Anne Mette Frøbert1, Malene Brohus1, Julia N C Toews2, Phillip Round2, Ole Fröbert3,4,5,6, Geoffrey L Hammond2, Michael T Overgaard1. 1. Department of Chemistry and Bioscience, Faculty of Engineering and Science, Aalborg University, Denmark. 2. Department of Cellular & Physiological Sciences, The University of British Columbia, Vancouver, BC, Canada. 3. Department of Cardiology, Faculty of Health, Örebro University, Sweden. 4. Department of Clinical Medicine, Faculty of Health, Aarhus University, Denmark. 5. Department of Clinical Pharmacology, Aarhus University Hospital, Denmark. 6. Steno Diabetes Center Aarhus, Aarhus University Hospital, Denmark.
Abstract
Sex hormone-binding globulin (SHBG) regulates the bioavailability of sex steroid hormones in the blood. Levels of SHBG increase markedly in brown bears (Ursus arctos) during hibernation, suggesting that a key regulatory role of this protein is to quench sex steroid bioavailability in hibernation physiology. To enable characterization of ursine SHBG and a cross species comparison, we established an insect cell-based expression system for recombinant full-length ursine and human SHBG. Compared with human SHBG, we observed markedly lower secretion levels of ursine SHBG, resulting in a 10-fold difference in purified protein yield. Both human and ursine recombinant SHBG appeared as dimeric proteins in solution, with a single unfolding temperature of ~ 58 °C. The thermal stability of ursine and human SHBG increased 5.4 and 9.5 °C, respectively, in the presence of dihydrotestosterone (DHT), suggesting a difference in affinity. The dissociation constants for [3 H]DHT were determined to 0.21 ± 0.04 nm for human and 1.32 ± 0.10 nm for ursine SHBG, confirming a lower affinity of ursine SHBG. A similarly reduced affinity, determined from competitive steroid binding, was observed for most steroids. Overall, we found that ursine SHBG had similar characteristics to human SHBG, specifically, being a homodimeric glycoprotein capable of binding steroids with high affinity. Therefore, ursine SHBG likely has similar biological functions to those known for human SHBG. The determined properties of ursine SHBG will contribute to elucidating its potential regulatory role in hibernation physiology.
Sex hormone-binding globulin (SHBG) regulates the bioavailability of sex steroid hormones in the blood. Levels of SHBG increase markedly in brown bears (Ursus arctos) during hibernation, suggesting that a key regulatory role of this protein is to quench sex steroid bioavailability in hibernation physiology. To enable characterization of ursine SHBG and a cross species comparison, we established an insect cell-based expression system for recombinant full-length ursine and human SHBG. Compared with human SHBG, we observed markedly lower secretion levels of ursine SHBG, resulting in a 10-fold difference in purified protein yield. Both human and ursine recombinant SHBG appeared as dimeric proteins in solution, with a single unfolding temperature of ~ 58 °C. The thermal stability of ursine and human SHBG increased 5.4 and 9.5 °C, respectively, in the presence of dihydrotestosterone (DHT), suggesting a difference in affinity. The dissociation constants for [3 H]DHT were determined to 0.21 ± 0.04 nm for human and 1.32 ± 0.10 nm for ursine SHBG, confirming a lower affinity of ursine SHBG. A similarly reduced affinity, determined from competitive steroid binding, was observed for most steroids. Overall, we found that ursine SHBG had similar characteristics to human SHBG, specifically, being a homodimeric glycoprotein capable of binding steroids with high affinity. Therefore, ursine SHBG likely has similar biological functions to those known for human SHBG. The determined properties of ursine SHBG will contribute to elucidating its potential regulatory role in hibernation physiology.
anion exchange chromatographydextran‐coated charcoal5α‐dihydrotestosteronematrix‐assisted laser desorption ionization‐time of flight mass spectrometrypFastBac™ Dualrelative binding affinitysize exclusion chromatography‐multi‐angle light scatteringsex hormone‐binding globulinSex hormone‐binding globulin (SHBG) is a plasma protein that transports and regulates the bioavailability of sex steroids in the blood by adjusting the equilibrium between free and protein‐bound steroid [1]. Steroids are lipophilic with low solubility in water and are therefore bound to various binding proteins when transported in the circulation [2]. Sex steroids, including androgens and estrogens, are important regulatory molecules that control sexual maturation and reproduction as well as regulate other sexually dimorphic tissues like muscle, adipose tissue, and bone [3]. According to the ‘free hormone hypothesis’, only free steroids can enter target cells by passive diffusion through the plasma membrane and exert their functions [4].The plasma level of SHBG increases 45‐fold in Scandinavian brown bears during hibernation [5]. During the 6–month‐long hibernation period, the bear does not eat, drink, urinate, or defecate, and moves only infrequently [6]. In a period where energy conservation is critical, such an increase in SHBG suggests an unknown function of this protein during this important physiological state in bears. Contrary to humans, brown bears do not show any signs of disease from prolonged immobility and obesity [7, 8, 9]. High plasma SHBG levels in humans correlate with a lower risk of numerous diseases, such as metabolic syndrome, type 2 diabetes, cardiovascular diseases [10], and muscle weakness [11]—none of which are observed in the hibernating brown bear [7]. Elucidating the physiological mechanisms that protect the hibernating bear may reveal novel therapeutic targets in humans.Human SHBG is well characterized [12, 13, 14, 15, 16, 17, 18]. Like the human SHBG precursor polypeptide, the ursine SHBG precursor polypeptide is 402 amino acids long, and they share 77% sequence identity. Cleavage of the human 29 amino acid secretion signal peptide results in mature human SHBG of 373 amino acids [19], but the signal peptide cleavage site and mature sequence has not been determined for ursine SHBG prior to this study. Mature human SHBG has a deglycosylated molecular weight of 40.5 kDa and forms a homodimer with a total glycosylated weight of about 90 kDa [19, 20, 21]. Each monomer consists of two laminin G‐like domains (LG domains), joined in tandem by a short linker. The tertiary structure of the N‐terminal LG domain has been solved for human SHBG, and the steroid‐binding site is located close to the center of this domain in a hydrophobic core formed between two β‐sheets (Fig. 1A) [22]. Additionally, a yet uncharacterized receptor, located in the plasma membrane of sex steroid‐responsive cells, has been reported for human SHBG [23, 24]. Amino acid residues 48–57 (TWDPEGVIFY) in the N‐terminal LG domain of human SHBG were identified as the receptor‐binding site (residues 51–60 in ursine SHBG) (Fig. 1B) and this region is highly conserved between species [25].
Fig. 1
The human SHBG N‐terminal LG domain. (A) Front and (B) back view of the human SHBG N‐terminal LG domain (surface representation) with DHT marked with blue and the receptor binding site marked with yellow (PDB: 1D2S) [22]. Substitutions from human to ursine SHBG are marked with red (note that only substitutions positioned at the surface are visible). The structure in figure B has been rotated 180° about the y‐axis from figure A.
The human SHBG N‐terminal LG domain. (A) Front and (B) back view of the human SHBG N‐terminal LG domain (surface representation) with DHT marked with blue and the receptor binding site marked with yellow (PDB: 1D2S) [22]. Substitutions from human to ursine SHBG are marked with red (note that only substitutions positioned at the surface are visible). The structure in figure B has been rotated 180° about the y‐axis from figure A.To characterize ursine SHBG, we established an insect cell‐based expression system for recombinant ursine SHBG alongside the human orthologue. The expression system produced dimeric and active full‐length ursine and human SHBG. A lower steroid‐binding affinity of ursine SHBG, compared to human, was observed. Except for the lower steroid affinity, ursine SHBG showed similar characteristics to human SHBG, and therefore, they likely have similar biological functions. The determined properties of ursine SHBG will contribute to elucidate SHBG’s potential regulatory role in hibernation physiology.
Results and Discussion
Sequence alignment and homology modeling of ursine SHBG
The ursine SHBG amino acid sequence was aligned to that of human SHBG (Fig. 2). The structure of the ursine SHBG N‐terminal LG domain was predicted by homology modeling based on the structure of the human orthologue (Fig. 3). In human SHBG, steroids are anchored in the steroid‐binding site through hydrogen bonds, with androgens and estrogens binding in opposite orientations. The C3 carbonyl of androgens and the C17 hydroxyl of estrogens points into the interior of SHBG and forms a hydrogen bond with the side‐chain hydroxyl of Ser42 in human SHBG, which is of paramount importance for high‐affinity steroid binding. Two additional hydrogen bonds are formed at the entrance of the binding pocket between the hydroxyl group at C17 of androgens or C3 of estrogens and the side chains of Asp65 and Asn82 in human SHBG, where Asp65 appears to be the most important [22, 26]. These three steroid‐anchoring residues are conserved in ursine SHBG (Ser45, Asp68, Asn85) (Table 1). Besides these residues, all other contacts are hydrophobic, with Phe67, Met107, and Met139 in human SHBG contributing with the largest contact surface to the steroid [26]. Phe67 is conserved in ursine SHBG (Phe70), while the two Met residues are substituted to Ile (Ile110) and Val (Val142). Trp84 in human SHBG also affects steroid‐binding, although not by direct contact [26], and is substituted to Met (Met87) in ursine SHBG.
Fig. 2
Alignment of the human and ursine SHBG amino acid sequences. The Homo sapiens SHBG (hSHBG) (NCBI: NP_001031) and Ursus arctos horribilis SHBG (uSHBG) (NCBI: XP_026376673) sequences were aligned by clustal omega (version 1.2.4, European Bioinformatics Institute, University College Dublin, Dublin, Ireland). Conserved residues are marked with a period in the human sequence. The sequences are numbered according to the mature ursine sequence.
Fig. 3
Homology model of the ursine SHBG N‐terminal LG domain. (A) The structure of the ursine SHBG N‐terminal LG domain was modeled using the SWISS‐MODEL server and the structure of the human orthologue in complex with dihydrotestosterone (DHT) as template (PMDB: PM0084113). Glycosylation sites are shown in green and the disulfide bond in yellow. The structure has been extended in the N‐ and C‐terminal ends to include Thr10 and Cys192 (shown in dashes). (B) The modeled ursine SHBG N‐terminal LG domain with amino acids differing from human SHBG shown as red sticks.
Table 1
Conservation of residues in ursine SHBG with known functional importance in human SHBG. The SHBG sequences are numbered starting from the first amino acid of the mature sequence, where the signal peptide of ursine SHBG is cleaved between position 26 and 27. For the N‐linked glycosylation sites, the entire consensus sequence is stated with the residue, to which the glycosylation is attached, marked in bold.
Interaction
Amino acid in human SHBG
Amino acid in ursine SHBG
Conserved
Steroid‐binding
Ser42
Ser45
Yes
Asp65
Asp68
Yes
Phe67
Phe70
Yes
Asn82
Asn85
Yes
Met107
Ile110
No
Met139
Val142
No
310‐helical lid
130–135 (PLTSKR)
133–138 (PLASKP)
Partly
RSHBG binding site
48–57 (TWDPEGVIFY)
51–60 (TWDPEGVIFY)
Yes
Disulfide bridges
Cys164‐Cys188, Cys333‐Cys361
Cys167‐Cys192, Cys336‐Cys364
Yes
O‐linked glycosylation
Thr7
Thr10
Yes
N‐linked glycosylation
Asn23‐Gly‐Ser
No
Asn351‐Arg‐Ser
Ser354‐Arg‐Ser
No
Asn367‐Gly‐Thr
Asn370‐Gly‐Thr
Yes
Ca2+‐binding site I
Asp50, Glu52, Ala160
Asp53, Glu55, A163
Yes
Zn2+‐binding site II
Asp65
Asp68
Yes
His83
Gln86
No
His136
Gln139
No
Zn2+‐binding site III
His101, Asp117
His104, Asp120
Yes
Alignment of the human and ursine SHBG amino acid sequences. The Homo sapiens SHBG (hSHBG) (NCBI: NP_001031) and Ursus arctos horribilis SHBG (uSHBG) (NCBI: XP_026376673) sequences were aligned by clustal omega (version 1.2.4, European Bioinformatics Institute, University College Dublin, Dublin, Ireland). Conserved residues are marked with a period in the human sequence. The sequences are numbered according to the mature ursine sequence.Homology model of the ursine SHBG N‐terminal LG domain. (A) The structure of the ursine SHBG N‐terminal LG domain was modeled using the SWISS‐MODEL server and the structure of the human orthologue in complex with dihydrotestosterone (DHT) as template (PMDB: PM0084113). Glycosylation sites are shown in green and the disulfide bond in yellow. The structure has been extended in the N‐ and C‐terminal ends to include Thr10 and Cys192 (shown in dashes). (B) The modeled ursine SHBG N‐terminal LG domain with amino acids differing from human SHBG shown as red sticks.Conservation of residues in ursine SHBG with known functional importance in human SHBG. The SHBG sequences are numbered starting from the first amino acid of the mature sequence, where the signal peptide of ursine SHBG is cleaved between position 26 and 27. For the N‐linked glycosylation sites, the entire consensus sequence is stated with the residue, to which the glycosylation is attached, marked in bold.SHBG forms two disulfide bridges (Cys164‐Cys188 and Cys333‐Cys361 in human SHBG), which are highly conserved across species [19]. The four cysteines are also conserved in ursine SHBG and are therefore expected to link Cys167 to Cys192 at the very C terminus of the N‐terminal LG domain (Fig. 3) and Cys336 to Cys364 in the C‐terminal LG domain.Human SHBG is a glycoprotein with one O‐linked (Thr7) and two N‐linked glycosylation sites (Asn351 and Asn367) [27, 28]. The O‐glycosylation site is fully occupied, while the Asn351 and Asn367 N‐glycosylation sites have average molar occupancies of 85% and 95%, respectively [27]. The O‐linked glycosylation site is conserved in ursine SHBG (Thr10). The consensus site for N‐glycosylation Asn367‐Gly‐Thr (Asn‐X‐Ser/Thr, where X is not a Pro) is also conserved in ursine SHBG (Asn370‐Gly‐Thr), as in most species [29], while Asn351 is substituted to Ser in ursine SHBG (Ser354). However, Pro22 in the human orthologue is substituted with Ser in ursine SHBG (Ser25), giving rise to a new consensus site for ursine N‐glycosylation: Asn23‐Gly‐Ser (Fig. 2). This site is located at the surface of SHBG and is therefore potentially accessible for glycosylation (Fig. 3). The degree of occupancy of these three glycosylation sites in ursine SHBG is not known.Three bivalent metal ion coordination sites have been identified in the N‐terminal LG domain of human SHBG: A Ca2+ binding site located opposite of the steroid‐binding pocket, a Zn2+ binding site located at the entrance to the steroid‐binding pocket, and another Zn2+‐binding site located close to the dimer interface. The Ca2+‐binding site and the Zn2+‐binding site at the dimer interface are conserved in ursine SHBG. For the Zn2+‐binding site located at the entrance to the steroid‐binding site, two of the human Zn2+‐coordinating residues, His83 and His136, are substituted to Gln in the bear (Gln86 and Gln139, respectively). Therefore, this Zn2+‐binding site is most likely absent in ursine SHBG. In human SHBG, this Zn2+‐binding site is located close to a flexible 310‐helical loop (residues 130–135 in human SHBG) that covers the entrance of the steroid‐binding pocket when Zn2+ is absent. Zn2+ coordination causes a structural change of the loop that decreases the SHBG‐binding affinity for estrogens, while this has little or no effect on androgens [30, 31]. One of the residues in this flexible lid is substituted in ursine SHBG (Thr132 to Ala135).
Expression of full‐length SHBG in ExpiSf cells
To characterize the biochemical properties of SHBG, we established an expression and purification protocol for recombinant ursine and human protein variants. SHBG, fused to a C‐terminal FLAG purification tag, was expressed in ExpiSf insect cells from a baculovirus expression vector system. The ExpiSf cell line produced higher SHBG yields compared to test expressions using Sf9 or High Five insect cells or human embryonic kidney (HEK293) cells (data not shown). Maximal levels of SHBG in the expression medium were observed 72–96 h postinfection. However, as increasing amounts of degraded protein was apparent over the same period of time (data not shown), SHBG was harvested 72 h postinfection.Supplementation of 10 µm DHT to the expression medium increased the SHBG yield from ExpiSf cells by 68% for ursine SHBG and 20% for human SHBG (Fig. S1). Based on preliminary analysis on SHBG expressed in insect cells, we speculate that this might be due to an increased solubility of SHBG upon steroid binding and that the relative effect on increase in solubility is larger for ursine compared to human SHBG (data not shown). However, there might be other explanations, and the effect of adding steroid is not fully understood. The SHBG fusion protein was purified to > 99% by using a combination of anti‐FLAG affinity and anion exchange chromatography (AEX), removing all protein contaminants visible by SDS/PAGE with Coomassie R‐250 staining (Fig. 4). MALDI‐ToF mass spectrometry (MS) confirmed the identity of SHBG, with 89.3% sequence coverage for ursine SHBG and 96.3% for human SHBG (Fig. S2). The final yield (mean ± SD of three replicates) of purified SHBG per liter ExpiSf culture was 65.9 ± 7.5 µg (1.6 ± 0.2 nmol) for ursine SHBG and about 10‐fold higher for human SHBG (653 ± 133 µg, 15.8 ± 3.2 nmol).
Fig. 4
Efficiency of SHBG purification. SDS/PAGE analysis (Coomassie Brilliant Blue R‐250 stained) showing the efficiency of anti‐FLAG affinity chromatography (α‐FLAG) and anion exchange chromatography (AEX) for purification of ursine (uSHBG) and human SHBG (hSHBG) from the ExpiSf expression medium. L = load, E = eluate. Equal volumes are loaded of both human and ursine SHBG; however, the AEX eluate were concentrated 2.3× for human SHBG and 10× for ursine SHBG.
Efficiency of SHBG purification. SDS/PAGE analysis (Coomassie Brilliant Blue R‐250 stained) showing the efficiency of anti‐FLAG affinity chromatography (α‐FLAG) and anion exchange chromatography (AEX) for purification of ursine (uSHBG) and human SHBG (hSHBG) from the ExpiSf expression medium. L = load, E = eluate. Equal volumes are loaded of both human and ursine SHBG; however, the AEX eluate were concentrated 2.3× for human SHBG and 10× for ursine SHBG.
Ursine and human SHBG contains two signal peptide cleavage sites
Cleavage of the signal peptide was evident from western blotting analysis where the apparent molecular weight of SHBG in the conditioned medium was slightly lower than that of SHBG from the cell pellet (Fig. 5). We therefore concluded that SHBG present in the medium had passed through the secretory pathway. Because SHBG is a plasma protein and thus natively secreted from hepatocytes, it is important that the recombinant protein enters the secretory pathway in the host cell to be properly processed, including attachment of carbohydrates and disulfide bond formation [32].
Fig. 5
Intra‐ and extracellular SHBG. Nonreducing western blot of intracellular (in) and extracellular (ex) ursine (uSHBG) and human SHBG (hSHBG) expressed by ExpiSf cells. Comparable amounts are loaded of cells (intracellular) and expression medium (extracellular)—thus, the cells were resuspended to the original volume of expression medium. Ursine samples are loaded in a 3× higher volume than the human.
Intra‐ and extracellular SHBG. Nonreducing western blot of intracellular (in) and extracellular (ex) ursine (uSHBG) and human SHBG (hSHBG) expressed by ExpiSf cells. Comparable amounts are loaded of cells (intracellular) and expression medium (extracellular)—thus, the cells were resuspended to the original volume of expression medium. Ursine samples are loaded in a 3× higher volume than the human.MALDI‐ToF MS revealed no peaks corresponding to tryptic or chymotryptic peptides from the signal peptides (human: MESRGPLATSRLLLLLLLLLLRHTRQGWA(L), ursine: MECRGPLATSGWLSLLLLLLPPPGHQ(G)), indicating that the secretion signal peptides had been cleaved off SHBG. A peak corresponding to the most N‐terminal semichymotryptic peptide from mature human SHBG (LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTF) confirmed cleavage of the signal peptide at the same site as reported previously [33]. We also observed a peak corresponding to an N‐terminal semichymotryptic peptide with an alternative cleavage site (RPVLPTQSAHDPPAVHL) for human SHBG. This alternative N‐terminal has previously been reported with an occurrence of ~ 25% [33]. For ursine SHBG, two peaks with masses corresponding to N‐terminal semichymotryptic peptides with two different signal peptide cleavage sites were apparent, namely between residues 26 and 27 (GRAPRHGL) and between residues 27 and 28 (RAPRHGL) (Fig. S3). Both cleavage sites are predicted as the most likely by the SignalP algorithm, although this depends on the software version used [34].
Substitution of the secretion signal peptide does not increase SHBG yield
A large fraction of both human and ursine SHBG was retained within the ExpiSf cells compared with the amount secreted to the expression medium (Fig. 5). Furthermore, the amount of ursine SHBG secreted to the expression medium was lower than that of human SHBG, despite similar total expression levels (intra‐ and extracellular) and similar cell densities. This indicates that ursine SHBG is less efficiently secreted from the ExpiSf cells (Fig. 5). In an attempt to optimize secretion efficiency of both ursine and human SHBG from the ExpiSf cells, the native signal peptides were substituted with the signal peptide of honeybee melittin, which has been reported to increase the yield of other proteins from insect cells [35]. Additionally, the signal peptide of ursine SHBG was substituted with the human SHBG signal peptide. Theoretically, the ursine SHBG signal peptide (MECRGPLATSGWL SLLLLLLPPPGHQ(G)) is less efficient than the human (MESRGPLATSRLLLLLLLLLLRHTRQGWA), as it contains a shorter hydrophobic core, fewer polar amino acids in the C‐terminal, and several proline residues close to the cleavage site [36, 37]. A longer leucine stretch, such as the one found in the human SHBG signal peptide, has been reported to increase the yield of hyenid SHBG in CHO cells [38]. However, substitution of the ursine signal peptide to that of human SHBG did not significantly increase secretion of ursine SHBG from ExpiSf insect cells. Neither did substitution of either the human or ursine signal peptide to that of honeybee melittin (Fig. 6). Thus, an inefficient signal peptide cannot explain the observed low yield of secreted ursine SHBG from the ExpiSf cells.
Fig. 6
Substitution of the SHBG signal peptide. Western blot of triplicate ExpiSf cultures expressing human (hSHBG) and ursine SHBG (uSHBG) with native (natSP), melittin (meltSP), or human SHBG signal peptide (hSP). (A) 10 μL culture medium with human SHBG was loaded. (B) 20 μL culture medium with ursine SHBG was loaded along with 5 μL culture medium with human SHBG used to normalize the quantities. (C) imagej was used to quantify the protein bands on the western blots. The intensities have been adjusted with the dilution factors. Means and standard deviations are indicated. The band intensities were not significantly different (n.s) (P‐value ≥ 0.05) between the various signal peptides, as determined from an unpaired Student’s t‐test.
Substitution of the SHBG signal peptide. Western blot of triplicate ExpiSf cultures expressing human (hSHBG) and ursine SHBG (uSHBG) with native (natSP), melittin (meltSP), or human SHBG signal peptide (hSP). (A) 10 μL culture medium with human SHBG was loaded. (B) 20 μL culture medium with ursine SHBG was loaded along with 5 μL culture medium with human SHBG used to normalize the quantities. (C) imagej was used to quantify the protein bands on the western blots. The intensities have been adjusted with the dilution factors. Means and standard deviations are indicated. The band intensities were not significantly different (n.s) (P‐value ≥ 0.05) between the various signal peptides, as determined from an unpaired Student’s t‐test.
Recombinant ursine and human SHBG expressed in ExpiSf cells is dimeric
SDS/PAGE analysis of reduced and nonreduced purified recombinant SHBG showed a small change in migration, supporting formation of disulfide bonds in both the ursine and human protein variants (Fig. 7). The presence of the Cys164‐Cys188 disulfide bond in human SHBG was verified directly by MALDI‐ToF MS of tryptically digested SHBG under non‐reducing conditions (Fig. S4). The tryptic dipeptide containing the Cys333‐Cys361 disulfide bond in human SHBG, and the dipeptide containing the expected Cys336‐Cys364 disulfide bond in ursine SHBG were not observed. These dipeptides both include N‐linked glycosylation sites, which may explain their lack of detection. Also, the tryptic dipeptide harboring the predicted ursine SHBG Cys167‐Cys192 disulfide was not detected. This is likely due to the relatively large mass (8690.40 Da), which is known to reduce the efficiency of ionization and detection in MALDI‐ToF.
Fig. 7
Reduced and nonreduced SHBG. SDS/PAGE analysis of nonreduced (nRD) and reduced (RD) purified ursine (uSHBG) and human SHBG (hSHBG).
Reduced and nonreduced SHBG. SDS/PAGE analysis of nonreduced (nRD) and reduced (RD) purified ursine (uSHBG) and human SHBG (hSHBG).In native PAGE, recombinant ursine and human SHBG migrated a similar distance as SHBG present in human serum, suggesting identical multimeric composition (Fig. S5). Indeed, size exclusion chromatography‐multiangle light scattering (SEC‐MALS) analysis verified the mass of both recombinant and native serum SHBG to be ~ 90 kDa, demonstrating that these proteins form dimers in solution (Fig. 8; Fig. S6).
Fig. 8
Determination of SHBG molecular mass by SEC‐MALS. The masses of human and ursine recombinant SHBG and of native human serum SHBG, determined by SEC‐MALS. Means and standard deviations are indicated. Lines corresponding to the molecular weight of monomeric and dimeric SHBG (nonglycosylated) is shown.
Determination of SHBG molecular mass by SEC‐MALS. The masses of human and ursine recombinant SHBG and of native human serum SHBG, determined by SEC‐MALS. Means and standard deviations are indicated. Lines corresponding to the molecular weight of monomeric and dimeric SHBG (nonglycosylated) is shown.
Ursine SHBG has three potential glycosylation sites
Ursine SHBG contains the same number of glycosylation consensus sites as the human orthologue, although positioned differently. The masses of SHBG, determined from SEC‐MALS analysis (93.1 ± 4.1 for ursine SHBG and 93.7 ± 5.8 kDa for human) demonstrate that the recombinant SHBG is glycosylated, as these masses are larger than the theoretical nonglycosylated dimeric masses (83.1 kDa for ursine SHBG and 82.9 kDa for human). The mass differences correspond to ~ 29 and ~ 32 sugar units per SHBG‐monomer for ursine and human SHBG, respectively. Three bands from ursine SHBG and two bands from human SHBG were observed in SDS/PAGE analysis (Fig. 7) and were expected to derive from differential glycan occupancy, as previously described for human plasma SHBG [27]. Moreover, both ursine and human SHBG were observed to elute in more than one peak in AEX chromatography suggesting that various glycoforms occur (data not shown). The masses of recombinant intact monomeric SHBG were determined by MALDI‐ToF MS to 43.1 kDa for ursine SHBG and 43.5 kDa for human SHBG (Fig. S7). This corresponds to a mass shift of 1.55 kDa for ursine SHBG and 2.05 kDa for human SHBG, or approximately 9 and 12 sugar units, respectively, relative to the theoretical molecular weight determined from the amino acid sequence (Table 2). Additionally, the peak from human SHBG contained a shoulder, corresponding to a mass of 42.8 kDa and a mass shift of 1.34 kDa or 8 sugar units. Thus, the glycosylations of recombinant human SHBG expressed in insect cells are either fewer or smaller than those of native human SHBG, for which the O‐glycosylation typically is 3 sugar units and the two N‐glycosylations typically are 11 units each [27]. Since the native glycosylations of SHBG are not associated with steroid‐binding, protein folding, or dimerization, we do not believe that the insect‐derived glycosylations affect any of the experimental outcomes in this study [12].
Table 2
SHBG masses determined by MALDI‐ToF MS. Masses of intact human and ursine recombinant SHBG (with a C‐terminal FLAG‐tag) determined by MALDI‐ToF MS and calculated from the mature amino acid sequence. For ursine SHBG, the calculated mass of the mature protein, cleaved after both amino acid 26 and 27 in the preprotein, is stated.
[SHBG+H]+
[SHBG+2H]2+
[SHBG+3H]3+
[SHBG]
Measured m/z
Human SHBG
43 534.87
21 760.10
14 487.84
Ursine SHBG
43 073.48
21 575.08
NOB
Calculated m/z
Calculated average mass (Da)
Human SHBG
41 460.11
20 730.56
13 820.71
41 459.10
Ursine SHBG (384aa)
41 566.01
20 783.51
13 856.01
41 565.00
Ursine SHBG (383aa)
41 508.96
20 754.98
13 836.99
41 507.95
δ (Da)
Human SHBG
2074.77
1029.54
667.13
Ursine SHBG (384aa)
1507.47
791.58
NOB
Ursine SHBG (383aa)
1564.52
820.10
NOB
Measured mass (Da)
Measured mass (Da) (mean ± SD)
Human SHBG
43 533.86
43 516.17
43 454.46
43 501.50 ± 41.69
Ursine SHBG
43 072.47
43 146.14
NOB
43 109.30 ± 52.09
Mass shift (Da)
Human SHBG
2042.40
Ursine SHBG (384aa)
1544.31
Ursine SHBG (383aa)
1601.36
SHBG masses determined by MALDI‐ToF MS. Masses of intact human and ursine recombinant SHBG (with a C‐terminal FLAG‐tag) determined by MALDI‐ToF MS and calculated from the mature amino acid sequence. For ursine SHBG, the calculated mass of the mature protein, cleaved after both amino acid 26 and 27 in the preprotein, is stated.The N‐glycosylation consensus site positioned closest to the C terminus of SHBG (Asn367‐Gly‐Thr in human SHBG) is highly conserved in all known mammalian sequences, including the bear, which suggests that glycosylation of this site in particular is functionally important [29]. We were unable to identify a peak corresponding to the nonglycosylated peptide spanning this N‐glycosylation site in ursine SHBG (Asn370), neither in MALDI‐ToF analysis of tryptic peptides of our recombinantly expressed SHBG, nor in the data from the bear plasma proteomics study by Welinder et al. [5]. This suggests high glycan occupancy of this site in both native and recombinant ursine SHBG, consistent with the observations for native human SHBG, which has a reported glycan occupancy of 95% [27]. Glycan occupancy results in a mass shift of the peptide, and the resulting modified peptide can only be identified by MALDI‐ToF MS if the glycan mass is known.A peak corresponding to the nonglycosylated peptide spanning the O‐glycosylation site in ursine SHBG (Thr10) was observed by MALDI‐ToF analysis of recombinant SHBG but not in the proteomics data by Welinder et al. Thus, for recombinant ursine SHBG, the O‐glycosylation site is not, or only partially, glycosylated, while it seems to be fully occupied in native ursine SHBG. The O‐glycosylation site has been reported to be fully occupied for native human SHBG [27].A peak corresponding to the nonglycosylated peptide covering the N‐glycosylation site Asn23 found in ursine SHBG, but not in human SHBG, was observed both for the recombinant SHBG and in the proteomics data by Welinder et al. [5]. We therefore suggest that this site is not, or only partially, glycosylated. Based on these data, we believe that the size heterogeneity of ursine plasma SHBG observed by Welinder et al. [5] derives primarily from partial occupation of the Asn23 glycosylation site.
Ursine and human recombinant SHBG is active and stabilized by steroid‐binding
The ability of the recombinant SHBG to bind steroid was demonstrated by thermal unfolding analysis in the presence and absence of DHT. Supplementation of 50 µm DHT increased the unfolding temperature from 58.7 ± 0.1 °C to 64.1 ± 0.3 °C for ursine SHBG and from 58.4 ± 0.5 °C to 68.0 ± 0.2 °C for human SHBG (Fig. 9). Thus, DHT‐binding stabilized both ursine and human SHBG, as has previously been reported for human SHBG [31]. Interestingly, human SHBG is stabilized to a larger extend by DHT than ursine SHBG (a 9.6 °C versus a 5.4 °C increase in unfolding temperature, respectively), suggesting a higher DHT‐binding affinity of the human variant.
Fig. 9
Thermal unfolding assay of SHBG with and without DHT. Thermal unfolding assay with (A) fluorescence ratio 350/330 nm and (B) first derivative hereof as a function of temperature for ursine (uSHBG) and human SHBG (hSHBG) in the presence of 0 or 50 µm DHT. (C) Unfolding temperature (T
m) of ursine (uSHBG) and human SHBG (hSHBG) in the presence of 0 or 50 µm DHT determined from the peak maximum of the first derivative of the fluorescent ratio 330/350 nm as a function of the temperature. Means and standard deviations are indicated. P‐values were determined from an unpaired Student’s t‐test.
Thermal unfolding assay of SHBG with and without DHT. Thermal unfolding assay with (A) fluorescence ratio 350/330 nm and (B) first derivative hereof as a function of temperature for ursine (uSHBG) and human SHBG (hSHBG) in the presence of 0 or 50 µm DHT. (C) Unfolding temperature (T
m) of ursine (uSHBG) and human SHBG (hSHBG) in the presence of 0 or 50 µm DHT determined from the peak maximum of the first derivative of the fluorescent ratio 330/350 nm as a function of the temperature. Means and standard deviations are indicated. P‐values were determined from an unpaired Student’s t‐test.
Ursine SHBG binds steroids with a 6‐fold lower affinity than human SHBG
We then determined the steroid‐binding affinity of recombinant ursine and human SHBG by Scatchard analysis using [3H]DHT as the labeled ligand [39].From saturation curves of specifically bound [3H]DHT, plotted as a function of total [3H]DHT added, a concentration of ~ 6 nm [3H]DHT was determined to be sufficient to saturate the applied amount of SHBG which results in minimal nonspecific binding and economy in the use of [3H]DHT (Fig. S8). The dissociation constant (K
D) for DHT (mean ± SD) was determined to be 1.32 ± 0.10 nm for ursine SHBG and 0.21 ± 0.04 nm for human SHBG, from triplicate Scatchard plot analysis, as the negative reciprocal of the slope (Fig. 10A). Thus, recombinant ursine SHBG bound DHT with a 6.4‐fold lower affinity than human SHBG. A single analysis on a second SHBG batch demonstrated very similar affinities (Fig. 10B). The determined K
D value for recombinant human SHBG (0.21 ± 0.04 nm) is in fair agreement to that previously reported for human serum SHBG (0.4 nm) [40].
Fig. 10
Scatchard analysis of DHT binding to SHBG. Scatchard analysis used to determine the steroid‐binding affinity of purified recombinant ursine SHBG (uSHBG) to [3H]DHT compared to human SHBG (hSHBG). (A) The analysis was performed in three technical replicates for the first recombinant SHBG batch and (B) once for the replicate on a second SHBG batch. The dissociation constant (K
D) was determined as the negative reciprocal of the slope of the linear regression.
Scatchard analysis of DHT binding to SHBG. Scatchard analysis used to determine the steroid‐binding affinity of purified recombinant ursine SHBG (uSHBG) to [3H]DHT compared to human SHBG (hSHBG). (A) The analysis was performed in three technical replicates for the first recombinant SHBG batch and (B) once for the replicate on a second SHBG batch. The dissociation constant (K
D) was determined as the negative reciprocal of the slope of the linear regression.Next, the SHBG binding affinities for 3β‐androstanediol, testosterone, androstenediol, and estradiol were assessed using [3H]DHT as the labeled ligand in a conventional competitive steroid‐binding assay. Half maximal inhibitory concentrations (IC50), that is, the steroid concentration able to outcompete 50% of the bound [3H]DHT, were used to determine the relative binding affinities (RBA) to DHT (Table 3). The RBA values were similar between human and ursine SHBG for these steroids, meaning that their binding affinities to ursine SHBG are also 6‐fold lower compared to human SHBG, except for 3β‐androstanediol where ursine SHBG demonstrated a slightly but significantly higher relative affinity. In addition, the RBA of both human and ursine SHBG for dehydroepiandrosterone, androstenedione, progesterone, deoxycorticosterone, 11‐deoxycortisol, and corticosterone were determined to be < 1% of the DHT affinity (data not shown). The IC50 values for SHBG ligands that effectively displaced DHT from the binding site (i.e., RBA > 1%) were then used to deduce their affinities (K
D values) for SHBG by using the Cheng–Prusoff equation (Table 3) [41].
Table 3
Half maximal inhibitory concentrations, relative binding affinities, and dissociation constants. Half maximal inhibitory concentrations (IC50) of [3H]DHT binding to SHBG of different steroids. Relative binding affinities to DHT and dissociation constants (KD) were calculated from the IC50 values.
IC50
Mean ± SD
RBA (DHT = 100%)
Mean ± SD
P‐value (t‐test)
KD (nm)
Mean ± SD
Human SHBG
Ursine SHBG
Human SHBG
Ursine SHBG
Human SHBG
Ursine SHBG
DHT
5.00 ± 1.10
6.14 ± 0.77
100
100
–
0.17 ± 0.03
1.18 ± 0.13
3β‐androstanediol
10.02 ± 1.83
8.83 ± 0.81
45.42 ± 8.06
66.51 ± 2.20
0.04
0.34 ± 0.04
1.78 ± 0.16
Testosterone
24.35 ± 5.32
34.48 ± 1.90
21.50 ± 0.27
18.52 ± 1.66
0.09
0.83 ± 0.16
6.41 ± 0.43
Androstenediol
57.55 ± 4.87
68.75 ± 3.78
8.40 ± 1.53
8.72 ± 0.38
0.76
1.88 ± 0.23
13.33 ± 0.44
Estradiol
110.04 ± 17.13
145.48 ± 23.57
4.71 ± 0.42
4.41 ± 0.10
0.34
3.63 ± 0.55
27.06 ± 4.52
Half maximal inhibitory concentrations, relative binding affinities, and dissociation constants. Half maximal inhibitory concentrations (IC50) of [3H]DHT binding to SHBG of different steroids. Relative binding affinities to DHT and dissociation constants (KD) were calculated from the IC50 values.IC50Mean ± SDRBA (DHT = 100%)Mean ± SDKD (nm)Mean ± SDOur in silico analyses of ursine SHBG showed that some of the residues involved in steroid binding differ from those of human SHBG and that substitutions occur within the steroid‐binding pocket (Fig. 1). This could explain the lower steroid‐binding affinity of ursine when compared to human SHBG. Specific amino acid substitutions, identical to those found in the ursine SHBG steroid‐binding pocket, have previously been introduced into human SHBG to determine how particular residues contribute to steroid binding. Introduction of a M107I substitution in human SHBG lowered the DHT‐binding affinity about 4‐fold with the estradiol‐binding affinity being relatively unchanged [42]. Human SHBG with a M139V substitution displayed a 2‐ to 3‐fold reduced affinity for DHT [38]. Since the affinity of ursine SHBG is ~ 6‐fold lower than human SHBG, we believe that both the M107I and the M139V substitutions contribute to this lowered affinity.Apart from Old World primates, lower steroid affinity, relative to human SHBG, is a common feature of SHBG in other mammals, including dogs (K
D = 7.1 nm [40]) and hyenas (K
D = 1.40–1.95 nm [38]), which are both phylogenetically closer to bears than humans. However, the SHBG affinity for the different sex steroids relative to each other, namely DHT > testosterone > estradiol, is conserved between ursine and human SHBG, as in other species [31, 43], which suggests that SHBG functions similarly across mammalian species.
Zinc binding does not affect estradiol affinity of ursine SHBG
The relative binding affinity of human and ursine SHBG for estradiol was assessed in the presence and absence of Zn2+. It has previously been shown that Zn2+ coordination has little or no effect on the affinity of human SHBG for androgens [30], and we do therefore not expect the addition of Zn2+ to affect the binding of [3H]DHT notably. The presence of 1 mm Zn2+ inhibited the ability of estradiol to outcompete [3H]DHT binding to human SHBG, while Zn2+ had no effect on the affinity of estradiol toward ursine SHBG (Table 4). Thus, the two ursine His to Gln substitutions in the Zn2+ coordination site located at the entrance to the steroid‐binding pocket eliminates the Zn2+‐induced reduction in affinity for estradiol observed in human SHBG [26]. The same substitution of the His136 residue has also previously been reported to disrupt the Zn2+‐binding site in human SHBG [30, 44]. The physiological function of the Zn2+‐induced reduction in estradiol affinity of human SHBG is not clear, but has been suggested to regulate the availability of sex steroids in Zn2+‐rich tissues, such as the prostate and other male reproductive organs [44]. Based on our results, we conclude that Zn2+ does not influence steroid binding of SHBG in bears, as seems to be the case in other mammals apart from humans, since residues within the loop segment covering the steroid‐binding pocket are poorly conserved between species, including those critically involved in the binding of Zn2+ in this location [30].
Table 4
Test of Zn2+‐induced reduction in estradiol affinity. The effect of supplementation of 1 mm Zn2+ on the affinity of estradiol and thus estradiol’s ability to outcompete [3H]DHT from the steroid‐binding site of SHBG. Estradiol was added in an amount corresponding approximately to the IC50 value in the absence of Zn2+, that is, the amount capable of outcompeting 50% of [3H]DHT.
Zn2+
Bound [3H]DHT (%)
Human SHBG
Ursine SHBG
0 mm
57.42
40.47
1 mm
90.17
38.63
Test of Zn2+‐induced reduction in estradiol affinity. The effect of supplementation of 1 mm Zn2+ on the affinity of estradiol and thus estradiol’s ability to outcompete [3H]DHT from the steroid‐binding site of SHBG. Estradiol was added in an amount corresponding approximately to the IC50 value in the absence of Zn2+, that is, the amount capable of outcompeting 50% of [3H]DHT.
Our characterization of ursine SHBG will contribute to elucidate the role of SHBG during hibernation in bears
In conclusion, we established an insect cell‐based expression system for recombinant full‐length ursine and human SHBG. This cell system was able to produce dimeric and active full‐length ursine and human SHBG. Apart from a 6‐fold lower steroid affinity, ursine SHBG had similar characteristics to human SHBG, namely being a homodimeric glycoprotein capable of binding steroids with high affinity. Therefore, ursine SHBG likely has similar biological functions as known for human SHBG.The previous observation of increased SHBG levels in brown bears during hibernation suggests that tight regulation of sex steroid activity is physiologically important [5]. To further delineate the importance of SHBG in bear hibernation, the plasma concentration of SHBG during hibernation and active state should be determined together with the sex steroid concentrations. These data, together with our determined K
D of SHBG for various sex steroids, would allow calculation of the free steroid levels. Such information could help determine if sex steroid activity is an important regulatory component of hibernation physiology or if SHBG has other important steroid‐free functions.Further elucidation of the protective mechanisms that underlie the bears’ outstanding ability to avoid complications related to immobility and obesity, including the potential involvement of SHBG, may be a stepping‐stone to facilitate the development of new human clinical therapies.
Experimental procedures
Homology model of ursine SHBG
A homology model of the ursine SHBG N‐terminal LG domain (PMDB: PM0084113) was generated in the SWISS‐MODEL workspace [45] and visualized in pymol [46]. The model was based on the crystal structure of the N‐terminal LG domain of human SHBG in complex with DHT (PDB: 1D2S) [22]. It should be emphasized that the model of the ursine SHBG N‐terminal LG domain does not take energy optimization into account and thus only illustrates the overall structure.
Expression of recombinant SHBG
Liver tissue from a euthanized brown bear was kindly provided by Orsa Rovdjurspark, Sweden. Ethics approval was not required for this study, since no live animals were used, and since euthanasia of the surplus animal was independently decided by Orsa Rovdjurspark. The liver tissue was homogenized by freeze drying followed by bead‐beating and the RNA extracted by using the NucleoSpin® RNA kit (MACHEREY‐NAGEL GmbH & Co. KG, Düren, Germany). Ursine and human native SHBG cDNA was generated and amplified by reverse transcription followed by PCR using the ursine RNA and MVP human liver total RNA (Agilent Technologies, Inc., Santa Clara, CA, USA) as template and the primers listed in Table S1. The cDNA was cloned into a pFastBac™ Dual (pFBD) plasmid (Gibco™, Invitrogen Life Technologies, Carlsbad, CA, USA) downstream to the polyhedrin promoter with a C‐terminal FLAG‐tag incorporated. The native signal peptide of human and ursine SHBG was substituted with that of honeybee melittin (MKFLVNVALVFMVVYISYIYAAPEP) and for ursine SHBG also with that of human SHBG (MESRGPLATSRLLLLLLLLLLRHTRQGWA) by PCR using the pFBD plasmids as templates, whereafter the SHBG constructs were cloned into pFBD as above. The pFBD plasmids were transformed into MAX Efficiency® DH10Bac™ Competent E. coli cells (Gibco™, Invitrogen Life Technologies) for site‐specific transposition of SHBG into the bacmid vector according to the method described in the user manual ‘Bac‐to‐Bac® Baculovirus Expression System’ (version D, 6 April 2004, 10359) from Invitrogen™ (Life Technologies, Carlsbad, CA, USA). Correct transposition of the SHBG constructs into the bacmids was verified by sequencing.The insect cell line ExpiSf9™ (Gibco™, Invitrogen Life Technologies) was transfected and cultivated according to the manufacturer’s instructions (‘ExpiSf™ Expression System’, Publication Number MAN0017532, Revision A.0). Briefly, ExpiSf9™ cells were cultured in ExpiSf CD medium (Gibco™, Invitrogen Life Technologies) supplemented with 1% PenStrep (100 units·mL−1 penicillin, 100 g·mL−1 streptomycin) (Gibco™, Invitrogen Life Technologies) at 27 °C with normal atmosphere and 95 rpm orbital shaking (50‐mm shaking diameter). The ExpiSf9™ cells were transfected with the bacmid DNA with use of ExpiFectamine™ Sf Transfection Reagent (Gibco™, Invitrogen Life Technologies) to generate recombinant baculovirus which was further amplified and harvested when the viability dropped to 60–80%. The baculoviral titer was determined by a flow cytometric tittering assay using the Baculovirus Envelope gp64 Monoclonal Antibody (AcV1), PE, eBioscience™ (Invitrogen™, Life Technologies). Only viral stocks with titers ≥ 1 × 108 ivp·mL−1 were applied for protein expression. For protein expression, ExpiSf cells were seeded on the day before infection to a final density of 5 × 106 viable cells·mL−1 in fresh ExpiSf™ CD Medium and added ExpiSf™ Enhancer (Gibco™, Invitrogen Life Technologies). After 18–24 h, the cells were infected with a multiplicity of infection ≥ 5. The expression medium was harvested 72 h postinfection where cells were removed by centrifugation at 500 rcf for 15 min (RT) and remaining cell debris by centrifuging at 18 600
for 30 min (4 °C). 1 mm CaCl2 and 0.02% sodium azide were added to stabilize the protein and prevent microbial growth.
Protein purification
Ursine and human SHBG with native signal peptide was purified from 1 L cultures by anti‐FLAG affinity chromatography and anion exchange chromatography.1 mL (settled) equilibrated Pierce™ Anti‐DYKDDDDK Affinity Resin (Pierce Biotechnology, Inc., Thermo Fisher Scientific, Rockford, IL, USA) was added per liter expression medium and incubated overnight on a roller mixer at 4 °C. The resin was collected from the expression medium by centrifugation at 1000
for 5 min and thereafter transferred to an empty gravity flow column. The resin was washed with 100 mL binding buffer (50 mm Tris‐HCl, 150 mm NaCl, 2.5 mm CaCl2, pH 7.5). Twice during the wash step, the column was plugged and capped, and the column mixed over end with buffer, before eluting.FLAG‐tagged SHBG was eluted from the resin by 30 min incubation with 2 mL FLAG elution buffer [binding buffer supplemented with 100 μg·mL−1 FLAG® Peptide (Sigma‐Aldrich, Saint Louis, MO, USA)] in the capped column at 4 °C with over end mixing. The elution step was repeated with 15 min incubation. Remaining unbound SHBG was eluted with 2 × 2 mL binding buffer.The anti‐FLAG purified SHBG was additionally purified by anion exchange. The pooled sample was mixed with two volumes of dilution buffer (50 mm Tris‐HCl, 2.5 mm CaCl2, pH 7.5), to lower the salt concentration, and loaded on a Mono Q HR 5/5 column (Pharmacia Biotech, Uppsala, Sweden) pre‐equilibrated in buffer A (50 mm Tris‐HCl, 2.5 mm CaCl2, 50 mm NaCl, pH 7.5). The column was washed with 10 column volumes of buffer A, whereafter proteins were eluted by applying a linear salt gradient from 0% to 100% buffer B (50 mm Tris‐HCl, pH 7.5, 500 mm NaCl, 2.5 mm CaCl2) over 50 column volumes at a flow rate of 0.5 mL·min−1. 1 mL fractions were collected and those containing SHBG were combined.The identity, purity, and integrity of the SHBG proteins were confirmed by SDS/PAGE, western blotting, and MALDI‐ToF MS. The purified protein yield from three independent culture batches was determined using absorption at 280 nm (extinction coefficients for the recombinant ursine and human SHBG are 47230 M−1·cm−1 and 58230 M−1·cm−1, respectively).
Test expression of recombinant SHBG in ExpiSf cells supplemented with DHT
Test expressions were performed in 4 mL suspension cultures in 6‐well plates (CELLSTAR®, Greiner Bio‐One GmbH, Kremsmünster, Austria). ExpiSf cells were seeded, infected, and harvested as previously described, except that DHT dissolved in absolute ethanol was supplemented to the cultures at the time of infection, resulting in final DHT concentrations of 0 and 10 µm, and an ethanol concentration of 1% in the cultures (ethanol in this concentration did not affect the morphology of the cells).
Western blot analysis
The proteins were blotted from an SDS/PAGE (4–20%, except for native PAGE where a 10% gel was applied) onto a nitrocellulose membrane using a Trans‐Blot® Turbo™ Transfer System (Bio‐Rad Laboratories, Singapore).Recombinant SHBG were immunostained using 10 µg·mL−1 murine monoclonal primary antibody to anti‐FLAG® M2 (Eastman Kodak Company, New Haven, CT, USA) and 0.2 µg·mL−1 Alexa Fluor® 546 donkey anti‐mouse IgG (H + L) secondary antibody (Invitrogen™, Life Technologies). The Alexa 546 fluorophore was detected with λex/λem 520−545/577–613 nm, while the bands of the molecular weight marker were visualized with λex/λem 625−650/675–725 nm. Protein band intensities on the western‐blotted membranes were quantified using the imagej 1.52a software [47].For comparison of intracellular and extracellular SHBG, cells and expression medium were separated by centrifugation at 300
for 10 min, and the cells were resuspended in PBS corresponding to the original volume. Equal volumes of intra‐ and extracellular samples were loaded on the gel.For immunostaining of recombinant SHBG in a native western blot, affinity purified rabbit anti‐SHBG LG4 primary antibody (provided by Geoffrey Hammond, The University of British Columbia) and Goat anti‐rabbit IgG (H + L), HRP secondary antibody (Invitrogen™, Life Technologies) was applied and detected by Amersham ECL Prime Western Blotting Detection Reagent (GE Healthcare, Buckinghamshire, UK).
MALDI‐ToF MS
Sample preparation for digested SHBG
Tryptically digested SHBG was analyzed at both reducing and nonreducing conditions and chymotryptically digested SHBG at reducing conditions.Purified SHBG was mixed 1 : 1 (v/v) with digestion buffer [2% (w/v) sodium deoxycholate in 100 mm triethylammonium bicarbonate] and incubated 10 min at 99 °C. For the samples to be reduced, tris(2‐carboxyethyl)phosphine was added in a 1 : 25 (w/w) reagent‐to‐protein ratio after cooling below 37 °C and incubated 30 min at 37 °C, whereafter iodoacetamide was added in a 1 : 10 (w/w) ratio and the sample incubated for 20 min at 37 °C in the dark. Trypsin or chymotrypsin was added in a 1 : 50 (w/w) ratio and the samples incubated overnight at 37 °C.To precipitate sodium deoxycholate, formic acid was added to a concentration of 2.0% and the sample incubated at room temperature for 5 min. The samples were then centrifuged at 13 000
for 20 min at 4 °C. The supernatant was desalted in a column with a C18 disc (Empore™, Oxford, PA, USA) and R2 and R3 Poros beads (Applied Biosystems, Foster City, CA, USA) and eluted with 10 µL 80% acetonitrile and 0.1% formic acid.A total of 0.5 μL desalted protein [or peptide standard II (Bruker Daltonik, Bremen, Germany)] was deposited on an AnchorChip™ MALDI target plate followed by 0.5 μL DHB matrix (Thermo Fisher) (40 mg·mL−1 DHB in 80% acetonitrile and 0.1% formic acid).
Sample preparation for intact SHBG
The method applied is described by Signor and Erba [48].Purified SHBG was desalted in a column with a C8 disc (Empore™) and R2 and R3 reversed phase resin and eluted with 10 µL 80% acetonitrile and 0.1% formic acid. A small amount of saturated α‐CHCA acetone solution (Thermo Fisher) was deposited on an AnchorChip™ MALDI target plate to form a matrix thin layer. 0.5 μL desalted protein [or protein standard II (Bruker Daltonik)] was deposited on the α‐CHCA thin layer followed by 0.5 μL matrix solution: α‐CHCA [20 mg·mL−1 in ACN and 5% formic acid (70 : 30, v/v)] mixed in a 1 : 1 ratio (v/v) with DHB [20 mg·mL−1 in ACN and 0.1% trifluoroacetic acid (TFA) (70 : 30, v/v)].MALDI‐ToF MS was performed using a Bruker Daltonics autoFlex TOF/TOF MALDI‐ToF instrument. Spectra were obtained in positive reflector mode for peptides and in positive linear mode for intact protein.
Size exclusion chromatography with multiangle light scattering analysis
SEC‐MALS was used to evaluate the molecular masses of SHBG. SEC measurements were performed on an Agilent 1260 Infinity HPLC system in‐line with a WYATT 30S5 guard column and a WYATT 30S5 SEC column. A MALS detector DAWN HELEOS 8 (Wyatt Technology, Santa Barbara, CA, USA) was used to obtain protein molecular mass and the refractometer Optilab T‐rEX (Wyatt Technology) to measure the refractive index (dRI). The system was equilibrated overnight in 20 mm Tris‐HCl, 150 mm NaCl, 1 mm CaCl2, 1 μm DHT, pH 8.0 (0.22 μm filtered and sonicated). For the ursine measurements, 250 mm NaCl was applied to prevent the protein from sticking to each other. 100 μL sample was injected (~ 10 μg SHBG) and BSA (2 mg·mL−1) was used for calibration. The flow rate was 0.5 mL·min−1. Data analysis was performed using the astra® software (Wyatt Technology).
Thermal unfolding profiles
Five hundred nanomolar purified ursine and human SHBG was equilibrated with 0 or 50 μm DHT in triplicates. Thermal unfolding profiles from 20.0 to 95.0 °C and a temperature increase of 1.0 °C·min−1 were measured on a Prometheus NT.48 system (NanoTemper Technologies, München, Germany) using high‐sensitivity capillaries. The unfolding temperatures were determined as the peak maximum of the first derivative of the fluorescent ratio 350 nm/330 nm as a function of the temperature.
Steroid binding assays
The binding affinities and relative binding affinities (RBA) of ursine and human SHBG were measured by steroid ligand saturation analysis according to the method by Hammond and Lähteenmäki [39].The optimal dextran‐coated charcoal (DCC) exposure time was determined to 10 min by time‐course experiments, which ensured efficient adsorption of the majority of the nonbound [1,2‐3H]5α‐dihydrotestosterone ([3H]DHT) (specific activity 60 Ci·mmol−1, American Radiolabelled Chemicals) with minimal dissociation of bound complex (Fig. S9A). The percentage dissociation of bound complex during the 10 min DCC exposure was determined by extrapolation of the counts from specifically bound [3H]DHT to SHBG to zero time and used to calculate the dissociation rate of the complex (Fig. S9B,C). After 10‐min DCC exposure, approximately 23% of the ursine SHBG‐DHT complex and 6% of the human SHBG‐DHT complex had irreversibly dissociated. Consequently, a correction factor of 1.23 for ursine SHBG and 1.06 for human SHBG was applied in the calculations of SHBG binding capacity to account for dissociation during the DCC treatment.
Determination of SHBG‐binding affinities to DHT
The steroid‐binding affinities of purified recombinant ursine and human SHBG to [3H]DHT were determined by equilibration with [3H]DHT in 7‐step twofold dilutions in the presence or absence of 100‐fold molar excess of unlabeled DHT (Steraloids, Inc., Newport, RI, USA) and removal of unbound steroid by 10‐min DCC exposure. For Scatchard analysis, bound steroid over free steroid was plotted as a function of bound steroid. The free steroid count is calculated by subtracting bound steroid count from the total [3H]DHT count added. Linear regression analysis was performed to obtain the dissociation constant (K
D), corresponding to the negative reciprocal of the slope.
Determination of relative binding affinities
The RBAs were determined in a competitive steroid‐binding assay, by saturating SHBG with [3H]DHT (approximately 6 nm) and adding increasing amounts of the following unlabeled steroid competitors: estradiol, testosterone, androstenediol, 3β‐androstanediol, dehydroepiandrosterone (Aldrich Chemical Company, Inc., Milwaukee, WI, USA), androstenedione (Sigma Chemical Co., St. Louis, MO, USA), progesterone, 11‐deoxycorticosterone, 11‐deoxycortisol, and corticosterone. Additionally, the RBA for estradiol was assessed in the presence and absence of 1 mm Zn2+. Steroids were purchased from Steraloids, Inc., unless stated otherwise. RBA were calculated in percentage from the IC50 values, that is, the concentrations of steroid that result in 50% displacement of the bound [3H]DHT relative to the concentration required of unlabeled DHT.K
D values of the steroids were calculated from the IC50 values, according to the Cheng–Prusoff equation [41]:
Conflict of interest
The authors declare no conflict of interest.
Author contributions
AMF wrote the first manuscript draft. AMF, PR, GLH, MB, and MTO designed the experiments. AMF, JNCT, and PR performed the experimental work and data analysis. AMF, MB, GLH, and MTO were in charge of data interpretation. MB, GLH, OF, and MTO revised the manuscript. All authors read and approved the final manuscript.Fig. S1. Effect of DHT supplementation on the SHBG yield.Fig. S2. Sequence coverage of SHBG in MALDI‐ToF MS.Fig. S3. Identification of the signal peptide cleavage site of ursine SHBG.Fig. S4. Identification of disulfide bond in human SHBG.Fig. S5. Native western blot of SHBG.Fig. S6. Chromatograms from SEC‐MALS.Fig. S7. Determination of SHBG molecular mass by MALDI‐ToF MS.Fig. S8. Saturation curve of DHT binding to SHBG.Fig. S9. Time‐course experiments during DCC exposure.Table S1. Primer sequences used for cloning.Click here for additional data file.
Authors: P H Petra; F Z Stanczyk; D F Senear; P C Namkung; M J Novy; J B Ross; E Turner; J A Brown Journal: J Steroid Biochem Date: 1983-07 Impact factor: 4.292
Authors: J Hilpert; H Vorum; R Burmeister; R Spoelgen; I Grishkovskaya; R Misselwitz; A Nykjaer; T E Willnow Journal: Biochem J Date: 2001-12-15 Impact factor: 3.857
Authors: Anne Mette Frøbert; Malene Brohus; Julia N C Toews; Phillip Round; Ole Fröbert; Geoffrey L Hammond; Michael T Overgaard Journal: FEBS Open Bio Date: 2021-12-13 Impact factor: 2.792