Literature DB >> 36084097

Genome wide identification and characterization of nodulation related genes in Arachis hypogaea.

Kiran Khurshid1, Anum Akram1, Ahmad Ali1, Faiza Munir1, Alvina Gul1, Ghulam Haider1, Zuhra Qayyum1, Rabia Amir1.   

Abstract

Nitrogen is an important plant nutrient that has a significant role in crop yield. Hence, to fulfill the needs of sustainable agriculture, it is necessary to improve biological nitrogen fixation in leguminous crops. Nod inducing gene families plays a crucial role in the interaction between rhizobia and legumes, leading to biological nitrogen fixation. However, nod inducing genes identification and characterization has not yet been performed in Arachis hypogaea. In this study, identification and genome-wide analysis of nod inducing genes are performed so that to explore their potential functions in the Arachis hypogaea for the first time. Nod genes were comprehensively analyzed by phylogenetic clustering analysis, gene structure determination, detection of conserved motifs, subcellular localization, conserved motifs, cis-acting elements and promoter region analysis. This study identified 42 Nod inducing genes in Arachis hypogaea, their sequences were submitted to NCBI and accession numbers were obtained. Potential involvement of these genes in biological nitrogen fixation has been unraveled, such as, phylogenetic analysis revealed that nod inducing genes evolved independently in Arachis hypogaea, the amino acid structures exhibited 20 highly conserved motifs, the proteins are present at different locations in cells and the gene structures revealed that all the genes are full-length genes with upstream intronic regions. Further, the promoter analysis determined a large number of cis-regulatory elements involved in nodulation. Moreover, this study not only provides identification and characterization of genes underlying developmental and functional stages of nodulation and biological nitrogen fixation but also lays the foundation for further revelation of nod inducing gene family. Besides, identification and structural analysis of these genes in Arachis hypogaea may provide a theoretical basis for the study of evolutionary relationships in future analysis.

Entities:  

Mesh:

Year:  2022        PMID: 36084097      PMCID: PMC9462762          DOI: 10.1371/journal.pone.0273768

Source DB:  PubMed          Journal:  PLoS One        ISSN: 1932-6203            Impact factor:   3.752


Introduction

Gene expression regulation at a transcriptional and post-transcriptional levels might influence and control important biological activities and processes such as perception of compounds, signal transduction, cellular morphogenesis, environmental stresses and beneficial interaction with microbes [1, 2]. Nodulation genes are involved in plant-microbe interaction leading to biological nitrogen fixation, an essential development for plant growth. Nodulation is a stepwise process that includes flavonoid exudation from roots and perception on rhizobia receptors, signal transduction, nod gene expression, root infection and nodule organogenesis [3]. And infection is controlled by the legume through a suite of nodulin genes which are temporally and spatially regulated [4]. After nodule formation, nitrogen is fixed by rhizobia and offer better growth to host plant in nitrogen scare soils, whereas rhizobia in return receive carbon for energy. Rhizobia uses ancient infection mode ‘crack entry’ for species of genus Arachis (counting Arachis hypogaea) without the development of infection threads which is easier to be established in non-legume crops [1, 5]. Plant productivity, species diversity in the natural ecosystem and agriculture, and the global nitrogen cycle is highly influenced by the nodulation process [1, 6]. Nodulation involves symbiotic signaling which initiates two parallel developmental processes i.e., bacterial infection and organogenesis of the nodule [7]. Flavonoid, a key signal in plant-microbe symbiosis, released from roots (as root-exudates) is recognized by rhizobia in the soil [8]. Upon chemotactic signal (flavonoid) by plant, rhizobia produce the signaling molecules known as nod factors (NFs) that signaled back to plant for bacterial entry into roots [7]. Rhizobia and host plant specificity is determined by NF which triggers the infection process and nodules formation [9]. Recognition of NFs is controlled by NF receptor genes such as NFP and LYK3 in M. truncatula and NFR5 and NFR1 in L. japonicus, OsCEBiP and/or LysM receptor kinases OsCERK1 in rice and LysM proteins such as AtCERK1, and AtLYK5 in Arabidopsis [10-16]. Moreover, DMI2 and receptor-like kinases SYMRK in M. truncatula and L. japonicus respectively, act as co-receptors in NF signaling [17]. The recognition process of NF activates a secondary messenger that initiates nucleus calcium oscillations and is responsible for proteins in nuclear membranes such as CASTOR, POLLUX and nuclear pore (NENA, NUP133 and NUP85) [17]. CYCLOPS and CCaMK complex decode calcium oscillations in the nucleus [17]. NSP1 and NSP2 genes in the nodulation signaling pathway encode transcription factors, that further trigger transcription factors ERN and nodule inception proteins (NIN), symbiotic signaling pathway transmits these signals for the occurrence of nodule morphogenesis [7, 17]. Furthermore, transcriptome analysis of Arachis hypogaea L. showed differently expressed genes (DEGs) which includes many orthologs to know genes of symbiotic signaling pathway such as ERN1, NSP2, and NFR5 [18]. Gene ontology enrichment analysis of these orthologs reveals their contribution in metabolic process, oxidative-reduction process, catalytic process, defense system and hormone biosynthesis [18]. Identification and classification of the nodulation genes in Arachis hypogaea are useful for future research on the expression of these genes, as to date no study has been performed on genome-wide characterization and identification of nodulation genes in Arachis hypogaea. In the Arachis hypogaea, this interaction is dependent on underground communications however, essential nutrients like nitrogen and soil organic matter may influence this relationship [19]. Arachis hypogaea, generally known as groundnut or peanut, is an essential food crop of subtropical and tropical areas. In the world, 84 countries grow peanut crops in an area of 27.66 million hectares having an annual production of 43 million tons of pods (nuts in-shell) i.e., with the 1590 kg ha-1 productivity [20]. The largest producers in the world are China, India, and the United States and exports are 1.25 million metric tons, approximately. Peanut seeds are an important contributor to human diets, as they are a rich source of lipids, proteins, and fatty acids. Oil content is about 47 to 50%, affecting its quality, flavor, and products [21]. About 55% of nitrogen required for growth and development is detained from biological nitrogen fixation in the peanut that could be enhanced (Hardarson 1993). In the present study, considering the importance of nodulation genes and lack of information about gene families in this process, we aimed to conduct a genome-wide identification and characterization of the NIG family genes in Arachis hypogaea.

Methodology

Identification and annotation of nodulation genes in Arachis hypogaea

To perform comprehensive analysis of Nod genes in Arachis hypogaea, different nodulation genes (NFP, SYMRK, NUP85, NUP133, CCaMK, CYCLOPS, NSP1, NIN, ERN1, Nod, Nol) were identified in model legumes [18]. A local BLASTp algorithm search was used to retrieve homologous FASTA sequences of these genes in NCBI (https://www.ncbi.nlm.nih.gov/). FASTA sequences retrieved from NCBI were used as queries to carry out BLASTn searches in peanut genomic database. The sequences was selected from PeanutBase (https://www.peanutbase.org/) with a cutoff e-value of 0e. To verify the reliability of results and to confirm each predicted sequences, all gene sequences were checked in the PFAM database (http://pfam.xfam.org/) [22] for domains. The full-length genes, half-length genes and genes having no domains in ORF are manually identified and then all the redundant sequences were removed. A total of 42 genes were designated as Nodulation related genes in Arachis hypoagea to perform further insilico analysis. The ExPASy translate tool (http://www.expasy.ch/tools/dna.html) was used to deduce the amino acid or open reading frames of Nod inducing genes. Then chemical and biophysical parameters of Nod inducing 42 genes in Arachis hypogaea were predicted by ProtParam (http://expasy.org/tools/protparam.html) available at ExPASy by using primary sequences of genes [23]. These properties were predicted to explore characteristics of genes e.g., protein length (aa), coding sequence (CDS), gene length (bp), molecular weight (MW), grand average of hydropathicity (GRAVY), isoelectric point (pI), instability index and aliphatic index (AI).

Sequence alignment and phylogeny inference

The sequences of nod inducing genes were retrieved from PeanutBase (https://www.peanutbase.org) and multiple sequences of full gene length were aligned by using MEGA 10.2.4 tool (https://www.megasoftware.net/) at default setting by using “align by muscle”. An unrooted tree was also constructed using MEGA 10.2.4 tool with neighbor joining (NJ) algorithm. The bootstrap replicates of 1000 with 50% cutoff values were used to test the reliability of the tree and then the tree was visualized.

Gene structure and conserved motif distribution analysis

Structural information of Nod inducing genes i.e., intron/exon patterns were predicted by using an online Gene Structure Display Server (http://gsds.gao-lab.org) [24, 25]. Gene structures were predicted by using coding regions (CDS) of genes in BED file format. The MEME (https://meme-suite.org/meme/) program was used for significant functional and conserved protein motifs prediction. This analysis was performed by adjustment of parameters as the optimum motif width: 3 residues, number of unique motifs: 20 and distribution of motifs: and any number of repetitions [26].

Chromosomal distribution and gene duplication

The position information of NIG gene family and chromosomes length were acquired from PeanutBase (https://www.peanutbase.org). Relative distances and physical locations of genes was visualized on their respective 20 Arachis hypogaea chromosomes using the online visualization tool PhenoGram (http://visualization.ritchielab.org/phenograms/plot). To evaluate the tandem and segmental duplication events, divergence time and selective pressure of NIG-family genes, the synonymous (Ks) and non-synonymous (Ka) values were calculated by TB-tool software (https://github.com/CJ- Chen/TBtools) (Chen et al. 2020) [27]. The divergence time was calculated by using a formula T = Ks/2x*MYA (where x = 6.56 x 10−9 and MYA = 10−6) (He et al. 2016) [28]. The segmental duplication was then represented by drawing the red lines between two duplicated genes.

Subcellular localization prediction and sequence logos analysis

To predict and better understand subcellular localization of NIG family proteins for several functions, all predicted 42 DNA FASTA sequences of Arachis hypogaea were translated to protein sequences via the online ExPASy translate tool (https://web.expasy.org/translate/). Plant-mPLoc (http://www.csbio.sjtu.edu.cn/bioinf/plant-multi/) was used to identify their subcellular locations [29]. Plant-mPLoc predictor allows localization of plant proteins at different 12 targets i.e., Chloroplast, Cell wall, Endoplasmic reticulum, Cytoplasm, Extracellular, Mitochondria, Golgi apparatus, Nucleus, Plasma membrane, Peroxisome, Plastid, Plasma membrane and Vacuole. Furthermore, sequence logos help to determine the amino acids that are conserved or non-conserved among all the genes. Hence for sequence logos analysis, proteins of 42 NIG family genes were aligned by CLUSTALW (https://www.genome.jp/tools-bin/clustalw) [30] and then sequence logos were generated by WebLogo (https://weblogo.berkeley.edu/logo.cgi) [31].

Retrieval of promoter regions and Cis-acting elements analysis

Promoter sequence regions of Arachis hypogaea, 1.5 kb upstream of the translation site, was downloaded from the peanut database. The PlantCare tool (http://bioinformatics.psb.ugent.be/webtools/plantcare/html/) [32] was used for the investigation of cis-acting elements in the promotes of NIG genes of Arachis hypogaea and classified based on their known functions.

Results

Identification and annotation of NIG gene family in Arachis hypogaea

Previous studies identified many nodulation genes in legume plants [17, 18]. Genome-wide studies of nodulation genes were conducted in many legume plants by exploring its publicly available data [33]. The current study identified a total of novel 42 NOD inducing genes in Arachis hypogaea ( by homology study. All the genes identified in NIG gene family, that encoded proteins having the nodulation function, were analyzed for the nodulation process according to their location on the chromosome. The ExPASy translate tool was used to deduce the amino acid or open reading frames of Nod inducing genes (. Based on PFAM analysis, the study determined whether each candidate gene contained the conserved domain, and the presence of related domains, respectively in the PFAM database was ultimately confirmed. Based on sequence identity with the functionally characterized NIG family, the individual names of all genes were given. The 42 full-length identified sequences were submitted to NCBI and their accession numbers were obtained. The gene names of the NIG family, their accession numbers, length of the coding sequences, and characteristics of these proteins are present in (Table 1).
Table 1

Characterization of NIG family genes in Arachis hypogaea.

Sr. NoGene IDChromosomesAccession numbersNucleotide CDS (bp)Length (aa)PIMwIIAIECGRAVYHalf life
1 AhNMTL1 13MZ16952627729235.71103395.3742.8991.86107120-0.228>10 hours
2 AhNMTL2 03MZ16952727729235.76103503.5541.5391.33110100-0.235>10 hours
3 AhNKEF1 05MZ16952817035675.8363918.9434.1282.7058370-0.403>10 hours
4 AhNKEF2 15MZ16952917025675.9163952.9235.1482.3659860-0.422>10 hours
5 AhNKEF3 17MZ16953016825605.5863090.2344.6981.8649320-0.477>10 hours
6 AhNKEF4 13MZ1695317345595.5862975.1845.5482.7049320-0.458>10 hours
7 AhNNLC1 16MZ16953222087354.8272061.9756.5451.9324980-0.065>10 hours
8 AhNNLC2 06MZ16953322117364.8272096.9756.1252.0024980-0.061>10 hours
9 AhNPR1 17MZ16953428779585.60106770.6353.0772.3597885-0.558>10 hours
10 AhNPR2 08MZ16953528959645.63107484.5453.7072.2099375-0.563>10 hours
11 AhNPR3 15MZ16953629529845.42109253.4358.2076.1986550-0.420>10 hours
12 AhNPR4 05MZ16953729589865.48109443.6157.5675.1486550-0.438>10 hours
13 AhNKLM1 11MZ1695385437626.6084511.4741.5588.39106980-0.183>10 hours
14 AhNKLM2 01MZ16953918876286.7369666.5043.3086.4387040-0.211>10 hours
15 AhNNup1 16MZ17008621517166.3681199.2651.5598.35150395-0.214>10 hours
16 AhNNup2 16MZ14708921477166.1981118.1751.3098.48150395-0.203>10 hours
17 AhNNup3 07MZ169571399613315.64149014.7243.7784.40202275-0.344>10 hours
18 AhNNup4 17MZ169572399313305.69149018.7143.6784.83200785-0.352>10 hours
19 AhNKEF5 11MZ16957315545175.6957794.1246.5192.5742900-0.251>10 hours
20 AhNKEF6 01MZ16957415495175.6957820.2045.7693.3342900-0.241>10 hours
21 AhNPR5 19MZ16957528489695.63107839.2757.9777.1774060-0.406>10 hours
22 AhNPR6 09MZ16957628429675.59107515.9658.3678.3575550-0.384>10 hours
23 AhNKLM3 05MZ16957717885957.5065636.7639.83101.04664050.068>10 hours
24 AhNKTyr 15MZ16957815384758.5152693.9837.77101.75616850.017>10 hours
25 AhNSur1 20MZ16957912424137.8847056.7131.8775.7461365-0.461>10 hours
26 AhNSur2 10MZ16958012424138.4347075.7031.6675.7161365-0.462>10 hours
27 AhNSur3 03MZ16958111883956.4944018.1734.4885.5464010-0.279>10 hours
28 AhNSur4 12MZ16958211123437.1538749.5939.6166.9750935-0.699>10 hours
29 AhNSur5 11MZ16958317275486.3362814.1338.1169.7895535-0.595>10 hours
30 AhNSur6 02MZ17008513504499.0851019.0739.1979.1563635-0.456>10 hours
31 AhNSur7 13MZ17007313144386.1948600.8831.7979.6165625-0.332>10 hours
32 AhNSur8 03MZ17007413944716.3152449.4334.3180.2576750-0.288>10 hours
33 AhNSur9 14MZ17007511703907.5343585.9030.4880.8576625-0.282>10 hours
34 AhNSur10 04MZ17007611553847.5442957.0727.6280.6078115-0.315>10 hours
35 AhNSur11 13MZ17007713594528.0850105.2234.3986.1968605-0.276>10 hours
36 AhNSur12 01MZ17007812754246.6447951.6638.5878.3358385-0.398>10 hours
37 AhNSur13 12MZ17007911583846.4743819.7239.8476.0758385-0.483>10 hours
38 AhNSur14 02MZ17008011703906.2444544.4742.6375.6758385-0.494>10 hours
39 AhNSur15 12MZ17008112454126.3346813.0337.3774.9556895-0.506>10 hours
40 AhNSur16 02MZ17008212454126.1346837.0137.7875.9056895-0.510>10 hours
41 AhNSur17 10MZ17008312454126.1346837.0137.7875.9056895-0.510>10 hours
42 AhNSur18 20MZ17008412454126.1346837.0137.7875.9056895-0.510>10 hours
The biochemical properties and physical parameters of Nod inducing 42 genes in Arachis hypogaea were predicted by ProtParam available at ExPASy by using primary sequences of genes. These properties were predicted to explore important characteristics of genes e.g., coding sequence (CDS), protein length (aa), isoelectric point (pI), molecular weight (MW), aliphatic index (AI), extinction coefficients (EC) by assuming all pairs of Cys residues form cystines, grand average of hydropathicity (GRAVY) and their estimated half-life. The full-length coding sequences of the Nod inducing genes ranged from 543 bp (AhNKLM1) to 3996 bp (AhNNup3) and their putative proteins contained between 343 and 1331 amino acid (aa) residues, with an average of ~631 aa. The theoretical pI ranged from 4.82 (AhNNLC1, AhNNLC2) to 9.08 (AhNSur6), and molecular weights ranged from 42957.07 (AhNSur10) to 149018.71 (AhNNup4). In congruence with the features, the genome-wide studies also detected significant variation in an aliphatic index, extinction coefficients and GRAVY inferring a high degree of complexity and functional diversification among the NIG family of Arachis hypogea (Table 1).

Evolutionary analysis of NIG gene family

To assess the evolutionary relationship, sequences of all the identified genes of NIG family (Nod Inducing Gene- family) were aligned and a phylogenetic tree was constructed using neighbor- joining method (Fig 1). All relationships were made by full-gene multiple sequence alignment of 42 Nod inducing genes and all ambiguous positions were removed for each sequence pair (pairwise deletion option). The phylogenetic analysis of these gene sequence resulted in the well-resolved tree, showing that the NIG family in Arachis hypogaea are classified into three major sub-families referred to as NIG-a, NIG-b and NIG-c. NIG-a has 14 members comprising of 5 domains while NIG-b having the maximum number of 16 members comprising of four domains. In addition to these families, sub-family NIG-c have the minimum number of 12 members comprising of four domains. Whereas all these three sub-families indicate that they are derived from a common ancestor with close homology. Based on their domains, NIG family represent functional similarities and have a close phylogenetic relationship. Furthermore, sub-families were divided into twelve groups, namely NIG-a1, NIG-a2, NIG-a3, NIG-a4, NIG-b1, NIG-b2, NIG-b3, NIG-b4, NIG-c1, NIG-c2, NIG-c3 and NIG-c4, on the basis of structural and functional similarities of genes. For instance, the genes that were more related to each other regarding structure and function were appeared in the same group. Thus, based on closed phylogenetic reconstruction, we speculate that these sub-families demonstrate biological nitrogen fixation. Conserved domain analysis revealed that groups of sub-family NIG-a were clustered together in a phylogenetic tree with NIG-a1, NIG-a2, NIG-a3 and NIG-a4. While groups of sub-family NIG-b contain NIG-b1, NIG-b2, NIG-b3 and NIG-b4 showed a close relationship. Meanwhile, sub-family NIG-c reported NIG-c1, NIG-c2, NIG-c3 and NIG-c4 groups have a relationship. As 6 members of NIG-a1 contains AhNPR1, AhNPR2, AhNPR3, AhNPR4, AhNPR5 and AhNPR6 genes having RWP-RK and PB1 domain, that are reported to be involved in nodule perception as they are involved in nitrate response and nodulation. However, this insilico study provided the further characterization of 4 members (AhNKEF1, AhNKEF2, AhNKEF3 and AhNKEF4) of the same sub-family NIG-a i.e., NIG-a2 based on their domains that are predicted to function in rhizobium infection. Moreover, the 2 members within NIG-a3 i.e., AhNNLC1 and AhNNLC2 has Nsp1-like-C-terminal region and thereby seeming to participate in infection and normal rhizobia bacteroid formation in the nodule. Two members of NIG-a4 group consist of AhNKLM1 and AhNKLM2 genes which contain protein kinase domain and LysM domain. Subsequently, 2 members, AhNMTL1 and AhNMTL2 belongs to NIG-b1 group and we identified that they can function in root nodule symbiosis. The two members in NIG-b3 contains the AhNNup3 and AhNNup4 gene having Nup85 Nucleoporin domain which might be an important part of nucleopore subcomplex and has been demonstrated to be involved in rhizobia colonization. Most of the groups with the SurNod19 domain belongs to NIG-b sub-family. As NIG-b2 has 6 members (AhNSur4, AhNSur5, AhNSur6, AhNSur12, AhNSur13 and AhNSur14) while 6 members of NIG-b4 contains AhNSur1, AhNSur2, AhNSur15, AhNSur16, AhNSur17 and AhNSur18 genes. Besides these two, 6 members of NIG-c1 (AhNSur3, AhNSur7, AhNSur8, AhNSur9, AhNSur10, AhNSur11) has the same domains and it was interesting to study that the NIG-b2, NIG-b4 and NIG-c1 are functionally same, which has been documented to participate in nodule development. The NIG-c has functionally characterized groups suggesting that most of the groups of this sub-family have similar functions as groups of NIG-a and NIG-b. While the NIG-c2 has functionally similar 2 members (AhNNup1 and AhNNup2) as NIG-c3. Members as AhNKEF5 and AhNKEF6 belongs to NIG-c3 and has functional similarity to NIG-a2 i.e., according to their domains they are characterized as rhizobial infection and nodulation causing genes. The 2 members of NIG-c4 (AhNKLM3 and AhNKTyr) include LysM, protein kinase and Pkinase_Tyr domains which have been reported to be involved in rhizobial nodule symbiosis. Hence, these studies revealed evolutionary relationships of Nod inducing genes in NIG family and the domains of these genes are implicated in causing rhizobial infection and nodulation which leads to biological nitrogen.
Fig 1

Phylogenetic analysis of NIG family genes.

Full length gene sequences were aligned and phylogenetic tree was constructed using MEGA10 software by maximum Likelihood (ML) method with 1000 bootstrap replicates. Different groups or genes are highlighted in different colors according to the domains present in these genes.

Phylogenetic analysis of NIG family genes.

Full length gene sequences were aligned and phylogenetic tree was constructed using MEGA10 software by maximum Likelihood (ML) method with 1000 bootstrap replicates. Different groups or genes are highlighted in different colors according to the domains present in these genes.

Conserved motif analysis and intron/exon organization of NIG gene family

Conserved motifs of NIG family genes were predicted by utilizing the online MEME tool. However, the conserved motif prediction is essential to further gain an understanding of diversification and structural characteristics of genes. The detailed information about the 42 genes of NIG family including name, width and best possible matches is presented by this study. The current study found 27 conserved motifs with different amino acids ranges from 15–50. Identified motifs and their schematic distribution in all sub-groups (Fig 2). In addition, the sequence, sites and width for each conserved motif (Table 2).
Fig 2

Conserved protein motifs of NIG gene family.

The protein motifs of NIG genes are shown as colored boxes. The proteins or motifs are ordered according with the order of sub-family NIG-a, NIG-b and NIG-c. Twenty seven predicted motifs were presented by different colored boxes and schematically arranged in accordance with the pattern of phylogenetic tree.

Table 2

Conserved sequences, sites, width and e-values of NIG family genes motifs.

MotifConserved amino acid sequencese-valuesSitesWidth
1. YFDIEFPRGHIGIKNFQAELVDEHGNSIPLYEAYLHHYFVLRYFENITMS 2.7e-5911750
2. YNNKQKRKVYLKYTVTWVDWDQYQVPLKFYILDVTDQVTYN 2.5e-4761841
3. AHVHSGIVNATLYGEBGRVLCEVKPTYGTGEEAGNEKGYVVGMSGCYPKP 1.0e-5661750
4. ENVPKEYDEEKWLINILVIDTRGTEDKKGCTECRCDLYNVKSEDFGNPTG 2.8e-5371750
5. ZSQPIYGKYFRRNDGVCQGSVNSYSWGLGVDARKTSLELPDPFRIEVGTH 1.8e-4531250
6. MKFICEVVJLSLSIIVJQSSIIFSRZLENPNHIKTATFYTKTFVLEPGKV 4.5e-3061050
7. EGHYHIKRTKIPMKKGGNLIY 1.4e-2001821
8. SDYKGGIFCCEKKSQCKLQKG 1.3e-1881221
9. QRYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKVNRSLSKLK 8.6e-169650
10. EKKDVTGLGVVFYILLAGDLP 4.7e-1453021
11. HNCAVEYSITPQNTD 1.4e-1401815
12. QICNEGRQNALAEILEILTVVCETHNLPLAQTWVPCRHRSV 1.4e-113641
13. HHLQQGQGVAGRAFLSHNMSFCPNITRFCKTDYPLVHYALM 2.3e-125641
14. GRVYQQKVPEWTPDVQYYSSKEYPRRDHAQHYNVRGTLALPVFEPPGQSC 2.8e-150650
15. FDIKYLDDDHEWVLITCDADLQECIDVLR 4.5e-088829
16. GSIKIKDGEILTLEF 2.1e-0841715
17. AYEDDJIVHIVMELCGGGELFDRIVKRGK 4.4e-0961029
18. ILAYLHEHHKPGVVHRDJKPENILLDNKM 3.0e-1071229
19. FGLTAAFAICLRSSHTGSDDYVLEFFLPPEJTDFNEQKKLLGSJLLIIKQ 3.6e-113850
20. VGVLELIMTSQKINYAPEVDKVCKALEAVNLKSSEILEHQY 1.1e-093641
21. AIVRNSGRCQLNTLGQYFGLGSETRGLHT 1.4e-0931029
22. AILKGHIDFKEEPWPGISDSAKDLIRKMLTPDPSKRLTAQEVLSHPWIIE 1.3e-092650
23. MDTDKDGRVTYEELKAGLRKLGSTLADNEJRLLMEVADVDRSGLJDYGEF 3.7e-079850
24. SSYDKTNPKSKTAVHLSPKIEIGPGKVSN 4.8e-0701029
25. QPPTNALNYPTAYTAPDVERTEPQEPFGGMLLEGVGSSKDLRNLCPLEDZ 4.0e-058450
26. RGNFGLVYLYTENGSLEEWLCKEISKRK 2.7e-0531228
27. EHSPSAPNPMSPFIFPTSSEQPYSPLWLFSDVEDEKHNVTL 2.2e-048641

Conserved protein motifs of NIG gene family.

The protein motifs of NIG genes are shown as colored boxes. The proteins or motifs are ordered according with the order of sub-family NIG-a, NIG-b and NIG-c. Twenty seven predicted motifs were presented by different colored boxes and schematically arranged in accordance with the pattern of phylogenetic tree. The number of motifs were comparatively greater in NIG-b sub-family than NIG-a and NIG-c sub-families. Motif 1 was found in all Nodulin stress up-regulating genes of groups NIG-b2, NIG-b4 and NIG-c1 except for AhNSur4. Similarly, motif 4 was exclusively present in all Nodulin stress up-regulating genes except for AhNSur6. Motif 2, 7 and 11 were unique to all genes of NIG-b2, NIG-b4 and NIG-c1 groups. Motif 5 and 8 were encountered in NIG-b2 and NIG-b4 groups. Motifs 6 is present in 10 (AhNSur1,2,6,12,13,14,15,16,17 and 18) out of 18 genes of AhNSur group, suggesting that these motifs might have conserved functions. Motif 3, 16, 21, 24 were detected only within some genes of AhNSur and AhNPR groups. Motif 9, 12, 20 and 14 were found in NIG-a1 group. Motif 25 was also encountered in NIG-a1 group except for AhNPR1 and AhNPR2 genes. Motif 13 and 27 were documented for all genes of NIG-a1 and NIG-b1. Motif 15, 17, 19 and 23 were unique to some genes of NIG-a1, NIG-a2, NIG-a4 and NIG-b1 groups, suggesting that these genes may be derived from a common ancestor. Motif 22 was only encountered in all AhNKEF genes. Motif 18 and 26 were observed within most genes of groups NIG-a2, NIGa-4, NIG-b1, and NIG-c2, NIG-c3 and NIG-c4. The analysis also suggests that motif 10 is conserved to most of the NIG family (present at 30 different sites; having 21 amino acids sequence), suggesting that it could be a signature motif associated with NIG family genes. While the non-conservation between motifs of NIG family predicts groups specificity, which could be related to diversifications in their functions. Furthermore, analysis revealed the conserved domains in genes of NIG family are positioned at similar locations and the results demonstrate that majority of the genes of this family are closely related and they have common compositions of motifs which represents that the gene structures are highly conserved. Structural diversity and functional characterization of NIG family genes are important to gain information about the evolution of this gene family. Hence to analyze the exon/intron structure of NIG family genes BED files were used, the analysis suggested that all are full-length genes i.e., the domains for nodulation lie inside the CDS regions. However, there are intronic regions in these genes and these intronic regions are upstream of the CDS regions. While the genes AhNSur6, AhNSur12, AhNSur14 and AhNKLM3 contained no intronic region (Fig 3). These observations indicated that each group in NIG family, shows maximum common gene structural conservation.
Fig 3

The gene structure of NIG family genes.

The coding sequence and intronic regions are plotted using yellow boxes and black lines respectively. The genes are ordered with their accession numbers.

The gene structure of NIG family genes.

The coding sequence and intronic regions are plotted using yellow boxes and black lines respectively. The genes are ordered with their accession numbers.

Chromosomal location and gene duplication of NIG genes

Chromosomal locations of 42 NIG gene family were investigated on their corresponding 20 Arachis hypogaea chromosomes. The genes were widely distributed throughout the Arachis hypogaea genome. Genes were mapped on chromosomes according to their order (Fig 4). However, th-e genes show unequal distribution on the chromosomes. Uneven distribution of NIG gene family on chromosomes indicates that the evolutionary process leads to genetic variation. Among 20 chromosomes, 9 chromosomes harbored maximum number of 3 genes (Chr01: AhKEF6, AhNKLM2, AhNSur12; Chr02: AhNSur6, AhNSur14, AhNSur16; Chr03: AhNSur8, AhNMTL2, AhNSur3; Chr05: AhNKLM3, AhNKEF1, AhNPR4; Chr11: AhNKLM1, AhNKEF5, AhNSur5; Chr12: AhNSur15, AhNSur13, AhNSur4; Chr15: AhNKTyr, AhNKEF2, AhNPR3; Chr16: AhNNup1, AhNNup2, AhNNLC1; Chr17: AhNKEF3, AhNNup4, AhNpr1). Chr13 has a higher number of NIG genes as compared to others. While there was no NIG gene located on Chr18. Chr10 and Chr20 hosted two genes. AhNsur10, AhNNLC2, AhNNup3, AhNPR2, AhNPR6, AhNSur9 and AhNPR5 are located on Chr04, Chr06, Chr07, Chr08, Chr09, Chr14 and Chr15 respectively. In plants, presumably, duplication mechanisms occur during gene families expansion; usually, these mechanisms involve segmental duplication, tandem duplication and whole-genome duplication [34]. Hence to understand the possible relationship between NIG gene family and potential gene duplication within the Arachis hypogaea genome, we analyzed the duplication mechanisms during the evolution of this gene family here. By analyzing the sequence coverage and similarities of 42 NIG genes, we identified 7 pairs of genes (AhNKEF5/AhNKEF6, AhNSur9/AhNSur10, AhNNCL1/AhNNCL2, AhNMTL1/AhNMTL2, AhNNup3/AhNNup4, AhNSur1/AhNSur2 and AhNSur15/AhNSur16) experienced segmental duplication. While there was no tandem and whole-genome duplication event. These observations were suggested that segmental duplication contributed largely to the expansion of NIG family members in Arachis hypogaea. These segmental duplication events were presented by constructing red lines on the Fig 4.
Fig 4

Chromosomal localization of NIG family genes on Arachis hypogaea chromosomes.

The candidate NIG genes were designated on respective chromosomes from top to bottom according to their order.

Chromosomal localization of NIG family genes on Arachis hypogaea chromosomes.

The candidate NIG genes were designated on respective chromosomes from top to bottom according to their order. The Arachis hypogaea chromosomes (Chr02, Chr10, Chr12, Chr13, Chr16, and Chr20) also have nodulation inducing overlapping genes. Ka and Ks values for these duplicated gene pairs were calculated by using the KaKs calculator and then obtained information was used to determine selective evolutionary pressure. 6 out of 7 gene pairs had Ka/Ks<1 which indicated purification selection while one gene pair had Ka/Ka>1 which implies positive selection during evolution. In addition, segmental duplication events of 7 gene pairs were predicted to occurred between 0.286 and 41.607 million years ago (Table 3).
Table 3

Ka, Ks and Ka_Ks calculation and divergent time of duplicated Arachis hypogaea NIG family genes.

S. NoParalogous PairsKaKsKa_KsDuplicationTime (Mya *)
1AhNKEF5- AhNKEF60.545890710.521316981.0471378SD41.607524
2AhNSur9- AhNSur100.01134130.063299490.17916888SD0.86442829
3AhNNLC1- AhNNLC20.003762160.035650280.10552952SD0.28674973
4AhNMTL1- AhNMTL20.006152910.018765640.32788171SD0.46897178
5AhNNup3- AhNNup40.040990330.053460090.76674648SD3.12426328
6AhNSur1- AhNSur20.021399040.066070380.32388251SD1.63102454
7AhNSur15- AhNSur160.005227410.025785230.20272897SD0.39843085

NIG family protein subcellular localization and sequence logos analysis

The protein localization by Plant-mPLoc analysis predicted that 37 proteins of NIG family are located at single positions. For instance, these single location proteins are present in the nucleus, chloroplast and cytoplasm. While there are 5 proteins found in multiple positions. For instance, the proteins encoded by AhNNup3 and AhNNup4 genes are located in chloroplast-nucleus, while AhNNLC1 and AhNNLC2 encoded proteins are located in cell membrane-nucleus and the protein encoded by AhNKLM2 gene is present in cell membrane-cytoplasm-nucleus (Fig 5).
Fig 5

Protein locations of NIG family genes.

The predicted locations of the proteins are nucleus, chloroplast and cell-membrane. The presence of protein on its respective location is represented by yellow colored boxes while their absence is indicated by green colored boxes.

Protein locations of NIG family genes.

The predicted locations of the proteins are nucleus, chloroplast and cell-membrane. The presence of protein on its respective location is represented by yellow colored boxes while their absence is indicated by green colored boxes. The sequence logos of NIG family proteins could help to evaluate and discover the pattern of amino acid conservation in all 42 genes. Sequence logos of aligned amino acid residues of nodulation genes in Arachis hypogaea were generated to determine whether the NIG family proteins were conserved in all 42 genes throughout evolution (). The analysis showed that the protein sequences had moderate to high-level conservation at many different positions across N to C terminal.

Retrieval of promoter regions and cis-acting elements analysis

To evaluate the transcriptional regulation of NIG gene family in response to different environmental conditions, promoters and cis-acting regulatory elements of candidate genes have been identified. Hence, 1500 bp upstream of the start codon was selected for identification of putative cis-acting regulatory elements (CAREs) (. The study revealed a total of 55 kinds of cis-acting regulatory elements across all Arachis hypogaea nodulation related genes. However, the CAREs length varies from 5–13 bp. Fig 6 represents the frequency of occurrence of each cis-acting element in each gene.
Fig 6

Analysis and frequency of occurrence of cis-acting elements related to stress responses, hormonal regulations and cellular development in NIG promoter regions of Arachis hypogaea.

The cis-acting elements of all the candidate genes were grouped into functional categories as show in Fig 7. Among these identified cis-acting elements, common elements, such as TATA-box and CAAT-box, were present in abundance and were shared by all NIG genes. In addition, other identified cis-acting regulatory elements were associated with environmental stress-related factors, hormonal regulation and cellular development. For instance, among all the identified cis-acting elements, the motifs such as ACE, GT1-motif, AE-box, GCC-box, ATC-motif, I-box, Box II, Box III, Box 4, chs-CMA1a, chs-CMA2a, CCAAT-box, MBS, LTR, ABRE, O2 site, G-box, GATA motif, GA motif and LAMP-element etc. are associated with stress responses like low-temperature, light, oxidation, defense, wound, drought, anaerobic induction and anoxic response respectively. After, the stress-responsive motifs, motifs involved in hormonal regulation were found to be the second largest in number. Motifs such as, CGTCA and TGACG (methyl-jasmonate), ABRE (abscisic acid), TCA element (salicylic acid), AuxRR-core (auxin responsiveness element) were considered as hormonal responsive elements in NIG genes. Similarly, the elements involved in cellular development are relatively fewer in number than hormonal and stress-sensitive elements. These cis-acting elements include CAT box, O2 site, GCN4_motif, circadian, MBSI and ARE etc. CAT box is involved in meristem expression responses. Zein metabolism is regulated by O2 site. GCN4_motif is involved in endosperm expression. The circadian motif plays an important role in controlling circadian rhythms. MBSI has a role in the regulation of flavonoid biosynthetic genes. And anaerobic induction is carried out by ARE motif. Furthermore, the analysis revealed that most of the NIG genes belonging to different groups contain a number of binding sites for a major class of plant transcription factor genes. For instance, CCAAT-box has a MYBHv1 binding site. The detailed information about the cis-elements, their sequences and functions are shown in . However, the number of occurrences of each cis-element was predicted. All NIG genes contained 512 stress-responsive elements, among them light-responsive elements made up 29%, which represents that light-responsive elements are most abundantly found in NIG genes. Similarly, hormonal regulation is coordinated by 237 motifs and there are at least 26 element to control cellular as shown in Fig 8.
Fig 7

Pie distribution of identified cis-elements of Arachis hypogaea NIG family genes from PlantCARE, on the basis of their biological functions.

Fig 8

Histogram showing the number of cis-elements in NIG family genes, (a) is representing the number of cis-elements of cellular development, (b) is representing the number of cis-elements of hormonal regulation and (c) is representing the number of cis-elements of cellular development, (c) is representing the number of cis-elements of stress responses.

Histogram showing the number of cis-elements in NIG family genes, (a) is representing the number of cis-elements of cellular development, (b) is representing the number of cis-elements of hormonal regulation and (c) is representing the number of cis-elements of cellular development, (c) is representing the number of cis-elements of stress responses.

Discussion

Many legume plants respond to rhizobium to form a symbiotic relationship and develop a structure on their roots, known as a nodule. A nodule is an organ in which rhizobium converts atmospheric N2 into ammonia by a unique process [35]. However, this type of symbiotic relationship is triggered by the release of flavonoids from plants which might act as chemo-attractant to rhizobium spp., the Nod genes and a signal which is generated in plants after the perception of Nod-Factors [36]. Nod factors activate several nodulation genes in the nitrogen-fixing plants, however, the characterization of Nod genes was reported in many legumes [7, 12, 17]. For instance, nodulation factor receptor genes like NFR1 and NFR5 are discovered in L. japonicus [12, 13] and LYK3 and NFP were discovered in M. truncatula1 [10]. Furthermore, in L. japonicus and M. truncatula, the receptor-like kinases SYMRK and DMI2 serve as co-receptors for NF signaling [17]. It was crucial to completely predict and understand the role of nodulation genes in Arachis hypogaea. Arachis hypogaea is 3rd largest class of legumes and it plays an important role in the world agriculture economy [37]. In this study, we analyzed the evolutionary relationship of nodulation inducing genes (NIG) family in Arachis hypogaea and categorized the physiochemical properties, gene structure, motif analysis, protein localization, chromosomal location, duplication of genes and their selection pressure of NIG family genes. The nodulation genes in allotetraploid Arachis hypogaea [38] were analyzed to understand the function of NIG family genes in flavonoid exudation, nodule development and biological nitrogen fixation. The phylogenetic tree divided NIG family genes into three sub-families NIG-a, NIG-b and NIG-c, where sub-family NIG-b was the largest with 16 members while the sub-family NIG-c was the smallest with 12 members while previously identified MtGRAS family divided nodulation genes into eight subfamilies [39] and A.evenia LysM-RLK nodulation gene family contained 18 members [40]. The role of these genes in nodulation was also supported by conserved amino acid residue analysis of Arachis hypogaea genes. These results showed that sequence logos were conserved at many regions among all the genes, exhibiting that NIG family genes remained conserved throughout the process of evolution. Moreover, in the phylogenetic tree the NIG genes which have a very close evolutionary relationship was clustered together, suggesting that they may play related functions in plant nodulation. Further analysis revealed that the gene length of NIG family genes ranges from 543 bp to 3996 bp. It has been predicted that genes belonging to NIG family share similar gene structures and protein motif distribution as well as few conserved motifs which indicated that NIG gene family is more conserved. Here we also predicted that the proteins encoded by these genes have almost similar motifs hence they are associated with the specific functions of symbiotic relationships. For instance L. japonicus and M. truncatula has Nucleoporin [41, 42], RWP-RK in Arachis duranensis and Arachis ipaensis [43], EF-hand domain in soybean [44], LRR in L. japonicus [45] were found to be involved in nodulation. AhNup3 is the largest assumed protein (149014.72 Da) while AhNSur4 is the gene whose molecular weight was the smallest (38749.59 Da). In addition, the proteins were found to be located at different cell organelles i.e., nucleus, chloroplast and cell-membrane. These proteins were either single or multilocus proteins. Genes derived from the same ancestral genes are called orthologs they have same biological functions, while the genes resulted from single genes by duplication event are called paralogs. Paralogs encode proteins with dissimilar functions [25, 46, 47]. The duplicated genes are mainly participating in paralogous genes formation of families. Besides, the uneven distribution of NIG family genes on 20 Arachis hypogaea chromosomes indicated that during evolution NIG genes experienced duplication. Further, in MtGRAS gene family of model legume M. truncatula 17 genes were duplicated [39] while our investigations predicted seven duplicated gene pairs in NIG family. Furthermore, these genes are originated from segmental duplication events and none of the genes originated from tandem duplication. Hence segmental duplication contributed to functional divergence and gene family expansion. Cis-regulatory elements present in the promoter regions of genes are considered to be responsible for controlling the environmental and developmental regulation of gene expression. We determined different types and numbers of cis-acting elements in NIG family genes promoters. Many genes contained MBS, ACE, Box 4, MRE, CCAAT-box, GATA-motif, AT1-motif, I-box, ACA-motif, ATC-motif, Box II, AAAC-motif, WUN-motif, GA-motif, GC-motif etc. And these elements might responsible to perform different functions of the gene families under this study. For instance, stress-related elements were in abundance which might play an important role in adapting to external environmental stresses such as, low temperature, drought, light and defense. Cis-elements controlling hormonal regulation was second the largest in number. In addition, few elements might play role in cellular development. Furthermore, different numbers of such cis-acting elements were also discovered in wild species (A. duranensis and A. ipaensis), representing, distinct functions of these genes, vital for plant growth and development [43].

Conclusion

The function of many nodulation related genes of legumes has been determined, but the functions of nodulation genes in Arachis hypogaea are still not demonstrated. NIG family genes were identified and divided according to evolutionary lineages into three sub-families. The expansion of NIG family might be the result of segmental duplication. Whereas, biophysical properties depict that NIG family proteins are located at distinctive cellular compartments, which represents that the proteins or enzymes are correlated with specific functions. In addition, these genes have conserved motifs and gene structures which suggests that the genes have functional similarities. All 42 genes are unevenly mapped on the chromosome. Cis-element analysis revealed the role of NIG family genes display their pivotal role in stress responses, hormonal regulation and cellular development. Hence, the results provided by genomic and bioinformatics analysis of NIG family genes provides a piece of valuable information about the phylogenetic relationship, structure, and function of these family members. These results could help in developmental research and genetic improvement of nodulation genes in Arachis hypogaea and other valuable nitrogen-fixing plants to improve biological nitrogen fixation. However, functional characterization of genes is needed to confirm their role in the nitrogen fixation and their use in future research programs.

Sequences of 42 Nod inducing genes of Arachis hypogaea.

(DOCX) Click here for additional data file.

Open reading frames or amino acid sequences of 42 Nod inducing genes of Arachis hypogaea.

(DOCX) Click here for additional data file.

Putative promoter sequences of 42 Nod inducing genes of Arachis hypogaea.

(DOCX) Click here for additional data file.

Cis-elements and their respective functions.

(DOCX) Click here for additional data file.

Sequence logos of Arachis hypogaea NIG genes.

The C-terminal and N-terminal pf NIG gene domain are represented by using ‘N’ and ‘C’. (TIF) Click here for additional data file.
  41 in total

1.  A receptor kinase gene of the LysM type is involved in legume perception of rhizobial signals.

Authors:  Esben Bjørn Madsen; Lene Heegaard Madsen; Simona Radutoiu; Magdalena Olbryt; Magdalena Rakwalska; Krzysztof Szczyglowski; Shusei Sato; Takakazu Kaneko; Satoshi Tabata; Niels Sandal; Jens Stougaard
Journal:  Nature       Date:  2003-10-09       Impact factor: 49.962

2.  WebLogo: a sequence logo generator.

Authors:  Gavin E Crooks; Gary Hon; John-Marc Chandonia; Steven E Brenner
Journal:  Genome Res       Date:  2004-06       Impact factor: 9.043

Review 3.  The unseen majority: soil microbes as drivers of plant diversity and productivity in terrestrial ecosystems.

Authors:  Marcel G A van der Heijden; Richard D Bardgett; Nico M van Straalen
Journal:  Ecol Lett       Date:  2007-11-29       Impact factor: 9.492

4.  The CLUSTAL_X windows interface: flexible strategies for multiple sequence alignment aided by quality analysis tools.

Authors:  J D Thompson; T J Gibson; F Plewniak; F Jeanmougin; D G Higgins
Journal:  Nucleic Acids Res       Date:  1997-12-15       Impact factor: 16.971

Review 5.  Speak, friend, and enter: signalling systems that promote beneficial symbiotic associations in plants.

Authors:  Giles E D Oldroyd
Journal:  Nat Rev Microbiol       Date:  2013-04       Impact factor: 60.633

6.  Contrasting patterns of evolution following whole genome versus tandem duplication events in Populus.

Authors:  Eli Rodgers-Melnick; Shrinivasrao P Mane; Palitha Dharmawardhana; Gancho T Slavov; Oswald R Crasta; Steven H Strauss; Amy M Brunner; Stephen P Difazio
Journal:  Genome Res       Date:  2011-10-05       Impact factor: 9.043

7.  Large-scale phosphoprotein analysis in Medicago truncatula roots provides insight into in vivo kinase activity in legumes.

Authors:  Paul A Grimsrud; Désirée den Os; Craig D Wenger; Danielle L Swaney; Daniel Schwartz; Michael R Sussman; Jean-Michel Ané; Joshua J Coon
Journal:  Plant Physiol       Date:  2009-11-18       Impact factor: 8.340

8.  LysM domain receptor kinases regulating rhizobial Nod factor-induced infection.

Authors:  Erik Limpens; Carolien Franken; Patrick Smit; Joost Willemse; Ton Bisseling; René Geurts
Journal:  Science       Date:  2003-08-28       Impact factor: 47.728

Review 9.  The Role of Flavonoids in Nodulation Host-Range Specificity: An Update.

Authors:  Cheng-Wu Liu; Jeremy D Murray
Journal:  Plants (Basel)       Date:  2016-08-11

Review 10.  Characteristics and Research Progress of Legume Nodule Senescence.

Authors:  Shunxin Zhou; Chanjuan Zhang; Yi Huang; Haifeng Chen; Songli Yuan; Xinan Zhou
Journal:  Plants (Basel)       Date:  2021-05-30
View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.