami, Miami, FL).

cDNA Sequencing

Total RNA was extracted from individual ducts and purified as described previously [11]. Venom duct cDNA library construction followed the kit manufacturer’s suggested protocol. Briefly, the first-strand cDNA was synthesized with the SMART IV Oligonucleotide and transcriptase. Full-length, double-stranded (ds) cDNA (SMART cDNA) was generated by long-distance PCR. SMART cDNA was ligated into the Sfi I predigested pDNR-LIB vector. The signal and mature peptide sequences of the conotoxin precursors were predicted using online ProP 1.0 Server [12].

Peptide Synthesis

The linear peptide was assembled by solid-phase methodology on an ABI 433A peptide synthesizer using FastMoc (N-(9-fluorenyl) methoxycarbonyl) chemistry and standard side-chain protection, except for cysteine residues. Cys residues of the three possible isomers were protected in pairs with either S-trityl on Cys3 and Cys19 (designated αB-VxXXIVA [1], [2]), Cys3 and Cys20 (designated αB-VxXXIVA [1], [3]), Cys19 and Cys20 (designated αB-VxXXIVA [1], [4]) or S-acetamidomethyl on Cys20 and Cys32, Cys19 and Cys32, Cys3 and Cys32, respectively. The peptides were removed from a solid support by treatment with reagent K (TFA / water / ethanedithiol / phenol / thioanisole; 90∶ 5 : 2.5∶ 7.5∶ 5,v / v / v / v / v). The released peptide was precipitated and washed three times with cold ether. A two-step oxidation protocol was used to fold the peptides selectively, as described previously [13]. Briefly, the disulfide bridge between Cys3 and Cys19, Cys3 and Cys20, or Cys19 and Cys20, respectively, was closed by dripping the peptide into an equal volume of 20 mM potassium ferricyanide, 0.1 M Tris, pH 7.5. The solution was allowed to react for 45 min, and the monocyclic peptide was purified by reverse-phase HPLC. Simultaneous removal of the S-acetamidomethyl groups and closure of the disulfide bridge between Cys20 and Cys32, Cys19 and Cys32, or Cys3 and Cys32, respectively, was carried out by iodine oxidation as follows: the monocyclic peptide in HPLC eluent was dripped into an equal volume of iodine (10 mM) in H2O:TFA:acetonitrile (74∶2:24 by volume) and allowed to react for 10 min. The reaction was terminated by the addition of ascorbic acid, diluted 10-fold with 0.1% TFA, and the bicyclic peptide was purified by HPLC on a reversed-phase C18 Vydac column using a linear gradient of 20–60% B60 in 40 min. Solvent B was 60% ACN, 0.092% TFA, and H2O; Solvent A 0.1% TFA in H2O. Peptide concentration was measured using absorbance at 280 nm, and calculated using the Beer-Lambert equation and a calculated molar extinction coefficient of 3040 cm−1 M−1.

cRNA Preparation and Injection

Capped cRNA for the various subunits were made using the mMessage mMachine in vitro transcription kit (Ambion) following linearization of the plasmid. The cRNA was purified using the Qiagen RNeasy kit. The concentration of cRNA was determined by absorbance at 260 nm. Oocytes were injected within one day of harvesting and recordings were made 1–4 days post-injection.

Voltage-clamp Recording

Oocytes were voltage-clamped and exposed to ACh and peptide as described previously [14]. Briefly, the oocyte chamber consisting of a cylindrical well (∼30 µl in volume) was gravity perfused at a rate of ∼2 ml/min with ND96 buffer (96.0 mM NaCl, 2.0 mM KCl, 1.8 mM CaCl2, 1.0 mM MgCl2, 5 mM HEPES, pH 7.1–7.5) containing 0.1 mg/ml BSA. The Ba++-ND96 had 1.8 mM BaCl2 in place of CaCl2. The membrane potential of the oocytes was clamped at −70 mV. The oocyte was subjected once a minute to a 1 s pulse of 100 µM ACh. In the case of the α9α10 and muscle α1β1δε subtypes, there is a 1 s pulse of 10 µM Ach, and for the α7 subtype a 200 µM ACh pulse. For toxin concentrations ≥10 µM, once a stable baseline was achieved, either ND-96 alone or ND-96 containing conotoxin was applied manually for 5 min prior to the addition of the agonist. All recordings were done at room temperature (∼22°C).

Data Analysis

The average of five control responses just preceding a test response was used to normalize the test response to obtain “% response.” Each data point of a dose-response curve represents the average ± S.E. of at least three oocytes. The dose-response data were fit to the equation, % response = 100/[1+ ([toxin]/IC50)?nH], where nH is the Hill coefficient, by non-linear regression analysis using GraphPad Prism (GraphPad Software).

NMR Spectroscopy

1H NMR spectra were recorded on αB-VxXXIVA isomers at a concentration of ∼ 350 µM in 20 mM phosphate/10% 2H2O buffer at pH ∼ 5.8. The 1D spectra were acquired on a Bruker Avance 600 MHz NMR spectrometer equipped with cryogenic probe fitted with a z axis gradient. The NMR spectra were collected at 5°C using the excitation sculpting pulse sequence [15]. Spectra were acquired over 4K data points with 64 scans and a 1H spectral width of 14 ppm. All spectra were processed in TOPSPIN (version 3.0) and referenced to the water resonance.

Circular Dichroism Analysis

αB-VxXXIVA isomers were dissolved in 20 mM phosphate buffer (pH 5.9) and CD spectra were recorded on a Jasco-815 spectropolarimeter at a concentration of 43 µM at 20°C. Spectra were collected at 0.05 nm intervals over the wavelength range 260–195 nm in a 10 mm pathlength cuvette. Three scans were collected and averaged for each peptide sample with scanning rate of 100 nm/min−1. The spectra were then smoothed using a third-order polynomial function. In order to investigate the effect of trifluoroethanol (TFE) on the conformation, CD spectra for αB-VxXXIVA [1], [2] were also acquired following the addition of 10, 20, 50 and 87% TFE. The % α-helix and β-sheet content were calculated from the CD data using the CDPro program [16].

Results

Discovery and Sequence Analysis of a cDNA of the Precursor of αB-VxXXIVA

In general, conotoxins are translated initially as prepropeptide precursors [7], with proteolytic cleavage yielding the final product(s). Peptides in the same superfamily are characterized by highly conserved prepropeptide precursor sequences. This conservation has allowed direct identification of new peptides belonging to a particular superfamily by cDNA sequencing of family or superfamily genes [17]. However, a large fraction of conotoxins present in the Conus genus has yet to be sequenced and several additional families of toxins remain to be identified. Most of the cone snails investigated to date are fish- or mollusc-hunters. In an effort to discover novel conotoxin families, we examined the worm-hunting C. vexillum. Specimens were collected from the South China Sea and dissected venom ducts were used to construct a cDNA library. Approximately 50 clones from the cDNA library were chosen randomly for sequencing and inspected for previously unreported sequences. In the present study with C. vexillum, several members of the previously characterized α- and ω- superfamilies were identified. In addition, however, an unusual precursor sequence was noted (Fig. 1, Table 1, GenBank accession number JX297421). A sequence similarity search detected no homology with precursors of the known superfamilies of conotoxins [7] (Table S1). The sequence was analyzed with DNAstar software and online ProP 1.0 Server [12], which indicated a 28-residue signal sequence followed by a previously unreported 40-residue mature toxin (Table 2 and see also Table S2 for sequence alignment). For other conotoxins, the encoding cDNA has a characteristic three-region organization, including a signal sequence, a ‘‘pro’’ region, and the toxin-encoding region [7], [18] The generation of the mature toxin requires proteolytic cleavage of the N-terminal prepro-region of the precursor. In contrast to previously characterized conopeptide toxins, the precursor of αB-VxXXIVA has no ‘‘pro’’ region. The putative proteolytic processing site between prepropeptide and mature region for conotoxins is usually a basic amino acid (K or R). In contrast, the predicted cleavage site for the αB-VxXXIVA precursor is –LG- (Fig. 1). The predicted mature peptide exhibited a new cysteine framework, not previously reported for conotoxins, C–CC–C (Table 2 and Table S2). The predicted mature toxin sequence was VRCLEKSGAQPNKLFRPPCCQKGPSFARHSRCVYYTQSRE.
Figure 1

αB-Conotoxin VxXXIVA prepeptide and encoded toxin are shown.

A putative proteolytic processing site (G) is indicated by the arrow. The mature toxin region is underlined. The stop codon is indicated as *. Unlike previously reported conotoxins, there is no pro region.

Table 2

Mature toxin sequences of nAChR-targeted conotoxin superfamilies [62]–[68].

PeptideSuperfamilyMassCysteine ResiduesSequenceReference
αB-VxXXIVAB46234VRCLEKSGAQPNKLFRPPCCQKGPSFARHSRCVYYTQSRÊ 40aaThis Study
α-AuIBA15734GCCSYPPCFATNPDC# 15aa62
αA-OIVBA18656 CCGVONAACPOCVCNKTCG# 19aa63
αC-PrXAT34922TYGIYDAKPOFSCAGLRGGCVLPONLROKFKE# 32aa64
αD-VxXIIAD513410DVQDCQVSTOGSKWGRCCLNRVCGPMCCPASHCYCVYHRGRGHGCSC? 47aa65,66
αS-RVIIIAS516810KCNFDKCKGTGVYNCGXSCSCXGLHSCRCTYNIGSMKSGCACICTYŶ 47aa67
ψ-PIIIEM27166HOOCCLYGKCRRYOGCSSASCCQR# 24aa68

O = hydroxyproline, X = gamma-carboxyglutamate, # = C-terminus amidation,

 = C-terminus COOH.

αB-Conotoxin VxXXIVA prepeptide and encoded toxin are shown.

A putative proteolytic processing site (G) is indicated by the arrow. The mature toxin region is underlined. The stop codon is indicated as *. Unlike previously reported conotoxins, there is no pro region. O = hydroxyproline, X = gamma-carboxyglutamate, # = C-terminus amidation, = C-terminus COOH.

Chemical Synthesis and Oxidative Folding of VxXXXIVA

With four Cys residues there are three possible disulfide bond arrangements:Cys3-Cys19, Cys20-Cys32 (αB-VxXXIVA [1], [2]); Cys3-Cys20, Cys19-Cys32 (αB-VxXXIVA [1], [3]), and Cys3-Cys32, Cys19-Cys20 αB-VxXXIVA [1], [4] (Fig. 2). Fmoc chemistry was used to synthesize the linear αB-VxXXIVA peptides. The cysteine side chains were protected in pairs with orthogonal protecting groups that could be removed selectively under different conditions, allowing the formation of one disulfide bridge at a time. The first and second, first and third, or second and third cysteine residues were protected with acid-labile groups, which were simultaneously removed during cleavage from the resin. Ferricyanide was used to close the first disulfide bridge. Reverse-phase HPLC was used to purify the monocyclic peptide; subsequently, the acid-stable acetometomethyl groups were removed from the remaining two cysteines by iodine oxidation, which also closed the second disulfide bridge. The three fully folded peptide isomers were individually purified by HPLC. Electrospray mass spectrometry was utilized to confirm the identity of the products. The monoisotopic masses in Da were: calculated, 4622.27; observed 4622.3 (αB-VxXXIVA [1], [2]), 4622.2 (αB-VxXXIVA [1], [3]), and 4622.4 (αB-VxXXIVA [1], [4]). Synthetic peptides with these disulfide bond arrangements were used in all subsequent studies.
Figure 2

Amino acid sequence of αB-Conotoxin VxXXIVA.

Three possible isomers with different disulfide connectivities: αB-VxXXIVA [1], [2] with a disulfide connectivity I–II, III–IV; αB-VxXXIVA [1], [3] with I–III, II–IV and αB-VxXXIVA [1], [4] with I–IV, II–III.

Amino acid sequence of αB-Conotoxin VxXXIVA.

Three possible isomers with different disulfide connectivities: αB-VxXXIVA [1], [2] with a disulfide connectivity I–II, III–IV; αB-VxXXIVA [1], [3] with I–III, II–IV and αB-VxXXIVA [1], [4] with I–IV, II–III.

Effect of Conotoxin αB-VxXXIVA on nAChR ACh-evoked Currents

ACh is used in neurotransmission in the prey of Conus and nAChR antagonists are prevalent components of cone snail venoms. We therefore tested the αB-VxXXIVA isomers on subtypes of nAChRs. Pairwise combinations of nAChR subunits were heterologously expressed in Xenopus oocytes (Table 3). The toxins were individually tested on these subtypes for their ability to antagonize the response elicited by ACh. Screening was performed initially at 10 µM concentration. Fig. 3A shows representative responses to ACh of α9α10 nAChRs in the presence and absence of αB-VxXXIVA [1], [2]. The block of α9α10 nAChR by αB-VxXXIVA [1], [2] was rapidly reversible. The most potent activity was observed at the α9α10 nAChR subtype (Fig. 3B). Concentration response experiments were then conducted. The IC50 of αB-VxXXIVA [1], [2] at the α9α10 nAChR subtype was 1.2 (0.8–1.7) µM. The concentration response for αB-VxXXIVA [1], [2] was subsequently assessed on each of the other expressed nAChR subtypes, Fig. 4 and Table 3. Fig. 4 shows representative responses to ACh of α9α10, α7, α3β4 and α4β2 nAChRs in the presence and absence of αB-VxXXIVA [1], [2]. αB-VxXXIVA [1], [3] was less potent than αB-VxXXIVA [1], [2] on α9α10 nAChRs with an IC50 of 3.9 (2.7–5.6) µM. Like αB-VxXXIVA [1], [2], αB-VxXXIVA [1], [3] had little or no activity on other tested nAChR subtypes (IC50>30 µM for α2β2, α2β4,α3β2,α3β4,α4β2, α4β4,α6/α3β2β3,α6/α3β4 and α7 nAChRs). αB-VxXXIVA [1], [4] blocked less than 15% of the α9α10 current at the highest concentration tested (30 µM). Likewise, it was inactive at other major nAChR subtypes including α3β4,α4β2 and α7 nAChRs (IC50>30 µM).
Table 3

IC50 and Hill slope values for block of rat nAChR subtypes by αB-Conotoxin VxXXIVA [1], [2].

nAChR subtypeIC50 IC50 C.I.Hill SlopeHill Slope C.I.
Rat α2β223.4 µM17.3–31.5 µM1.10.7–1.5
Rat α2β4>30 µM–––
Rat α3β2>30 µM–––
Rat α3β4>30 µM–––
Rat α4β2>30 µM–––
Rat α4β4>30 µM–––
Rat α6/α3β2β312.2 µM10.0–14.9 µM1.20.9–1.7
Rat α6/α3β430.1 µM18.8–48.0 µM1.00.5–1.5
Rat α7>30 µM–––
Rat α9α101.2 µM0.8–1.7 µM1.40.5–2.1
Mouse α1β1γδ6.6 µM5.1–8.5 µM1.20.8–1.6

C.I., 95% confidence interval.

Figure 3

αB-Conotoxin VxXXIVA blocks α9α10 nAChRs.

(A) Xenopus oocytes expressing α9α10 nAChR were voltage clamped at –70 mV and subjected to a 1 s pulse of ACh every min as described in Materials and Methods. A representative response in a single oocyte is shown. After control responses to ACh, the oocyte was exposed to 10 µM toxin for 5 min (arrow). After the 5 min toxin application, a response to ACh was measured (a). After 1 min of toxin washout, another response to ACh was measured (b). Note that the response to ACh recovered to control level after 1 min of toxin washout. (B) Concentration response of α9α10 nAChRs exposed to the three different isomers of αB-VxXXIVA (see Fig 2). Values shown in the graph are mean ± SEM from 3–5 separate oocytes. The IC50s were: αB-VxXXIVA [1], [2], 1.2 µM (0.8–1.7 µM); αB-VxXXIVA [1], [3], 3.9 µM (2.7–5.6 µM); and αB-VxXXIVA [1], [4] >30 µM. Hill slopes were αB-VxXXIVA [1], [2], 1.4 (0.5–2.1) and αB-VxXXIVA [1], [3], 1.3(0.9–1.7).

Figure 4

αB-Conotoxin VxXXIVA differentially blocks α9α10, α7, α3β4 and α4β2 nAChRs.

nAChR subtypes were expressed as described in Materials and Methods. “C” indicates control responses to ACh. Oocytes were then exposed to 10 µM peptide for 5 min, followed by application of ACh. The peptide blocked α9α10 but not α7, α3β4 or α4β2 nAChRs.

αB-Conotoxin VxXXIVA blocks α9α10 nAChRs.

(A) Xenopus oocytes expressing α9α10 nAChR were voltage clamped at –70 mV and subjected to a 1 s pulse of ACh every min as described in Materials and Methods. A representative response in a single oocyte is shown. After control responses to ACh, the oocyte was exposed to 10 µM toxin for 5 min (arrow). After the 5 min toxin application, a response to ACh was measured (a). After 1 min of toxin washout, another response to ACh was measured (b). Note that the response to ACh recovered to control level after 1 min of toxin washout. (B) Concentration response of α9α10 nAChRs exposed to the three different isomers of αB-VxXXIVA (see Fig 2). Values shown in the graph are mean ± SEM from 3–5 separate oocytes. The IC50s were: αB-VxXXIVA [1], [2], 1.2 µM (0.8–1.7 µM); αB-VxXXIVA [1], [3], 3.9 µM (2.7–5.6 µM); and αB-VxXXIVA [1], [4] >30 µM. Hill slopes were αB-VxXXIVA [1], [2], 1.4 (0.5–2.1) and αB-VxXXIVA [1], [3], 1.3(0.9–1.7).

αB-Conotoxin VxXXIVA differentially blocks α9α10, α7, α3β4 and α4β2 nAChRs.

nAChR subtypes were expressed as described in Materials and Methods. “C” indicates control responses to ACh. Oocytes were then exposed to 10 µM peptide for 5 min, followed by application of ACh. The peptide blocked α9α10 but not α7, α3β4 or α4β2 nAChRs. C.I., 95% confidence interval. α9α10 nAChRs are known to be highly permeable to calcium. Entry of Ca++ through the nAChR elicits a response by Ca++-activated chloride currents. The magnitude of this response in Xenopus oocytes is large and can comprise >90% of the observed current. In contrast, the closely-related divalent cation Ba++ does not elicit a response. We therefore assessed whetherαB-VxXXIVA blocked the response to ACh when Ba++ was substituted for Ca++ in the buffer. Consistent with previous observations, the ACh response of α9α10 nAChRS in Ba++ ND96 was substantially smaller than that observed in Ca++ ND96 (data not shown). Using Ba++ ND96, the α9α10 nAChR was most potently blocked by αB-VxXXIVA [1], [2] with an IC50 of 1.49 µM; under these conditions, αB-VxXXIVA [1], [3] had an IC50 of 3.15 µM and αB-VxXXIVA [1], [4] did not potently block the α9α10 nAChR subtype (Fig. 5). Thus, the potency of the αB-VxXXIVA isomers in the presence of Ba++ was similar to that seen in Ca++, consistent with the toxin effect being due to blockade of the nAChR rather than blockade of the Ca++-activated Cl− channel.
Figure 5

Concentration-response of αB-Conotoxin VxXXIVA on α9α10 nAChR in the presence of Ba++.

Equimolar Ba++ was substituted for Ca++, in the perfusion solution as described in Materials and Methods, to prevent activation of endogenous Xenopus Ca++ activated Cl− currents. Values are mean ± SEM from 3–5 separate oocytes. The IC50 for the αB-VxXXIVA isomer with disulfide connectivity of I-II; III-IV was 1.49 µM (1.18–1.88) with Hill slope of 0.81 (0.66–0.96). The IC50 for the αB-VxXXIVA isomer with disulfide connectivity of I-III; II-IV was 3.15 µM (2.08–4.78) with Hill slope of 0.64 (0.46–0.81). Hill slopes (nH) were: Data points shown are the mean ± SEM.

Concentration-response of αB-Conotoxin VxXXIVA on α9α10 nAChR in the presence of Ba++.

Equimolar Ba++ was substituted for Ca++, in the perfusion solution as described in Materials and Methods, to prevent activation of endogenous Xenopus Ca++ activated Cl− currents. Values are mean ± SEM from 3–5 separate oocytes. The IC50 for the αB-VxXXIVA isomer with disulfide connectivity of I-II; III-IV was 1.49 µM (1.18–1.88) with Hill slope of 0.81 (0.66–0.96). The IC50 for the αB-VxXXIVA isomer with disulfide connectivity of I-III; II-IV was 3.15 µM (2.08–4.78) with Hill slope of 0.64 (0.46–0.81). Hill slopes (nH) were: Data points shown are the mean ± SEM.

NMR Studies

The 1D 1H NMR spectra of αB-VxXXIVA isomers in phosphate buffer at pH 5.8 show that the majority of the amide protons fall within the 8.0–9.0 ppm range (Fig. 6); the lack of chemical shift dispersion here and elsewhere in the spectrum indicates that these isomers lack any significant tertiary structure. The same was true at pH 7.0 (Fig. S1, S2, S3). NMR spectra were also acquired in the presence of 3–10 mM CaCl2 to ascertain whether calcium had any effect on their conformation, but no change in chemical shift dispersion was observed (Fig. S4).
Figure 6

1H NMR spectra of αB-Conotoxin VxXXIVA isomers.

Peptides were dissolved in 20 mM phosphate buffer at pH 5.8 and spectra were acquired at 600 MHz.

1H NMR spectra of αB-Conotoxin VxXXIVA isomers.

Peptides were dissolved in 20 mM phosphate buffer at pH 5.8 and spectra were acquired at 600 MHz. CD spectra were acquired on all threeαB-VxXXIVA isomers in phosphate buffer. All peptide isomers exhibited minima at around 200 nm (Fig. 7A), indicative of a random coil conformation with no α-helical and β-sheet content, and consistent with our NMR results. As TFE is known to stabilize the α-helical structure in proteins and peptides [19], CD spectra of one of the isomers (αB-VxXXIVA [1], [2]) were recorded in increasing concentrations of TFE. Upon addition of 50–85% TFE, αB-VxXXIVA [1], [2] showed slightly increased ordered structure, as evident by the shift in the minimum towards 208 nm, with some ellipticity also developing at 222 nm (Fig. 7B). The CD data were fitted using three algorithms (CDSSTR, CONTINLL, and SELCON) in CDPro [16]. The outputs obtained from all three algorithms gave very similar values and indicated that the αB-VxXXIVA [1], [2] isomer in the presence of 87% TFE had ∼ 42% α-helix, ∼ 8% β-strand and ∼ 50% unordered structure (including turns), whereas, in the absence of TFE it had ∼ 7% α-helix, ∼ 31% β-strand and ∼ 62% unordered structure.
Figure 7

CD spectra αB-Conotoxin VxXXIVA isomers.

(A) Overlay of spectra in phosphate buffer. (B) CD spectrum of αB-VxXXIVA [1], [2] in the presence of 50 and 87% TFE. This isomer showed a propensity to adopt a partially helical conformation at high TFE concentrations as evident by the shift in the minimum towards 208 nm along with some ellipticity developing around 222 nm.

CD spectra αB-Conotoxin VxXXIVA isomers.

(A) Overlay of spectra in phosphate buffer. (B) CD spectrum of αB-VxXXIVA [1], [2] in the presence of 50 and 87% TFE. This isomer showed a propensity to adopt a partially helical conformation at high TFE concentrations as evident by the shift in the minimum towards 208 nm along with some ellipticity developing around 222 nm.

Discussion

Conotoxins are a highly specialized set of disulfide-bonded peptides that are structurally and functionally diverse. Despite this diversity, toxins identified to date may be grouped into approximately 17 gene superfamilies based on conservation of the signal sequence. Within these gene superfamilies, the mature peptides adopt one of 23 patterns of arrangement of cysteine residues. Pharmacological targets within a gene superfamily may differ. For example, in the A superfamily, there are both paralytic and excitotoxic peptides [20]. It is very likely that the previously described superfamilies and Cys frameworks represent only a small fraction of the total chemical space of conotoxins. C. vexillum inhabits waters up to 70 m deep in Hainan province of the South China Sea and feeds on eunicid worms. Here, we describe the discovery and characterization from this species of αB-VxXXIVA, a peptide that differs in substantial aspects from previously-reported conotoxins. The clone for αB-VxXXIVA was obtained from random sequencing of a cDNA library prepared from venom ducts. The signal sequence of αB-VxXXIVA does not align well with the signal sequence of other known conotoxins. Conservation of the signal sequence has previously been exploited as a means of cloning novel conotoxins from different species of cone snails [21]. The unique signal sequence of αB-VxXXIVA explains why this novel conotoxin has not been detected previously with screening primers designed to recognize known gene superfamilies. The discovery of αB-VxXXIVA expands the known complexity of this group of ion channel- and receptor-targeted ligands. Interestingly, the precursor for αB-VxXXIVA is unique among conotoxins in that it lacks a pro region. The pro region of disulfide-bonded peptides has been shown to facilitate oxidative folding [22]. Consequently, the pro region of conotoxins was originally proposed as a means by which these peptides could fold into the same three-dimensional scaffold with identical disulfide connectivity [23]. However, evidence from studies with the two-disulfide α-conotoxin GI and three disulfide ω-conotoxin MVIIA [24] indicates that the propeptide sequence does not necessarily contribute directly to folding thermodynamics but rather plays a facilitative role when folding is catalyzed by a disulfide isomerase [25]. The pro domain has also been implicated in the secretory pathway of hydrophobic O-superfamily conotoxins [26]. Apparently, such a mechanism is not necessary for the more hydrophilic αB-VxXXIVA. The mature αB-VxXXIVA toxin is 40 amino acid residues in length and has a previously unreported arrangement of four Cys residues, C-CC-C. We synthesized the three possible disulfide isomers (Fig. 2) and assessed their activity at nAChRs. There are no reported examples of conotoxins that contain a vicinal disulfide bridge, and in the present case, the isomer that was synthesized with linkage between the adjacent second and third Cys residues was inactive. Both of the other two possible disulfide connectivities, αB-VxXXIVA [1], [2] with a disulfide connectivity I–II, III–IV, and αB-VxXXIVA [1], [3] with I–III, II–IV, blocked αα9α10 nAChRs, with the I–II, III–IV connectivity being 2-fold more active than the I–III, II–IV form. There is precedent for conotoxins that selectively block the α9α10 over other nAChR subtypes. α-Conotoxin Vc1.1 from C. victoriae and α-conotoxin RgIA from C. regius block the α9α10 nAChR with IC50 values of 5 and 19 nM, respectively [27]. Vc1.1 also blocks α6/α3β2β3 and α3β4 nAChRs with IC50 values of 140 and 4200 nM, respectively. Both α-CTx Vc1.1 and α-CTx RgIA were subsequently found to activate GABAB receptors [27], [28], [29]. In addition, other conotoxins that block nAChRs have also been reported to block voltage-gated ion channels including sodium and potassium channels [30], [31]. The IC50 values for the αB-VxXXIVA isomers against α9α10 nAChRS are in the micromolar range. It is therefore possible that these peptides, in addition to blocking nAChRs, will subsequently be found to act on other ligand- or voltage-gated ion channels. Although cone snails hunt fish, molluscs and worms, worms are the most common prey. The nAChR subunits from these polychaete marine worms have not been cloned; however, it is of note that αB-VxXXIVA preferentially targets the α9α10 subtype of nAChR. The α9 subunit is a member of the nAChR family although it is more distantly related; indeed it appears to be the closest subunit to the ancestor that gave rise to the nAChR family [32]. Thus, it is tempting to speculate that, among Conus, the worm-hunting species may be particularly likely to produce toxins that target α9 receptors. The α9 subunit is also of increasing interest in biomedicine. Conotoxins that target the α9 nAChR have been shown to be analgesic [10], [27] and to accelerate the recovery of function after nerve injury, possibly through immune-mediated mechanisms [33], [34]. In addition, small molecule antagonists of α9α10 nAChRs are analgesic in models of neuropathic pain [35], [36]. The α9α10 receptor is present in keratinocytes and is implicated in the pathophysiology of wound healing [37]. Recently it has been shown that the α9 subunit is overexpressed in breast cancer tissue. α9 antagonists reduce tumour growth [38], [39]. Moreover, variants of the α9 subunit affect transformation and proliferation of bronchial cells [1], [40]. Thus, novel antagonists of the α9α10 nAChR are not only of value to structure/function analysis of this receptor subtype but may also help inform development of novel therapeutics. The αB-VxXXIVA toxins are atypical among disulfide-bridged conotoxins in showing largely disordered structures in aqueous solution over a range of temperature and pH values. While unusual, this is consistent with structure predictions that show no significant ordered secondary structure for this amino acid sequence (Fig. S5); presumably this is also why the addition of a helix-stabilizing co-solvent like TFE did not induce significant helical structure in αB-VxXXIVA (Fig. 7). There are, however, precedents for disulfide-bridged conotoxins with poorly ordered structures and potent biological activity. Synthetic α−AuIB, for example, formed both a globular (native) isomer and a ribbon isomer upon oxidative refolding, and the ribbon isomer, although having a less well-defined structure, had approximately 10 times greater potency than the native peptide on nACh-evoked currents in rat parasympathetic neurons [41]. More recently, three different disulfide-bridge isomers of the μ-conotoxin PIIIA, which contains three disulfides, were found to block the skeletal muscle voltage-gated sodium channel NaV1.4 with similar, yet distinct potencies [42] even though one of them was disordered and gave a poorly dispersed 1H NMR spectrum akin to those observed for all three αB-VxXXIVA disulfide isomers. The concept of intrinsically disordered proteins is well established now [43], although it is quite unusual to find a conotoxin containing two disulfide bridges that displays these properties, as in the case of αB-VxXXIVA. It is believed that most intrinsically disordered proteins adopt a more ordered structure upon binding to their physiological targets [44], although evidence is emerging that this is not always the case. It remains to be seen if αB-VxXXIVA becomes more ordered upon binding to α9α10 nAChR. This might be assessed by studying the interaction of ACh-binding proteins engineered to resemble the α9α10 nAChR [45] and/or by creating conformationally constrained analogues of αB-VxXXIVA. The of of αB-VxXXIVA [, isomer at pH 5.8 and 7.0 in 20 mM phosphate buffer, acquired on a Varian 600 MHz NMR spectrometer at 22°C. Note that fewer amide resonances are observed at pH 7.0 because some are in rapid to intermediate exchange with solvent water at this pH. (TIFF) Click here for additional data file. The of of αB-VxXXIVA [, isomer at pH 5.8 and 7.0 in 20 mM phosphate buffer, acquired on a Varian 600 MHz NMR spectrometer at 22°C. Note that fewer amide resonances are observed at pH 7.0 because some are in rapid to intermediate exchange with solvent water at this pH. (TIFF) Click here for additional data file. The of of αB-VxXXIVA [, isomer at pH 5.8 and 7.0 in 20 mM phosphate buffer, acquired on a Varian 600 MHz NMR spectrometer at 22°C. Note that fewer amide resonances are observed at pH 7.0 because some are in rapid to intermediate exchange with solvent water at this pH. (TIFF) Click here for additional data file. [, in the presence and absence of CaCl (TIFF) Click here for additional data file. Secondary structure prediction of αB-VxXXIVA isomer, using the protein structure prediction http://bioinf.cs.ucl.ac.uk/psipred/ (TIFF) Click here for additional data file. Alignment of protein precursor sequences of gene superfamilies from . (DOC) Click here for additional data file. Alignment of mature toxin sequences of nAChR targeted conotoxin superfamilies from . (DOC) Click here for additional data file.
  66 in total

1.  A new level of conotoxin diversity, a non-native disulfide bond connectivity in alpha-conotoxin AuIB reduces structural definition but increases biological activity.

Authors:  Julie L Dutton; Paramjit S Bansal; Ron C Hogg; David J Adams; Paul F Alewood; David J Craik
Journal:  J Biol Chem       Date:  2002-10-09       Impact factor: 5.157

2.  The prodomain of a secreted hydrophobic mini-protein facilitates its export from the endoplasmic reticulum by hitchhiking on sorting receptors.

Authors:  Silvestro G Conticello; Noga D Kowalsman; Christian Jacobsen; Guennady Yudkovsky; Kazuki Sato; Zvulun Elazar; Claus Munck Petersen; Ami Aronheim; Mike Fainzilber
Journal:  J Biol Chem       Date:  2003-05-27       Impact factor: 5.157

3.  The synthesis, structural characterization, and receptor specificity of the alpha-conotoxin Vc1.1.

Authors:  Richard J Clark; Harald Fischer; Simon T Nevin; David J Adams; David J Craik
Journal:  J Biol Chem       Date:  2006-06-05       Impact factor: 5.157

4.  Identification of a novel class of nicotinic receptor antagonists: dimeric conotoxins VxXIIA, VxXIIB, and VxXIIC from Conus vexillum.

Authors:  Marion Loughnan; Annette Nicke; Alun Jones; Christina I Schroeder; Simon T Nevin; David J Adams; Paul F Alewood; Richard J Lewis
Journal:  J Biol Chem       Date:  2006-06-21       Impact factor: 5.157

Review 5.  Structural studies of conotoxins.

Authors:  Norelle L Daly; David J Craik
Journal:  IUBMB Life       Date:  2009-02       Impact factor: 3.885

6.  Alpha-conotoxin Vc1.1 alleviates neuropathic pain and accelerates functional recovery of injured neurones.

Authors:  Narmatha Satkunanathan; Bruce Livett; Ken Gayler; David Sandall; John Down; Zeinab Khalil
Journal:  Brain Res       Date:  2005-09-22       Impact factor: 3.252

7.  Atypical alpha-conotoxin LtIA from Conus litteratus targets a novel microsite of the alpha3beta2 nicotinic receptor.

Authors:  Sulan Luo; Kalyana Bharati Akondi; Dongting Zhangsun; Yong Wu; Xiaopeng Zhu; Yuanyan Hu; Sean Christensen; Cheryl Dowell; Norelle L Daly; David J Craik; Ching-I Anderson Wang; Richard J Lewis; Paul F Alewood; J Michael McIntosh
Journal:  J Biol Chem       Date:  2010-02-09       Impact factor: 5.157

8.  New conotoxins define the novel I3-superfamily.

Authors:  Duo-Duo Yuan; Li Liu; Xiao-Xia Shao; Can Peng; Cheng-Wu Chi; Zhan-Yun Guo
Journal:  Peptides       Date:  2009-01-30       Impact factor: 3.750

9.  Central role of alpha9 acetylcholine receptor in coordinating keratinocyte adhesion and motility at the initiation of epithelialization.

Authors:  Alex I Chernyavsky; Juan Arredondo; Douglas E Vetter; Sergei A Grando
Journal:  Exp Cell Res       Date:  2007-07-20       Impact factor: 3.905

Review 10.  Mammalian nicotinic acetylcholine receptors: from structure to function.

Authors:  Edson X Albuquerque; Edna F R Pereira; Manickavasagom Alkondon; Scott W Rogers
Journal:  Physiol Rev       Date:  2009-01       Impact factor: 37.312

View more
  20 in total

1.  Transcriptomic messiness in the venom duct of Conus miles contributes to conotoxin diversity.

Authors:  Ai-hua Jin; Sébastien Dutertre; Quentin Kaas; Vincent Lavergne; Petra Kubala; Richard J Lewis; Paul F Alewood
Journal:  Mol Cell Proteomics       Date:  2013-09-16       Impact factor: 5.911

2.  Cloning, synthesis, and characterization of αO-conotoxin GeXIVA, a potent α9α10 nicotinic acetylcholine receptor antagonist.

Authors:  Sulan Luo; Dongting Zhangsun; Peta J Harvey; Quentin Kaas; Yong Wu; Xiaopeng Zhu; Yuanyan Hu; Xiaodan Li; Victor I Tsetlin; Sean Christensen; Haylie K Romero; Melissa McIntyre; Cheryl Dowell; James C Baxter; Keith S Elmslie; David J Craik; J Michael McIntosh
Journal:  Proc Natl Acad Sci U S A       Date:  2015-07-13       Impact factor: 11.205

3.  Optimized deep-targeted proteotranscriptomic profiling reveals unexplored Conus toxin diversity and novel cysteine frameworks.

Authors:  Vincent Lavergne; Ivon Harliwong; Alun Jones; David Miller; Ryan J Taft; Paul F Alewood
Journal:  Proc Natl Acad Sci U S A       Date:  2015-07-06       Impact factor: 11.205

4.  Backbone cyclization of analgesic conotoxin GeXIVA facilitates direct folding of the ribbon isomer.

Authors:  Xiaosa Wu; Yen-Hua Huang; Quentin Kaas; Peta J Harvey; Conan K Wang; Han-Shen Tae; David J Adams; David J Craik
Journal:  J Biol Chem       Date:  2017-08-28       Impact factor: 5.157

5.  αS-conotoxin GVIIIB potently and selectively blocks α9α10 nicotinic acetylcholine receptors.

Authors:  Sean B Christensen; Pradip K Bandyopadhyay; Baldomero M Olivera; J Michael McIntosh
Journal:  Biochem Pharmacol       Date:  2015-06-11       Impact factor: 5.858

6.  Inhibition of α9α10 nicotinic acetylcholine receptors prevents chemotherapy-induced neuropathic pain.

Authors:  Haylie K Romero; Sean B Christensen; Lorenzo Di Cesare Mannelli; Joanna Gajewiak; Renuka Ramachandra; Keith S Elmslie; Douglas E Vetter; Carla Ghelardini; Shawn P Iadonato; Jose L Mercado; Baldomera M Olivera; J Michael McIntosh
Journal:  Proc Natl Acad Sci U S A       Date:  2017-02-21       Impact factor: 11.205

7.  αO-Conotoxin GeXIVA disulfide bond isomers exhibit differential sensitivity for various nicotinic acetylcholine receptors but retain potency and selectivity for the human α9α10 subtype.

Authors:  Dongting Zhangsun; Xiaopeng Zhu; Quentin Kaas; Yong Wu; David J Craik; J Michael McIntosh; Sulan Luo
Journal:  Neuropharmacology       Date:  2017-04-14       Impact factor: 5.250

8.  Conotoxin αD-GeXXA utilizes a novel strategy to antagonize nicotinic acetylcholine receptors.

Authors:  Shaoqiong Xu; Tianlong Zhang; Shiva N Kompella; Mengdi Yan; Aiping Lu; Yanfang Wang; Xiaoxia Shao; Chengwu Chi; David J Adams; Jianping Ding; Chunguang Wang
Journal:  Sci Rep       Date:  2015-09-23       Impact factor: 4.379

9.  Optimal cleavage and oxidative folding of α-conotoxin TxIB as a therapeutic candidate peptide.

Authors:  Xiaosa Wu; Yong Wu; Furong Zhu; Qiuyuan Yang; Qianqian Wu; Dongting Zhangsun; Sulan Luo
Journal:  Mar Drugs       Date:  2013-09-17       Impact factor: 5.118

10.  Systematic interrogation of the Conus marmoreus venom duct transcriptome with ConoSorter reveals 158 novel conotoxins and 13 new gene superfamilies.

Authors:  Vincent Lavergne; Sébastien Dutertre; Ai-hua Jin; Richard J Lewis; Ryan J Taft; Paul F Alewood
Journal:  BMC Genomics       Date:  2013-10-16       Impact factor: 3.969

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.