Literature DB >> 33676968

Antiviral peptides against Coronaviridae family: A review.

Hamid Heydari1, Reza Golmohammadi2, Reza Mirnejad3, Hamid Tebyanian4, Mahdi Fasihi-Ramandi1, Mehrdad Moosazadeh Moghaddam5.   

Abstract

The Coronaviridae family comprises large enveloped single-stranded RNA viruses. The known human-infecting coronaviruses; severe acute respiratory syndrome coronavirus (SARS-CoV), Middle East respiratory syndrome coronavirus (MERS-CoV), novel SARS-CoV-2, human coronavirus (HCoV)-NL63, HCoV-229E, HCoV-OC43 and HKU1 cause mild to severe respiratory infections. The viral diseases induced by mammalian and avian viruses from Coronaviridae family pose significant economic and public health burdens. Due to increasing reports of viral resistance, co-infections and the emergence of viral epidemics such as COVID-19, available antiviral drugs show low or no efficacy, and the production of new treatments or vaccines are also challenging. Therefore, demand for the development of novel antivirals has considerably increased. In recent years, antiviral peptides have generated increasing interest as they are from natural and computational sources, are highly specific and effective, and possess the broad-spectrum activity with minimum side effects. Here, we have made an effort to compile and review the antiviral peptides with activity against Coronaviridae family viruses. They were divided into different categories according to their action mechanisms, including binding/attachment inhibitors, fusion and entry inhibitors, viral enzyme inhibitors, replication inhibitors and the peptides with direct and indirect effects on the viruses. Reported studies suggest optimism with regard to the design and production of therapeutically promising antiviral drugs. This review aims to summarize data relating to antiviral peptides particularly with respect to their applicability for development as novel treatments.
Copyright © 2021 Elsevier Inc. All rights reserved.

Entities:  

Keywords:  Antiviral peptide; Coronaviridae family; Inhibitory mechanisms

Mesh:

Substances:

Year:  2021        PMID: 33676968      PMCID: PMC7931737          DOI: 10.1016/j.peptides.2021.170526

Source DB:  PubMed          Journal:  Peptides        ISSN: 0196-9781            Impact factor:   3.867


Introduction

The Coronaviridae family comprises large enveloped single-stranded RNA viruses with genomes ranging from 25 to 32 kb. The International Committee on Taxonomy of Viruses (ICTV) divided this family into Orthocoronavirinae and Letovirinae sub-families and according to phylogenetic relationships Orthocoronavirinae consists of four genera including Alphacoronavirus, Betacoronavirus, Gammacoronavirus and Deltacoronavirus [1,2]. The alphacoronaviruses and betacoronaviruses infect mammals and usually cause respiratory disease in humans and gastroenteritis in animals. The gammacoronaviruses and deltacoronaviruses infect avian species; however, some of them have also been found in mammalian hosts [3,4]. The known human-infecting coronaviruses, severe acute respiratory syndrome coronavirus (SARS-CoV), Middle East respiratory syndrome coronavirus (MERS-CoV) and novel SARS-CoV-2 responsible for the coronavirus disease 2019 (COVID-19) that cause severe lower respiratory tract infections with extra-pulmonary involvements are from betacoronavirus. The other human coronaviruses (HCoV-NL63, HCoV-229E, HCoV-OC43 and HKU1) which induce mild to severe respiratory tract illness belong to the alphacoronavirus and betacoronavirus genera [2,4]. Furthermore, the viral diseases caused by other members of Coronaviridae family pose significant economic and public health burdens. These viruses include porcine enteric diarrhea virus (PEDV), porcine transmissible gastroenteritis virus (TGEV), porcine hemagglutinating encephalomyelitis virus (PHEV), infectious bronchitis virus (IBV), feline infectious peritonitis virus (FIPV), Mouse hepatitis virus (MHV) and the recently emerged swine acute diarrhea syndrome coronavirus (SADS- CoV) [[5], [6], [7], [8], [9]]. Several potential drugs and vaccines against coronavirus infections have been reported in the literature [2,5,10]. However, these approaches are not effective against a broad range of viral infections. Moreover, due to increasing reports of viral resistances, co-infections, and the emergence of viral epidemics such as COVID-19, available antiviral drugs show low or no efficacy against several coronavirus infections and the production of new vaccines is also challenging and time consuming [11]. Therefore, demand for the development of novel antivirals has considerably increased that may serve as supplementary or alternative to the currently used drugs. Employing antimicrobial peptides is an alternative option to circumvent the issues mentioned earlier. The features that suggest them as potent candidates for pharmacological applications are their remarkable structural and functional diversity. The wide range of biological activities of antimicrobial peptides proposes that they could be incorporated in the treatment strategies against bacterial, viral, and fungal infections [[12], [13], [14], [15]]. Antiviral peptides have generated an increasing interest as a promising therapeutic in recent years. They have been obtained from natural, biological, and computational sources and are highly specific and effective in low concentrations and possess broad-spectrum activities with minimum side effects and host toxicity [16,17]. Here, we have made an effort to compile and review the antiviral peptides with activity against the viruses of Coronaviridae family and their mechanisms of action, which may help the researchers to design and produce novel antiviral drugs.

Characteristics and mechanisms of action of antiviral peptides

Antiviral peptides affect viruses by inhibiting the essential stages of their life cycle or components such as inhibition of attachment, fusion, host cell entry, intracellular viral replication and transcription, maturation, and viral enzymes. Direct interaction with virus particles and its effect on viral pathogenesis has also been reported by some antiviral peptides [[17], [18], [19]].

Antiviral peptides against human-infecting coronaviruses

Binding/attachment inhibitor peptides

The interaction of attachment proteins expressed on the virion surface with the host cell receptors is a vital initial step in the viral infections [20]. The viral genome of coronaviruses encodes spike (S), envelope (E), membrane (M), and nucleocapsid (N) structural proteins. The S protein has extracellular, transmembrane and intracellular domains, and also, the extracellular domain is divided into two subunits: S1 and S2. The S1 subunit includes the receptor-binding domain (RBD). The RBD comprises the N-terminal domain (NTD) and the C-terminal domain (CTD). SARS-CoV and SARS-CoV-2 bind to the angiotensin-converting enzyme 2 (ACE2) (abundant on the lung and small intestine cells surfaces), and MERS-CoV binds to proteinaceous dipeptidyl peptidase 4 (DPP4) (expressed on the lung and kidney cells surfaces) by CTD [21,22]. The S protein is an attractive target for the development of antiviral agents against CoVs. In a study conducted by Zheng et al., anti-SARS-CoV activity of two peptides (P2 and P6) was demonstrated using a cytopathic effect (CPE)-based assay. These peptides were designed and synthesized based on the variations of the S1 domain. They effectively protected cells from the CPEs and reduced viral titer compared to the untreated controls. Significant synergistic antiviral effects were also detected in the combination of two peptides. They suggested that P2 was not a competitive peptide for the ACE2 receptor binding but may hamper conformation changes of the binding site, and P6 binds to the S protein and interferes with the virus-cell interactions [23] (Fig. 1 A). In the other research, ACE2-derived peptides (peptides representing critical regions of ACE2) could block ACE2-S protein interaction and inhibit virus binding to the host cell. The evaluated peptides (P4, P5 and P6) exhibited a notable antiviral activity with the relative low 50 % inhibitory concentrations (IC50) [24]. The attachment blocker small peptides (SP-4, SP-8 and SP-10) were also synthesized in a previous study based on S protein's receptor-binding regions (Molecular weight ∼ 1.3–1.4 KDa). Their efficient inhibitory activity against S protein binding to the ACE2 was detected using the enzyme-linked immunosorbent assay (ELISA) method in Vero E6 cells [25].
Fig. 1

Model of SARS-CoV/ SARS-CoV-2 binding inhibition by S1 domain-based inhibitor peptides (A) and ACE2-derived inhibitor peptides (B).

Model of SARS-CoV/ SARS-CoV-2 binding inhibition by S1 domain-based inhibitor peptides (A) and ACE2-derived inhibitor peptides (B). Moreover, Chang et al. indicated that two synthetic peptides, GA91 and GA101 (corresponding to SARS-CoV Spike protein) block the binding of the SARS-CoV S protein to the host cells, using Vero E6 cells in adhesion assay [26]. In a different study, a hexapeptide, which was derived from RBD of the S protein, showed antiviral activity against SARS-CoV and HCoV-NL63. This peptide blocks the binding sites essential for the initial viral attachment to the respective receptor (Fig. 1A) and effectually inhibits CoVs replication in cell culture [27]. In the recent in-silico studies, the inhibitor peptides targeting the interaction between SARS-CoV-2 spike protein and ACE2 were designed using computational approaches [28,29]. Baig and colleagues have presented an ACE2-based peptide (18 aa peptide) that could block the viral attachment [28]. Furthermore, the S protein of SARS-CoV-2 was targeted by an inhibitor protein (ΔABP-D25Y) in Jaiswal et al., study. This protein includes two α-helical peptides which homologues to the ACE2 and also, its attachment to S protein is competitive [29] (Fig. 1B). Recent investigations showed that there are several potential heparin-binding sites located within the S1 domain of SARS-CoV-2. Heparin-binding peptides (HBPs) are capable of stopping SARS-CoV-2 infection. The interaction between HBPs and the S1 protein of SARS-CoV-2 was also described [30]. Another antimicrobial peptide with anti-SARS-CoV-2 activity is human defensin 5 (HD5). This alpha-defensin is secreted by intestinal Paneth cells and by neutrophils. It has high affinity to ACE2 and dramatically protects host cells from the adherence of the virus. HD5 is also capable of attaching SARS-CoV-2 S1 protein and affects its efficiency [31,32]. The characteristics of the antiviral peptides with binding inhibitory activity against human-infecting coronaviruses are expressed in Table 1 .
Table 1

The characteristics of the peptides with binding inhibitory activity against human-infecting coronaviruses.

Peptide nameSequencePeptide sourceTarget virusInhibitory concentrationCell lineRef.
P2PTTFMLKYDENGTITDAVDCS1 subunit of SARS-CoVSARS-CoV112.5 ± 26.3 μg/mL (IC50)Fetal rhesus kidney (FRhK-4) cells[23]
P6YQDVNCTDVSTAIHADQLTPS1 subunit of SARS-CoVSARS-CoV113.0 ± 27.6 μg/mL (IC50)Fetal rhesus kidney (FRhK-4) cells[23]
P4EEQAKTFLDKFNHEAEDLFYQSSACE2SARS-CoV50 μM (IC50)HeLa cells[24]
P5EEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEEACE2SARS-CoV6 μM (IC50)HeLa cells[24]
P6EEQAKTFLDKFNHEAEDLFYQSSGLGKGDFRACE2SARS-CoV0.1 μM (IC50)HeLa cells[24]
SP-4GFLYVYKGYQPIS protein of SARS-CoVSARS-CoV4.3 ± 2.18 nmol (IC50)[25]
SP-8FYTTTGIGYQPYS protein of SARS-CoVSARS-CoV6.99 ± 0.71 nmol (IC50)[25]
SP-10STSQKSIVAYTMS protein of SARS-CoVSARS-CoV1.88 ± 0.52 nmol (IC50)Vero E6 cells[25]
GA91S protein of SARS-CoVSARS-CoVVero E6 cells[26]
GA101S protein of SARS-CoVSARS-CoVVero E6 cells[26]
BD-11bYKYRYLS protein of SARS-CoVSARS-CoV14 mM (IC90)Vero E6 cells[27]
BD-11bYKYRYLS proteinHCoV- NL637 mM (IC90)CaCo2 cells[27]
18 aa peptideFLDKFNHEAEDLFYQSSLACE2SARS-CoV-2[28]
ΔABP-D25YGSHMGDAQDKLKYLVKQLERALRELKKSLDELERSLEELEKNPSEDALVENNRLNVENNKIIVEVLRIILELAKASAKLAACE2SARS-CoV-2[29]
P5 + 14GGGYSKAQKAQAKQAKQAQKAQKAQAKQAKQAQKAQKAQAKQAKQS1 subunit of SARS-CoV-2SARS-CoV-2[30]
Human Defensin-5Intestinal Paneth cells and neutrophilsSARS-CoV-210 μg/mLCaco-2 cells[31]
The characteristics of the peptides with binding inhibitory activity against human-infecting coronaviruses.

Fusion and entry inhibitor peptides

As mentioned above, the extracellular domain of S protein contains two subunits; S1 and S2. The S2 mediates the membrane fusion. It contains various motifs: fusion peptide (FP), heptad repeat 1 (HR1) and HR2 regions, transmembrane (TM) domain and the cytoplasmic tail. FP is the functional fusogenic component and triggers the fusion event through insertion into the cell membrane. The HR1 and HR2 form a six-helix bundle or fusion core, and this conformational rearrangement is essential for the viral fusion and entry. There are two viral entry pathways for CoVs: plasma membrane (early) pathway and endosomal (late) pathway. The protease availability determines the route of entry. In the presence of exogenous or host membrane-bound proteases, most notably the transmembrane protease/serine sub-family member 2 (TMPRSS2), the virus can fuse via the plasma membrane pathway. TMPRSS2, cleaves the S protein at the S2’ position which is located in upstream of the FP and activates plasma membrane fusion. Otherwise, the virus can fuse via an endosomal membrane pathway (clathrin- and non-clathrin-mediated endocytosis). Following endocytosis, the activated cysteine protease cathepsin L can cleave the S2’ site in acidic conditions and trigger the subsequent fusion steps and CoVs genome releasing [21,22]. In a study conducted by Liu et al., the anti-SARS-CoV activity of the synthesized peptides based on HR1 and HR2 regions of S protein was investigated. One peptide derived from HR2 (CP-1) had inhibitory activity against SARS-CoV by binding to the HR1 and interfering with the conformational rearrangement (six-helix bundle formation) viral fusion. A HR1- derived peptide (NP-1) showed a marginal antiviral activity [33]. The inhibitory activity against membrane fusion and viral entry has also been described by a peptide derived from the SARS-CoV S2 protein HR segments in another research [34]. Moreover, Zheng and colleagues synthesized the peptides based on the sequence of SARS-CoV S2 domain. Significant antiviral effects were observed for two peptides (P8 and P10) through binding to the S2 protein and preventing virion–cell membrane fusion. They significantly protected cells from CPEs and reduced viral titer in the culture media. The peptide P8 had the highest antiviral potency and no virus was detected after P8 treatment. Furthermore, peptide combinations significantly improved their antiviral effects [23]. In the Sainz Jr et al., study, the peptides' ability analogous to the S2 subunit to inhibit SARS-CoV plaque formation has also been described [35]. Anti-SARS-CoV properties of HR-based antiviral peptides have been reported in more researches [[36], [37], [38]]. Fig. 2 shows the anti-fusion activity of the HR2-based peptides model against coronaviruses.
Fig. 2

Schematic presentation of anti-fusion activity of HR2-based peptides against coronaviruses. A) Fusion core (six-helix bundle) formation through HR1 and HR2 rearrangement and thus membrane fusion. B) Blocking fusion core formation and membrane fusion by HR2-based peptides.

Schematic presentation of anti-fusion activity of HR2-based peptides against coronaviruses. A) Fusion core (six-helix bundle) formation through HR1 and HR2 rearrangement and thus membrane fusion. B) Blocking fusion core formation and membrane fusion by HR2-based peptides. Although, activities of various S2 domain-based peptides against SARS-CoV were mentioned from several studies, the antiviral peptides with different origin have been characterized in the literature. The Griffithsin (GRFT) as an antiviral protein was originally obtained from a red alga. It can bind to the SARS-CoV spike glycoprotein specifically and inhibits viral entry. It prevents SARS-CoV infection both in vitro and in vivo. GRFT’s activity against other human-infecting coronaviruses was also demonstrated [39]. Furthermore, a membrane fusion blocker peptide with basic amino acids in its composition was introduced by Zhao et al., in 2016. This mouse β-defensin-4 derived peptide (P9) efficiently attached to the SARS-CoV and MERS-CoV glycoproteins and entered the host cells with the viruses through endocytosis. P9 prevents endosomal acidification and thus, inhibits the subsequent fusion steps [40]. The inhibitory model of such peptides against coronaviruses is shown in Fig. 3 .
Fig. 3

Model of anti-fusion activity of alkaline peptides (peptides with basic amino acids) such as P9 and P9R against coronaviruses. This model depicts: A) Binding the virus with its receptor and endocytosis induction (1); Endocytosis (2); Endosome acidification, cathepsin L activation, fusion and viral genome release (3). B) Receptor binding and endocytosis induction in the presence of alkaline peptides (1); Endocytosis with attached alkaline peptides (2); Inhibition of endosome acidification, no cathepsin L activation and no fusion (3).

Model of anti-fusion activity of alkaline peptides (peptides with basic amino acids) such as P9 and P9R against coronaviruses. This model depicts: A) Binding the virus with its receptor and endocytosis induction (1); Endocytosis (2); Endosome acidification, cathepsin L activation, fusion and viral genome release (3). B) Receptor binding and endocytosis induction in the presence of alkaline peptides (1); Endocytosis with attached alkaline peptides (2); Inhibition of endosome acidification, no cathepsin L activation and no fusion (3). Several researches have also been performed regarding antiviral activity of HR regions-based peptides against MERS-CoV. In the Lu et al., study, a MESR-CoV HR2 analogous peptide (HR2P) was synthesized and its antiviral activity was investigated against this virus. The peptide could inhibit MERS-CoV fusion through interaction with the viral HR1 domain and heterologous six-helix bundle formation [41]. A similar result was presented in the study by Channappanavar et al. [42]. A fusion inhibitor named MERS-five-helix bundle (MERS-5HB) was synthetized by Sun et al. MERS-5HB was derived from the MERS six-helix bundle and consisted of three copies of HR1 and two copies of HR2. Lack of one HR2 in 5HB led to its interaction with a native HR2 of the MERS-CoV and the fusion step interruption [43]. As mentioned above, six-helix bundle (hexameric structure) formation by HR1 and HR2 is necessary for viral fusion and entry. Wang et al., have designed the hydrocarbon-stapled peptide and lipopeptide with a hydrocarbon tail in the two separate studies that could effectively block MERS-CoV formation hexameric structure [44,45]. The MERS-CoV fusion inhibitory peptides derived from HR2 domain of HKU4 (bat coronavirus) have also been reported. The HKU4-HR2Ps binds to HR1 of MERS-CoV with high stability and blocks the fusion process [46] (Fig. 2). Recently, a gold nanorod-based HR1 peptide (PIH-AuNRs) was proposed as MERS-CoV fusion inhibitor. The HR1 peptide inhibitor (PIH) derived from viral HR2 region was conjugated by potential biocompatible and site-specific carriers (AuNRs). This complex could completely inhibit MERS-CoV fusion [47]. In an in-silico study conducted by Ling et al., an antiviral peptide targeting SARS-CoV-2 fusion was described. They predicted the HR1 and HR2 regions in S protein of SARS-CoV-2 using sequence alignment and simulated forming of the fusion core. Then, they designed HR2-baseed peptide that can competitively bind with HR1 to inhibit viral fusion core forming [48]. Furthermore, Xia and colleagues utilized a lipopeptide (EK1C4) derived from a pan-coronavirus fusion inhibitor, EK1 (targeting the HR1 domain), against SARS-CoV-2. This lipopeptide displayed potent inhibitory activity against the virus [49]. More lipopeptides with anti-fusion activity against SARS-CoV-2 were reported in the recent studies. A SARS-CoV-2 HR2 sequence-based lipopeptide (IPB02) was highly potent fusion inhibitor of SARS-CoV-2 and SARS-CoV [50] (Fig. 2). In another study, similar peptide activity corresponding to the C-terminal HR domain of SARS-CoV-2 conjugated by tetra-ethylene glycol-cholesterol was demonstrated against SARS-CoV-2 and MERS-CoV. The spread of SARS-CoV-2 in human airway epithelial (HAE) cultures was also blocked using this lipopeptide [51]. One derivative of aforementioned lipopeptide ([SARSHRC-PEG4]2-chol) was able to block entry of SARS-CoV-2 in the host cells and the cells over-expressing the TMPRSS2 protease. Moreover, [SARSHRC-PEG4]2-chol intranasal administration to ferrets, completely protected the animals from SARS-CoV-2 infection [52]. Zhao et al., studied the alkaline peptide P9R (a defensin-like peptide) as an antiviral activity against pH-dependent viruses such as SARS-CoV, SARS-CoV-2 and MERS-CoV that require endosomal acidification for their infection development. P9R is the modified form of P9 (weakly positively charged amino acids substitution), which was mentioned above, and its antiviral mechanism was similar to P9 [53] (Fig. 3). Anti-SARS-CoV-2 fusion activity of the peptides derived from food proteins such as lactoferrin, have also been proposed recently through inhibition of cathepsin L [54]. The HR-based antiviral peptides against other human-infecting coronaviruses were suggested in the previous studies. The fusion inhibitor peptides targeting HCoV-229E via interaction with its six-helix bundle were characterized in a research. The peptides could efficiently inhibit CPEs of HCoV-229E infection in the host cells [55]. Meanwhile, the mentioned above pan-coronavirus fusion inhibitor (EK1) which was derived from HR2 domain of HCoV-OC43, possessed broad fusion inhibitory property against multiple human coronaviruses. This peptide and cholesterol-attached form exhibited effective inhibitory activities against HCoV-OC43, MERS-CoV, HCoV-229E and HCoV-NL63 [49,56] (Fig. 2). The characteristics of antiviral peptides with fusion or entry inhibitory activity against human-infecting coronaviruses are illustrated in Table 2 .
Table 2

The characteristics of the peptides with fusion or entry inhibitory activity against human-infecting coronaviruses.

Peptide nameSequencePeptide sourceTarget virusEffective / inhibitory concentrationCell line / animal modelRef.
CP-1GINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEHR2 region of SARS-CoVSARS-CoV19 μmol/L (IC50)Vero E6 cells[33]
NP-1GVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQHR1 region of SARS-CoVSARS-CoV50 μmol/L (IC50)Vero E6 cells[33]
SGINASVVNIQKEIDRLNEVAKNLNESLIDLQELHR segment of SARS-CoVSARS-CoV[34]
P8QYGSFCTQLNRALSGIAAEQS2 subunit of SARS-CoVSARS-CoV24.9 ± 6.2 μg/mL (IC90)Fetal rhesus kidney (FRhK-4) cells[23]
P10IQKEIDRLNEVAKNLNESLIHR2 region of SARS-CoVSARS-CoV73.5 ± 15.7 μg/mL (IC90)Fetal rhesus kidney (FRhK-4) cells[23]
SARSWW-IIIGYHLMSFPQAAPHGVVFLHVTWS2 subunit of SARS-CoVSARS-CoV∼ 2 μM (IC50)Vero E6 cells[35]
SARSWW-IVGVFVFNGTSWFITQRNFFSS2 subunit of SARS-CoVSARS-CoV∼ 2 μM (IC50)Vero E6 cells[35]
HR1-1NGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTAHR1 region of SARS-CoVSARS-CoV3.68 μM (EC50)Vero E6 cells[36]
HR2-18IQKEIDRLNEVAKNLNESLIDLQELGKHR2 region of SARS-CoVSARS-CoV5.22 μM (EC50)Vero E6 cells[36]
HR1-aYENQKQIANQFNKAISQIQESLTTTSTAS2 subunit of SARS-CoVSARS-CoV1.61 μM (EC50)Vero E6 cells[37]
GST-removed-HR2DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELS2 subunit of SARS-CoVSARS-CoV2.18 μM (EC50)Vero E6 cells[37]
HR2ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELS2 subunit of SARS-CoVSARS-CoV0.34 μM (EC50)Vero E6 cells[37]
SR9ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELHR2 region of SARS-CoVSARS-CoV<100 nM (EC50)Vero E6 cells[38]
GRFTSLTHRKFGGSGGSPFSGLSSIAVRSGSYLDAIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQYGriffithsia sp.SARS-CoV>100 μg/mL (IC50)Vero 76 cells / BALB/c mice[39]
P9NGAICWGPCPTAFRQIGNCGHFKVRCCKIRmouse β-defensin-4SARS and MERS-CoVs∼ 5 μg/mL (IC50)FRhK-4 and Vero-E6 cells / BALB/c mice[40]
25 μg/mL (IC90)
HR2PSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELHR2 region of MERS-CoVMERS-CoV0.6 μM (IC50)Calu-3 and Vero cells[41]
HR2P-M2SLTQINTTLLDLEYEMKKLEEVVKKLEESYIDLKELHR2 region of MERS-CoVMERS-CoV0.55 μmol/L (IC50)Vero 81 cells[42]
5HBHR1-SGGRGG-HR2-GGSGGSGG-HR1-SGGRGG-HR2-GGSGGSGG-HR1S2 subunit of MERS-CoVMERS-CoV1 μM (IC50)Huh-7 cells[43]
P21S10LDLTYEMLSLQQVV KLNEYS2 subunit of MERS-CoVMERS-CoV0.97–1.58 μM (EC50)Huh-7 and Calu-3 cells[44]
IIQIEEIQKKIEEIQKKIEEIQKKIEEIQKKIEEIQKK-β-alanine-KMERS-CoV0.13 μM (EC50)Huh-7 cells[45]
HKU4-HR2P2EISKINTTLLDLSDEMAMLQQEVVKQLNDSYIDLKELHR2 domain of bat coronavirus HKU4MERS-CoV0.34 μM (IC50)Huh-7 cells[46]
HKU4-HR2P3LDLSDEMAMLQQEVVKQLNDSYIDLKELGNYTYYNKWHR2 domain of bat coronavirus HKU4MERS-CoV0.48 μM (IC50)Huh-7 cells[46]
PIH-AuNRCGGGGGSLTEINTELLDLEYEMKKLEEVVKKLEESYIDLKEL-AuNRHR2 domain of MERS-CoVMERS-CoV0.117 μM (IC90)Huh-7 cells[47]
HR2-anti-PDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELHR2 domain of SARS-CoV-2SARS-CoV-2[48]
EK1C4SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL-PEG4-CholHR2 domain of HCoV-OC43SARS-CoV-236.5 nM (IC50)Vero E6 cells[49]
IPB02ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELK-CholHR2 domain of SARS-CoV-2SARS-CoV-2 and SARS-CoV0.08 and 0.251 μM (IC50)293 T cells[50]
DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQEL-GSGSGC-TEG-CholC-terminal HR domain of SARS-CoV-2SARS-CoV-2 and MERS-CoV∼ 6 and ∼3 nM (IC50)Vero E6 and human derived tracheo/bronchial epithelial cells[51]
[SARSHRC-PEG4]2-Chol[DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQEL-PEG4]2-CholC-terminal HR domain of SARS-CoV-2SARS-CoV-2∼ 300 and ∼ 5 nM (IC50)Vero E6 and Vero E6 cells overexpressing the protease TMPRSS2 / Ferrets[52]
P9RNGAICWGPCPTAFRQIGNCGRFRVRCCRIRMouse β-defensin-4 like peptideSARS-CoV-2, MERS-CoV and SARS-CoV0.9, 2.2 and 4.2 μg/mL (IC50)Vero E6 cells[53]
GRFTSLTHRKFGGSGGSPFSGLSSIAVRSGSYLDAIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQYGriffithsia sp.HCoV-OC43, HCoV-229E and HCoV-NL6352, >10 and 10 μg/mL (IC50)HCT-8, MRC-5, LLC-MK2 cells[39]
229E-HR1PAASFNKAMTNIVDAFTGVNDAITQTSQALQTVATALNKIQDVVNQQGNSLNHLTSQS2 subunit of HCoV-229EHCoV-229E13.2 μM (IC50)Huh-7 and A549 cells[55]
229E-HR2PVVEQYNQTILNLTSEISTLENKSAELNYTVQKLQTLIDNINSTLVDLKWLS2 subunit of HCoV-229EHCoV-229E1.96 μM (IC50)Huh-7 and A549 cells / Balb/c mice[55]
EK1SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELHR2 domain of HCoV-OC43HCoV-OC43, MERS-CoV, HCoV-229E and HCoV-NL630.62, 0.11, 0.69 and 0.48 μM (IC50)HCT-8, Calu-3, A549 and LLC-MK2 cells / Balb/c mice[56]
EK1C4SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL-PEG4-CholHR2 domain of HCoV-OC43MERS-CoV, HCoV-OC43, HCoV-229E and HCoV-NL634.2, 24.8, 101.5 and 187.6 nM (IC50)RD, Huh-7 and LLC-MK2 cells / Mice[49]

PEG, poly-ethylene glycol; Chol, cholesterol; TEG, tetra-ethylene glycol.

The characteristics of the peptides with fusion or entry inhibitory activity against human-infecting coronaviruses. PEG, poly-ethylene glycol; Chol, cholesterol; TEG, tetra-ethylene glycol.

Viral enzymes inhibitor peptides

The coronavirus enzymes' pivotal roles, including proteases, helicases, RNA-dependent RNA polymerase (RdRp), and methyltransferase, have been well characterized in the viral life cycle. Coronaviruses genome contains at least 6 open reading frames (ORFs). The ORF1ab encodes the overlapping polyproteins which are cleaved into non-structural proteins (nsps) by the main protease (Mpro or 3CLpro) and the papain-like protease (PLpro) [57]. Due to these cysteine proteases' critical role in viral gene expression and replication, they are favorable targets for the antiviral drug design. In the study conducted by Gan et al., the designed octapeptide inhibited the SARS-CoV Mpro and blocked replication of the virus [58]. Similarly, the synthetized dipeptides (6a and EP128533) and tetrapeptide inhibited several CoVs by inhibiting their Mpro [[59], [60], [61]]. In the previous studies, SARS-CoV Mpro inhibitory activities of the peptide-based compounds (tetrapeptide, pentapeptides and octapeptides) were also proposed without biological experiments [[62], [63], [64]]. A recent study indicated that, in-silico hydrolysis of marine fish proteins, gastrointestinal enzymes generated active peptides. Some of them were identified as high-affinity oligopeptides binder to the Mpro of SARS-CoV-2. According to their results, the identified oligopeptides could be used as potential SARS-CoV-2 inhibitor drugs [65]. In addition, blocking other enzyme of SARS-CoV (Methyltransferase) was demonstrated previously by the synthesized peptides. The nsp16 acts as a methyltransferase and plays an essential role in the life cycle of coronaviruses. The designed peptides could markedly inhibit the activity of methyltransferase and thus viral replication [66]. Table 3 shows the characteristics of antiviral peptides with potential inhibitory activity against coronaviruses enzymes.
Table 3

The characteristics of the peptides with potential inhibitory activity against coronaviruses enzymes.

Peptide nameSequencePeptide sourceTarget virusEffective / inhibitory concentrationCell lineRef.
OctapeptideAVLQSGFRStructure of SARS-CoV MproSARS-CoV0.027 μg/mL (EC50)Vero cells[58]
6aLQQ-fmkCleavage site of SARS-CoV MproSARS-CoV2.5 μM (EC50)Vero cells[59]
EP128533SARS-CoV0.56−1.4 μg/mL (EC50)Vero-76 cells[60]
Protected tetrapeptideCbz-AVLQCleavage site of the main proteasesSARS-CoV, HCoV-OC43, HCoV-229E, HCoV-NL63, HCoV-HKU1 and IBV1.3–4.6 μM (IC50)[61]
Pentapeptide aldehydesESTLQ, NSFSQ, DSFDQ and NSTSQAnalyses of the SARS-CoV MproSARS-CoV[63]
Tetrapeptide aldehydeTVFHAnalyses of the SARS-CoV 3CL proteaseSARS-CoV98 nM (IC50)[64]
OligopeptidesITTIM, TVPIY, ICIY, PASQF, IITAM, TIIF, AIPAW, IVPIL, PVIDL, TVPIY, ICIY, PISQF, EQIVY, VISAW and PESWMarine fish proteinsSARS-CoV-2[65]
K 12GGASCCLYCRCHSequence of nsp 10 of SARS-CoVSARS-CoV160 μM (IC50)[66]
K 29FGGASCCLYCRCHIDHPNPKGFCDLKGKYSequence of nsp 10 of SARS-CoVSARS-CoV160 μM (IC50)[66]

Fmk, fluoromethyl ketones; Cbz, carboxybenzyl.

The characteristics of the peptides with potential inhibitory activity against coronaviruses enzymes. Fmk, fluoromethyl ketones; Cbz, carboxybenzyl.

Viral replication inhibitor peptides

In the study performed by Lo et al., a synthesized peptide could inhibit replication of HCoV-229E in the host cells, significantly through the interference of the oligomerization of the viral nucleocapsid protein [67]. The application of such a strategy may assist the design and development of antiviral drugs against other human-infecting coronaviruses. Table 4 shows the characteristics of the viral replication inhibitor peptides.
Table 4

The characteristics of the viral replication inhibitor peptides.

Peptide nameSequencePeptide sourceTarget virusEffective / inhibitory concentrationCell line / animal modelRef.
C-terminal tail peptideNucleocapsid protein of HCoV-229EHCoV-229E300 μMA549 cells[67]
APB-13ILPWKWPWWPWRR-NH2CattleTGEV62.5 μg/mLST cells / Piglets[88]
viperinPorcine antiviral proteinPEDVIPEC-J2 cells[89]
The characteristics of the viral replication inhibitor peptides.

Direct interaction of antiviral peptides with virus particles

The virucidal activity of a confirmed antimicrobial peptide against SARS-CoV was reported in the Li et al., study. The infectivity of virus decreased significantly via direct interaction of the peptide (mucroporin-M1) with the virus envelope [68]. The characteristics of mucroporin-M1 are shown in Table 5 .
Table 5

The characteristics of the peptides with direct effect on virus particles.

Peptide nameSequencePeptide sourceTarget virusEffective / inhibitory concentrationCell lineRef.
Mucroporin-M1LFRLIKSLIKRLVSAFKScorpion venomSARS-CoV7.12 μMHela-ACE2 cells[68]
Caerin1.1GLLSV LGSVA KHVLP HVVPV IAEHL-NH2Skin of the Australian green tree frogPEDV10 μg/mLVero cells[90]
The characteristics of the peptides with direct effect on virus particles.

Effects of human antimicrobial peptides against coronaviruses pathogenesis

Indirect effects of human beta-defensin 2 (HBD 2) (an antimicrobial peptide produced by epithelial cells) against MERS-CoV were reported in the previous studies. HBD 2 enhanced primary antiviral innate immunity and effective adaptive immune responses [69,70]. Human cathelicidin (LL-37) also reduces the pathology of COVID-19 by affecting regulatory T cells. The probable role of LL-37 in the down-regulation of interleukin-17, which is involved in thrombosis and acute respiratory distress syndrome, was reported recently [71].

Antiviral peptides against mammalian and avian viral strains

The antiviral peptides with binding inhibitory activities against mammalian and avian viral strains have also been reported. The TGEV is a porcine coronavirus and the causative agent of transmissible gastroenteritis (TGE). TGE is a highly contagious enteric disease of swine with up to 100 % mortality in suckling piglets and causes economic losses. The S protein of the virus interacts with its cellular receptor, porcine aminopeptidase N (pAPN). Also, APN is a cellular receptor for HCoV-229E and FIPV [72]. Phages displaying peptide sequences with protective effects against TGEV infection, have been described in the literature. The findings of Ren et al., study showed three chemically synthesized peptides (F, H and S) that had sequence homologies (same motifs identified in the S protein of TGEV) were able to inhibit TGEV infection through competition with binding the pAPN [72]. Similarly, an antiviral peptide's potential inhibitory effect was observed using a phage bearing the peptide with affinity to pAPN [73]. Furthermore, the inhibitory activity of a membrane (M) protein-derived peptide was demonstrated in the other study. Peptide TGEV-M7 was able to significantly reduce the virus's ability to infect host cells [74]. Cao et al., indicated the antiviral activity of two peptides (L and W) against porcine epidemic diarrhea virus (PEDV). The PEDV is another swine pathogen that causes severe diarrhea and dehydration. These peptides share a consensus motif with S1 protein of PEDV and inhibit the binding of the virus to the host cells [75]. FIPV is a type of feline coronavirus (FCoV) and belongs to the alphacoronaviruses. It can cause lethal disease in cats due to multiple organs involvement. The S1 domain of FIPV S protein also contains the RBD. Doki et al., synthesized peptides based on the S1 domain sequence and investigated their inhibitory effects. Two peptides (I-S1-9 and I-S1-16) inhibited the binding and infectivity of FIPV significantly. Moreover, significant reduction of viral adsorption to cells was observed using peptide I-S1-9 [76]. IBV that belongs to gammacoronavirus, is the etiologic agent of complex and highly contagious respiratory disease in chickens which remains an economic problem. Bo et al., showed that a phage-displayed peptide blocks binding the IBV S protein and inhibits virus infectivity and CPE occurrence in HeLa cells [77]. The other studies indicated that swine intestine antimicrobial peptide (SIAMP) inhibits IBV replication and decreases tissue injury caused by the virus. Interaction of SIAMP with IBV and blocking the virus binding to the embryos' epithelial cells were reported as the probable inhibitory mechanisms of the peptide [78]. Table 6 shows the characteristics of the peptides inhibiting the mammalian and avian coronaviruses binding.
Table 6

The characteristics of binding inhibitor peptides of the mammalian and avian viruses.

Peptide nameSequencePeptide sourceTarget virusEffective concentrationCell lineRef.
FFKPSSPPSITLWS protein of TGEVTGEV20 μg/mLSwine testis (ST) cells[72]
HHVTTTFAPPPPRS protein of TGEVTGEV20 μg/mLST cells[72]
SSVVPSKATWGFAS protein of TGEVTGEV20 μg/mLST cells[72]
HDAISWTHYHPWpAPNTGEVST cells[73]
TGEV-M7HALTPIKYIPPGM protein of TGEVTGEV62.5 μg/mLST cells[74]
LLMQINPTYYQIMS1 protein of PEDVPEDV50 μg/mLVeroE6 cells[75]
WWSFNPSTYTIAGS1 protein of PEDVPEDV50 μg/mLVeroE6 cells[75]
I-S1-9YGFWTIAYTNYTDVMVDVNGS1 protein of FIPVFIPV100 μMFelis catus whole fetus-4 (fcwf-4) cells[76]
I-S1-16YHWMNVTLHVVLNDTEKKYDS1 protein of FIPVFIPV100 μMfcwf-4 cells[76]
Peptide 1GSHHRHVHSPFVIBV8.3 μg/mLHela cells[77]
SIAMPSwine intestineIBV100 μg/mLChick embryos[78]
The characteristics of binding inhibitor peptides of the mammalian and avian viruses. The fusion or entry blocker peptides against other viruses from Coronaviridae family have been investigated in the literature. Wang et al., indicated that surfactin can effectively inhibit TGEV from entering the host cells [79]. Surfactin is a cyclic lipopeptide secreted by Bacillus subtilis, affects both the viruses and the cells as a membrane fusion inhibitor [79,80]. Likewise, it could inhibit the fusion between the TGEV envelope and the host cell membrane in another study. Surfactin inhibited the replication of TGEV and PEDV completely, and its oral administration also protected piglets from PEDV infection [80]. In another study, anti-PEDV properties of synthetic surfactin analogues were investigated. The SLP5 as a linear lipopeptide had lower cytotoxicity and similar antiviral activity, compared to the surfactin [81]. The PEDV entry was also blocked by a phage-displayed peptide through binding to the S protein, in Meng et al., study [82]. Anti-fusion and entry activities of S2 domain-based peptides against PEDV, FIPV, MHV and IBV have been described in the previous researches [35,[83], [84], [85], [86]]. Moreover, the IBV infection in the host cells was inhibited by an antiviral peptide (As1) obtained from a medicinal plant. As1 binds to fusion and S protein of the virus and interferes with their function during IBV entry [87]. The characteristics of antiviral peptides with fusion or entry inhibitory activity against mammalian and avian viral strains are shown in Table 7 .
Table 7

The characteristics of the peptides with fusion or entry inhibitory activity against mammalian and avian viral strains.

Peptide nameSequencePeptide sourceTarget virusEffective / inhibitory concentrationCell line / animal modelRef.
SurfactinBacillus subtilisTGEV0.002 mg/mLIntestinal porcine epithelial cells (IPEC-J2)[79]
SurfactinBacillus subtilisTGEV and PEDV15−50 μg/mLST cells/ Piglet[80]
SLP 5Palmityl-EVLDLSurfactinPEDV16.5 ± 0.6 μg/mL (EC50)Vero cells[81]
HR2M, HR2L and HR2PHR2 domain of PEDVPEDV4.97, 2.96 and 1.11 μM (IC50)Huh-7 cells[83]
HHVTTTFAPPPPRPEDV1 μg/mL (EC50)Vero cells[82]
FP4FNATYLNLTGEIDDLEFRSEKLHNTTVELAILIDNINNTLVNLHR2 domain of FIPVFIPV1.8 μM (IC50)Fcwf-4 cells[84]
FP5FNATYLNLTGEIDDLEFRSEKLHNTTVELAILIDNINNTLVNL EWLNRIEHR2 domain of FIPVFIPV1.33 μM (IC50)Fcwf-4 cells[84]
MHVWW-IVGYFVQDDGEWKFTGSSYYYS2 subunit of MHVMHV5 μM (IC50)L2 cells[35]
HR2SLSLDFEKLNVTLLDLTYEMNRIQDAIKKLNESYINLKEHR2 region of MHVMHV50 μM (IC90)LR7 cells[86]
NOVEL-1NASDMEIKKVNKKIEEYIKKIEEVEKKLEEVNKKHR2 domain of NDV and IBVIBV∼5 μM (IC90)Chicken embryo fibroblast (CEFs) cells[85]
NOVEL-2VNKKIEEIDKKIEELNKKLEELEKKLEEVNKKHR2 domain of NDV and IBVIBV∼5 μM (IC90)CEFs cells[35]
Alstotide As1CRPYGYRCDGVINQCCDPYHCTPPLIGICLAlstonia scholaris plantIBV∼100 μMVero cells[87]
The characteristics of the peptides with fusion or entry inhibitory activity against mammalian and avian viral strains. In a recent study by Liang et al., indicated in vivo and in vitro anti-TGEV activities of Bovine antimicrobial peptide-13 (APB-13). The peptide had notable inhibitory effect on the expression of nucleocapsid protein of TGEV. Furthermore, viral shedding of animal rectum reduced significantly after treatment by APB-13 [88]. Wu et al., reported that the PEDV proliferation was regulated using an antiviral protein (viperin). The interaction of viperin with the N protein of PEDV led to interfering with viral replication or assembly [89]. Table 4 shows the characteristics of the viral replication inhibitor peptides. The multiplication of PEDV was inhibited significantly by a cationic amphibian antimicrobial peptide in the host cells. The ability of Caerin1.1 to disrupt the integrity of the virus particles was mentioned as its inhibitory mechanism [90]. The characteristics of Caerin1.1 are shown in Table 5.

Conclusion

The emergence or re-emergence of Coronaviridae family viruses and enhanced cross-species dissemination due to potential viral mutations are still real threats to the worldwide population. Currently, there is no specific treatment for the majority of infections that caused by such viruses. This study was the first review regarding antiviral peptides with activity against all studied viruses from Coronaviridae family. However, several peptides were found with different antiviral mechanisms. This review mainly aimed to summarize data regarding the peptides that can be applicable and provide relevant information to develop novel treatments. Our study suggests that antiviral peptides are effective therapeutic options for these pathogens. The studies regarding fusion/entry inhibitors (notably HR-based) were more than the others and the HR2-based peptides possessed the most promising activity against investigated coronaviruses. The SR9 and PIH-AuNR were the most effective antiviral peptides against SARS-CoV and MERS-CoV, respectively. As mentioned in the text, the permeability and effectiveness of the peptides conjugated by the fatty acids (lipopeptides) were more than the pure peptides. For SARS-CoV-2, a lipopeptide (EK1C4) derived from a pan-coronavirus fusion inhibitor (EK1) displayed significant inhibitory activity against SARS-CoV-2 in Vero E6 cells. EK1C4 also inhibited other coronaviruses including MERS-CoV, HCoV-OC43, HCoV-229E and HCoV-NL63 in cell culture and mice. The spread of SARS-CoV-2 in human airway epithelial (HAE) cultures was also blocked using the peptide corresponding to C-terminal HR domain of SARS-CoV-2 conjugated by tetra-ethylene glycol-cholesterol. A derivative of this lipopeptide ([SARSHRC-PEG4]2-chol) was able to block the entry of SARS-CoV-2 in the Vero E6 cells. Its intranasal administration to ferrets completely protected the animals from SARS-CoV-2 infection. The antiviral activity and potency of antiviral peptides could be improved by combination with other peptides having different mechanisms of action, or with conventional antiviral drugs. Although, clinical trials and animal models testing have not yet been performed for the majority of the evaluated antiviral peptides, the obtained results from in vivo studies show the optimistic future to prepare the novel anti-CoVs drugs.

Declaration of Competing Interest

The authors declare no conflict of interest.
  87 in total

1.  Broad-spectrum in vitro activity and in vivo efficacy of the antiviral protein griffithsin against emerging viruses of the family Coronaviridae.

Authors:  Barry R O'Keefe; Barbara Giomarelli; Dale L Barnard; Shilpa R Shenoy; Paul K S Chan; James B McMahon; Kenneth E Palmer; Brian W Barnett; David K Meyerholz; Christine L Wohlford-Lenane; Paul B McCray
Journal:  J Virol       Date:  2009-12-23       Impact factor: 5.103

2.  In silico design of antiviral peptides targeting the spike protein of SARS-CoV-2.

Authors:  Rongsong Ling; Yarong Dai; Boxuan Huang; Wenjie Huang; Jianfeng Yu; Xifeng Lu; Yizhou Jiang
Journal:  Peptides       Date:  2020-05-05       Impact factor: 3.750

3.  Cryo-EM structure of the 2019-nCoV spike in the prefusion conformation.

Authors:  Daniel Wrapp; Nianshuang Wang; Kizzmekia S Corbett; Jory A Goldsmith; Ching-Lin Hsieh; Olubukola Abiona; Barney S Graham; Jason S McLellan
Journal:  Science       Date:  2020-02-19       Impact factor: 47.728

4.  Swine intestine antimicrobial peptides inhibit infectious bronchitis virus infectivity in chick embryos.

Authors:  Q Sun; K Wang; R She; W Ma; F Peng; H Jin
Journal:  Poult Sci       Date:  2010-03       Impact factor: 3.352

Review 5.  Antiviral peptides as promising therapeutic drugs.

Authors:  Liana Costa Pereira Vilas Boas; Marcelo Lattarulo Campos; Rhayfa Lorrayne Araujo Berlanda; Natan de Carvalho Neves; Octávio Luiz Franco
Journal:  Cell Mol Life Sci       Date:  2019-05-17       Impact factor: 9.261

Review 6.  The Benefits of Vitamin D Supplementation for Athletes: Better Performance and Reduced Risk of COVID-19.

Authors:  William B Grant; Henry Lahore; Michelle S Rockwell
Journal:  Nutrients       Date:  2020-12-04       Impact factor: 5.717

7.  Design of Potent Membrane Fusion Inhibitors against SARS-CoV-2, an Emerging Coronavirus with High Fusogenic Activity.

Authors:  Yuanmei Zhu; Danwei Yu; Hongxia Yan; Huihui Chong; Yuxian He
Journal:  J Virol       Date:  2020-07-01       Impact factor: 5.103

8.  The antiviral protein viperin interacts with the viral N protein to inhibit proliferation of porcine epidemic diarrhea virus.

Authors:  Jiaqi Wu; Heng Chi; Yali Fu; Aiping Cao; Jingxuan Shi; Min Zhu; Lilin Zhang; Deping Hua; Jinhai Huang
Journal:  Arch Virol       Date:  2020-07-27       Impact factor: 2.574

9.  Suppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.

Authors:  Kehu Yuan; Ling Yi; Jian Chen; Xiuxia Qu; Tingting Qing; Xi Rao; Pengfei Jiang; Jianhe Hu; Zikai Xiong; Yuchun Nie; Xuanling Shi; Wei Wang; Chen Ling; Xiaolei Yin; Keqiang Fan; Luhua Lai; Mingxiao Ding; Hongkui Deng
Journal:  Biochem Biophys Res Commun       Date:  2004-07-02       Impact factor: 3.575

10.  A phage-displayed peptide recognizing porcine aminopeptidase N is a potent small molecule inhibitor of PEDV entry.

Authors:  Fandan Meng; Siqingaowa Suo; Dante S Zarlenga; Yingying Cong; Xiaowei Ma; Qiong Zhao; Xiaofeng Ren
Journal:  Virology       Date:  2014-03-25       Impact factor: 3.616

View more
  5 in total

1.  A database of anti-coronavirus peptides.

Authors:  Qianyue Zhang; Xue Chen; Bowen Li; Chunying Lu; Shanshan Yang; Jinjin Long; Heng Chen; Jian Huang; Bifang He
Journal:  Sci Data       Date:  2022-06-13       Impact factor: 8.501

2.  Rational Discovery of Antiviral Whey Protein-Derived Small Peptides Targeting the SARS-CoV-2 Main Protease.

Authors:  Nicola Gambacorta; Leonardo Caputo; Laura Quintieri; Linda Monaci; Fulvio Ciriaco; Orazio Nicolotti
Journal:  Biomedicines       Date:  2022-05-04

Review 3.  Antiviral Peptides (AVPs) of Marine Origin as Propitious Therapeutic Drug Candidates for the Treatment of Human Viruses.

Authors:  Linda Sukmarini
Journal:  Molecules       Date:  2022-04-19       Impact factor: 4.927

Review 4.  A contemporary review on the important role of in silico approaches for managing different aspects of COVID-19 crisis.

Authors:  Mohammad Moradi; Reza Golmohammadi; Ali Najafi; Mehrdad Moosazadeh Moghaddam; Mahdi Fasihi-Ramandi; Reza Mirnejad
Journal:  Inform Med Unlocked       Date:  2022-01-21

5.  Two Different Therapeutic Approaches for SARS-CoV-2 in hiPSCs-Derived Lung Organoids.

Authors:  Paola Spitalieri; Federica Centofanti; Michela Murdocca; Maria Giovanna Scioli; Andrea Latini; Silvia Di Cesare; Gennaro Citro; Antonio Rossi; Augusto Orlandi; Shane Miersch; Sachdev S Sidhu; Pier Paolo Pandolfi; Annalisa Botta; Federica Sangiuolo; Giuseppe Novelli
Journal:  Cells       Date:  2022-04-05       Impact factor: 6.600

  5 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.