Literature DB >> 33037295

A bioinformatic study of antimicrobial peptides identified in the Black Soldier Fly (BSF) Hermetia illucens (Diptera: Stratiomyidae).

Antonio Moretta1, Rosanna Salvia1, Carmen Scieuzo1, Angela Di Somma2, Heiko Vogel3, Pietro Pucci4, Alessandro Sgambato5,6, Michael Wolff7, Patrizia Falabella8.   

Abstract

Antimicrobial peptides (AMPs) play a key role in the innate immunity, the first line of defense against bacteria, fungi, and viruses. AMPs are small molecules, ranging from 10 to 100 amino acid residues produced by all living organisms. Because of their wide biodiversity, insects are among the richest and most innovative sources for AMPs. In particular, the insect Hermetia illucens (Diptera: Stratiomyidae) shows an extraordinary ability to live in hostile environments, as it feeds on decaying substrates, which are rich in microbial colonies, and is one of the most promising sources for AMPs. The larvae and the combined adult male and female H. illucens transcriptomes were examined, and all the sequences, putatively encoding AMPs, were analysed with different machine learning-algorithms, such as the Support Vector Machine, the Discriminant Analysis, the Artificial Neural Network, and the Random Forest available on the CAMP database, in order to predict their antimicrobial activity. Moreover, the iACP tool, the AVPpred, and the Antifp servers were used to predict the anticancer, the antiviral, and the antifungal activities, respectively. The related physicochemical properties were evaluated with the Antimicrobial Peptide Database Calculator and Predictor. These analyses allowed to identify 57 putatively active peptides suitable for subsequent experimental validation studies.

Entities:  

Mesh:

Substances:

Year:  2020        PMID: 33037295      PMCID: PMC7547115          DOI: 10.1038/s41598-020-74017-9

Source DB:  PubMed          Journal:  Sci Rep        ISSN: 2045-2322            Impact factor:   4.379


Introduction

With over one million described species, insects represent the most diverse as well as the largest class of organisms in the world, due to their ability to adapt to recurrent changes and to their resistance against a wide spectrum of pathogens[1]. Their immune system, exclusively based on the innate, well-developed immune response, allows a general and rapid response to various invading organisms[2, 3]. The humoral immune response includes the enzymatic cascade that regulates the activation of coagulation and melanization of the hemolymph, the production of reactive oxygen (ROS) and nitrogen (RNS) species, and the production of antimicrobial peptides (AMPs)[4]. Today, the problem of antibiotic resistance represents one of the greatest threats in the medical field[4]. The constant need to find alternative solutions has increased the interest in AMPs over time. AMPs are small molecules, consisting of 10–100 amino acids, that have been identified in many organisms such as bacteria, fungi, plants, vertebrates and invertebrates, including insects[5]. They are cationic molecules that exhibit activities against bacteria, fungi, viruses, and parasites[5]. In addition to these known activities, many peptides also exert a cytotoxic effect against cancer cells[6]. The discovery of the first AMP derived from insects, dates back to 1980s, when Boman et al.[7] identified and isolated the first cecropin from the lepidopteran Hyalophora cecropia. Since then, many other AMPs have been discovered. Due to their high biodiversity, insects are considered to be among the richest and most innovative sources for these molecules. Insect AMPs can be classified into four families: α-helical peptides (e.g. cecropins), cysteine-rich peptides (e.g. defensins), proline-rich peptides, and glycine-rich peptides[8]. Despite their diversity, AMPs share two common features: the tendency to adopt an amphipathic conformation and the presence of a large number of basic residues, which determine the net positive charge at a neutral pH[9]. The established electrostatic forces between the positive amino acid residues of a peptide and the negative charges exposed on microorganism cell surfaces allow their interaction with bacterial membranes. Moreover, the cationic nature of these peptides allows the interaction with the negatively charged molecules exposed on cancer cell surfaces, such as phospholipid phosphatidylserine (PS), O-glycosylated mucins, sialylated gangliosides, and heparin sulfate, in contrast to the typical zwitterionic nature of the normal mammalian membranes[6,10,11]. According to their mechanism of action, AMPs can be grouped in two categories[12], (1) the membranolytic mechanism, described by three different putative models: “carpet”, “toroidal” and “barrel-stave” model[13], and (2) the non-membranolytic one, characterised by their direct interaction with intracellular targets such as DNA, RNA and proteins[14-16]. To date, more than 3000 AMPs have been discovered and reported to the Antimicrobial Peptide Database (APD, https://aps.unmc.edu/AP/), which contains exactly 3104 AMPs from six kingdoms: 343 from bacteria, 5 from archaea, 8 from protists, 20 from fungi, 349 from plants, and 2301 from animals. The amount of AMPs in insects varies according to the species, i.e. more than 50 AMPs have been found in the invasive ladybird Harmonia axyridis[17], whereas none was identified in the pea aphid Acyrthosiphon pisum[18]. The non-pest insect Hermetia illucens (Diptera: Stratiomyidae), also known as the Black Soldier Fly (BSF), is among the most promising sources for AMPs being able to live in hostile environments rich in microbial colonies[19]. In this study, we have analysed the larvae and the combined adult male and female H. illucens transcriptomes in order to identify AMPs, which were then analysed with the CAMP (Collection of Antimicrobial Peptides) database (https://www.camp.bicnirrh.res.in/)[20-23]. Moreover, the iACP online tool (https://lin.uestc.edu.cn/server/iACP) was used to predict the anticancer activity of the identified peptides while the AVPpred (https://crdd.osdd.net/servers/avppred) server was used to predict the antiviral activity of the identified peptides while the Antifp server (https://webs.iiitd.edu.in/raghava/antifp) was used to predict their antifungal activity, and their physicochemical properties were evaluated with the Antimicrobial Peptide Database Calculator and Predictor (APD3).

Results

De novo transcriptome assembly and gene identification

A Next-Generation sequencing (RNAseq) of the RNA isolated from larvae and combined adult male and female H. illucens transcriptomes was performed for an unambiguous identification of the peptide candidates. Sequencing and de novo assembly of the transcriptomes led to the identification of 25,197 unique nucleotide sequences (contigs) in the larvae transcriptome, and 78,763 contigs in the combined adults. These contigs were functionally annotated using Blast2GO software (https://www.blast2go.org). A total of 68 genes, encoding putative AMPs in the H. illucens transcriptomes, were finally identified.

Antimicrobial, anticancer, antiviral and antifungal activity prediction

All identified 68 sequences, encoding putative AMPs, were analysed in silico by the four machine-learning algorithms, such as Support Vector Machine (SVM), Discriminant Analysis (DA), Artificial Neural Network (ANN), and Random Forest (RF), available on the free online CAMP database, in order to predict their antimicrobial activity. The results are shown in Table 1. Table 2 reports the anticancer and non-anticancer scores obtained using the iACP tool. Table 3 shows the results obtained with the AVPpred server to predict the antiviral activity and with the Antifp server used to predict the antifungal activity. These analyses allowed the identification of 57 putatively active peptides: 13 sequences were predicted to be only antimicrobial while the others showed different combinations of antimicrobial, antiviral, anticancer or antifungal activity. In particular, 22 were both putative antimicrobial and anticancer; eight were both putative antimicrobial and antiviral; two were both putative antimicrobial and antifungal; seven were putative antimicrobial, anticancer and antiviral; one was putative antimicrobial antifungal and antiviral; two were putative antimicrobial, anticancer and antifungal while two potentially cover the complete range of analyzed biological activities (antimicrobial, anticancer, antifungal and antiviral). The remaining 11 did not show any activity according to the in silico investigation. In Supplementary Table S1 all the predicted activities are listed.
Table 1

Prediction of the antimicrobial activity through the CAMP database.

PeptideSequenceSVMRFANNDA
Hill_BB_C14202KRFTKCTLARELFQRGIPKSELPDWVCLVRWESNYQTNAMNKNNRDGSWDYGLFQINDKWWCKGHIKSHNACGLSCNELLKDDISKAVTCARLIKRQQGFRAWYGWLNHCTKVKPSIHECF1.0000.800AMP1.000
Hill_BB_C3566AKMSRCGVANMLLKYGFPRKDLADWVCLIEHESSFRTNVVGPPNTDGSRDYGLFQINSRYWCSGDGPSHNMCRIPCRMLLSNDMTHSIRCAVTVFRKQGLSAWYGWSGHCQGNAPSVENCFRSYNNLYYGK1.0000.916AMP1.000
Hill_BB_C1152RYGFPRNQLADWICLVEWESSFRTDAVGPPNGDGSRDWGLFQINDRYWCQSANYGNSHNICGVSCERLLSDDITTAVNCVRKIYAAHGFSGWNAWTQHCHSPSSVEHCFVESDCLPGGVSFDKHWL1.0000.8045AMP1.000
Hill_BB_C1153ASGRQFERCELARILHNRYGFPRNQLADWICLVEWESSFRTNAVGPPNSDGSRDWGLFQINDRYWCKSSNYRNSHNMCGVSCEHLLSDDITTAVNCVRKIYAAHGFSGWNAWTQH1.0000.918AMP1.000
Hill_BB_C2676TVYSRCGFAQTLYYDYGVTDMNTLANWVCLVQYESSFNDQAVGAINYNGTQDFGLFQINNKYWCQGAVSSSDSCGIACTSLLGNLSASWSCAQLVYQQQGFSAWYGWLNNCNGTAPSVADCF1.0000.611AMP1.000
Hill_BB_C269KVFTRCQLAKELIRYDFPRTFLSNWVCLIESESGRSTSKTLQLPNTSANYGIFQINSKTWCRKGRKGGLCEMKCEDFLNDDISDDARCAKQIYNRHGFQGWPGWVNKCRGRALPDVLKC1.0000.8725AMP1.000
Hill_BB_C1169SNGPRDYGLFQINNQYWCQGNVKSANECHIACTSLLSDDITHALNCAKKIKAQQGFKAWYGWLNYCQKSKPSVKECF0.9370.8045AMP0.993
Hill_BB_C779KVYTRCEMARILYHDHGVKNLTTLANWVCLIEHESGFNDEAVGALNSNGTRDYGLFQINNKYWCKGNVASSDSCKIACTALLGNVDASWKCAQLVYKEQGFKAWYGW1.0000.7555AMP1.000
Hill_LB_C36111KQFNKCSLATELSRLGVPKSELPDWVCLVQHESNFKTNWINKKNSNGSWDFGLFQINDKWWCEGHIRSHNTCNVKCEELVTEDIEKALECAKVIKRERGYKAWYGWLNNCQNKKPSVDECF1.0000.8235AMP1.000
Hill_LB_C12085KTFTKCSLAKTLYAHGIPKSELPDWVCLVQHESGFRTDAVGALNSNGTRDYGLFQINNKYWCKGNISSYNECNIACSALLSDDI0.8900.871AMP0.987
Hill_BB_C1290QLNIQGGAKSPLSDFDLNVQGGARKYYNNGHKPLHGTEDYNQHLGGPYGYSRPNFGGGLLFTHRFKLCSLSKLLIVC0.5810.5055AMP0.554
Hill_BB_C7347QLNIQGGGSPHSGFNLSIQGQKKLWESNNKRNTLHGTGQYSQHF0.3070.374NAMP0.031
Hill_BB_C9109QIFAQGGGSPGKGYDIYAQGRAKLWESQNQRNSLHGTASYSQHLGGPYGNSRPNVGGGLIFTHRF0.3510.6175AMP0.270
Hill_BB_C11804QLNIQGGGSPHSGFNLSIQGQKKLWESNNKRNTLHGTGQYSQHF0.3070.374NAMP0.031
Hill_BB_C309VSCWFENENIKASACQMSCMYRKGRRGGMCVNGVCTCSPN0.8270.6825AMP0.908
Hill_BB_C1827TTCTHLNCKLHCVLYRKRSGRCDRFNICKCI0.8980.8805AMP0.995
Hill_BB_C5878LSCLFENQAISAIACGASCITRKGRRGGWCSNGVCRCTPN0.9710.941AMP0.994
Hill_BB_C8756QPYQLQYEEDGPEYARELPIEEEELPSQVVEQHHQAKRATCDLLSPFKVGHAACVLDGFAMGRRGGWC0.2660.0085NAMP0.037
Hill_BB_C13793KESSDPDSALYSDIHPRFRRQLPCDYLSGLGFGEDACNTDCIAKGHKSGFCTGLVCRCRTL0.5030.5453AMP0.645
NHill_AD_C73537GQSEASWWKKVFKPVEKLGQRVRDATIQGIGIAQQGANVLATVRGGPPQ0.6330.870AMP0.904
NHill_AD_C16493GQSEAGWWKRVFKPVEKFGQRVRDAGVQGIAIAQQGANVLATARGGPPQQG0.6330.842AMP0.885
NHill_AD_C12927GWWKRVFKPVEKLGQRVRDAGIQGLEIAQQGANVLATARGGPPQQG0.6720.9075AMP0.955
NHill_AD_C12928GWWKRVFKPVERLGQRVRDAGIQGLQIAQQGANVLATVRGGPPQQG0.7730.911AMP0.969
NHill_AD_C4669SWFKKVFKPVEKVGQRVRDAGIQGVAIAQQGANVLATARGGPPH0.5740.745AMP0.899
Hill_BB_C3195GWWKKVFKPVEKLGQRVRDAGIQGIAIAQQGANVLATVRGGPPQ0.8680.9945AMP0.988
Hill_SB_C698GQSEAGWWKRVFKPVEKFGQRVRDAGIQGIEIAQQGANVLATARGGPPQQG0.5580.718AMP0.770
Hill_SB_C2730GWWKRVFKPVEKLGQRVRDAGIQGLEIAQQGANVLATVRGGPPQQG0.7000.9095AMP0.959
Hill_SB_C1875GQGESRSLWKKIFKPVEKLGQRVRDAGIQGIAIAQQGANVLATVRGGPPQ0.7140.9115AMP0.949
Hill_BB_C5151GQSESRSLWKKLFKPVERAGQRIRDATIKGIVIAQQGANVLATIRGGPAIPPGQG0.6410.944AMP0.935
Hill_BB_C390FNNLPICVEGLAGDIGSILLGVESDIGALAGAIANLALIAGECAAQGEAGAAICA0.9460.685AMP0.822
NHill_AD_C53857CINNGDGCQPDGRQGNCCSGYCHKEPGWVTGYCR0.8110.742AMP0.973
NHill_AD_C49215CIANGNGCQPDGRQGNCCSGFCYKQRGWVAGYCRRR0.9610.8735AMP0.999
Hill_BB_C2323QLNIQGGGSPHSGFDLSVQGRAKIWESDNGRNTLYGTGQYGQHLGGPYGNSEPSFGGGLMFSHRF0.1630.048NAMP0.007
Hill_BB_C7345SIDDLTLSEDGEDHVEIITDDEVQRAKR0.4560.1395NAMP0.024
Hill_BB_C7346QLNIQGGGSPHSGFDLNVQGRAKIWESNNGRNTLHGTGEYSQHLGGPYGNSRPNFGGGLLFTHRF0.2230.1105NAMP0.019
Hill_BB_C11803QLNIQGGGSPHSGFNLSIQGQKKLWESNNKRNTLHGTGQYSQHFGGPYGNSRPNFGGGLVFTHRF0.2780.3295AMP0.030
Hill_BB_C21232QLNIQGGSKSTFLILISMSKVVRESNNGHETLHGTGDYNQHLGGPYGNSQPNFGGELLFTHRFKLCSLSKLLIVCVFSKCRK0.7490.8505AMP0.865
NHill_AD_C17624QIFAQGGGSPGKGYDIYAQGRAKLWESQNQRNSLHGTASYSQHLGGPYGNSRPNVGGGLTFTHRF0.2840.515NAMP0.170
Hill_LB_C16634IKCTASICTQICRILKYKCGYCASASRCVCLK0.9920.913AMP0.999
Hill_LB_C37730AFAFDVTRKINPETSAVERPEVSEYPEIPKGTKLQEFVMMDIEIEEEGADNRAETIQRIKCVPSQCNQICRVLGKKCGYCKNASTCVCLG0.9880.9565AMP0.984
Hill_BB_C46948RKCTASQCTRVCKKLGYKRGYCQSSTKCVC0.9680.9375AMP0.999
Hill_BB_C16137MNIQGNAVSNPAGGQDVTVTAGKQFGSDNANITAGGFAGGNTLRGPPNAGVFASANANGHSLSVSKTVVPGISSTTSHGASANLFR0.8860.8225AMP0.758
Hill_BB_C16883QLSGSITPDMAGGNNVNIMASKFLGNPNHNIGGGVFASGNTRSNTPSLGAFGTLNLKDHSLGVSKTITPGVSDTFSQNARLIILKTPDHRVDANVFNSHTRLNNGFAFDKRGGSLDYTHRAGHSLSLGASHIPKFGTTAELTGKANLWKSPSGLSTFDLTGSAS1.0000.9275AMP1.000
Hill_BB_C10074SPQDGRRGSASVTVNNESRRGTDVRADLNARLWEGNNRRSSLDANAYYQRHFGGPMGTGRPDAGVGLNFRHRF0.4000.4375NAMP0.566
Hill_BB_C9237MNIQGNAVSNPAGGQDVTVTAGKQFGSDNTNITAGAFAGGNTLRGPPNAGVFASANANSHSLSVSKTVVPGVSATTSHAASANLFRNDQHSVNAQAFSSATKLNDGFQFKQHGAGLNYNNANGHGASIGVNKIPGFGSSMDVGARANIFQNPNTSFDVMANSRTHLSGPFQGKTNFGVSAGITRRF1.0000.9505AMP1.000
NHill_AD_C40487MNIQGNAVSNPAGGQDVTVTAGKQFGSDNTNITAGAFAGGNTLRGPPNAGVFASANANGHSLSVSKTVVPGVSSTTSHAASANLFRNDQHNVNAQAFSSATKLNDGFQFKQHGAGLNYNNANGHGASIGVNKIPGFGSSMDVGARANIFQNPNTSFDVMANSRTHLSGPFQGKTNF1.0000.9745AMP1.000
Hill_BB_C7758AACDLFSALNVASSICAAHCLYLGYKGGYCDSKLVCVCR0.9850.819AMP0.988
Hill_BB_C14087VTCDLLEPFLGPAPCMIHCIVRFRKRTGYCNSQNVCVCRG0.7120.6305AMP0.709
Hill_LB_C29142ATCDLLSPFKVGHAACAAHCIARGKRGGWCDKRAVCNCRK0.9560.9455AMP0.999
Hill_BB_C308VSCWFENENIKASACQMSCMYRKGRRGGMCVNGVCTCSPN0.8270.6825AMP0.908
Hill_BB_C1619LSCLFENQAVSAIACGSSCIARKGRRGGYCRNGVCVCTDN0.9720.900AMP0.972
Hill_BB_C1826TTCTHLNCKLHCLLQRKRSGRCDRFNICKCIS0.8780.9105AMP0.995
Hill_BB_C6571ATCTNWNCRTQCIARGKRGGYCVERNICKCTS0.9500.9815AMP0.992
Hill_BB_C7081ATCDLISGTKIENVACAAHCIAMGHKGGYCNSNLICICR0.9870.907AMP0.979
Hill_BB_C7985FTCSNLGCKAQCIILGNRSGGCNRLGVCQCN0.9910.9175AMP0.999
Hill_BB_C7176ATCDLLSPFKVGHAACALHCIALGRRGGWCDGRAVCNCRR0.9330.938AMP0.996
Hill_BB_C2519ATCDLLSPFKVGHAACALHCIAMGRRGGWCDGRAVCNCRR0.8950.8835AMP0.987
Hill_BB_C8473ATCDLLSPFGVGHAACAVHCIAMGRRGGWCDDRAVCNCRR0.8550.8145AMP0.977
Hill_BB_C34351AMCDLLSGLNMGRSVCAMRCILKGHRGGWCDDQGVCNCRV0.8160.6875AMP0.971
Hill_BB_C4683RPDNIEYLEDSQVAELVRHKRLSCLFENEAISALACGASCITRKGRRGGWCSNGVCHCTPN0.7340.5745AMP0.645
Hill_BB_C4977LSCWFENEDIKATACAMSCIYRKGRKGGRCENGICRCTPN0.8280.7115AMP0.913
Hill_BB_C13326LSCLFENQAVSAIACGASCITRKGKRGGWCSNGVCRCTPN0.9750.9475AMP0.991
Hill_BB_C7171TTCDLISGTKIENIACAAHCIAMGHKGGYCNSNLICICR0.9810.8805AMP0.984
Hill_BB_C10649QFDNLEDTGVEEKVRHKRLTCLFDNRPISAFACGSNCVSRKGKRGGWCVNGVCRCT0.8600.595AMP0.983
Hill_BB_C13792KQSSDPESALYSDIHPRFRRQLPCDYLSGLGFGEDACNTDCIAKGHKSGFCTGLVCRCRTL0.9950.9725AMP0.965
Hill_BB_C15867VTCDLLKPFFGRAPCMMHCILRFKKRTGFCSRQNVCVCR0.8260.5095AMP0.885
NHill_AD_C69719DVSIGSCVWGGSNYVSDCNGECKRRGYKGGHCGSFLNNICWCET0.9840.913AMP0.993
Hill_BB_C49430APQFGGQIGGFGGGGFGGGGFGPGGGFRPGGVAEFQESSSSVNVERETFDQGGFEISDSSVTSSSVSESFRD0.0120.2715NAMP0.031

From left to right are shown in order: peptide contig, peptide sequence, Support Vector Machine (SVM) score, Random Forest (RF) score, Artificial Neural Network (ANN) result and the Discriminant Analysis (DA) score.

Table 2

Prediction of the anticancer activity through the iACP tool.

PeptideSequenceAnticancer scoreNon-anticancer score
Hill_BB_C14202KRFTKCTLARELFQRGIPKSELPDWVCLVRWESNYQTNAMNKNNRDGSWDYGLFQINDKWWCKGHIKSHNACGLSCNELLKDDISKAVTCARLIKRQQGFRAWYGWLNHCTKVKPSIHECF0.4525420.547458
Hill_BB_C3566AKMSRCGVANMLLKYGFPRKDLADWVCLIEHESSFRTNVVGPPNTDGSRDYGLFQINSRYWCSGDGPSHNMCRIPCRMLLSNDMTHSIRCAVTVFRKQGLSAWYGWSGHCQGNAPSVENCFRSYNNLYYGK0.6036490.396351
Hill_BB_C1152RYGFPRNQLADWICLVEWESSFRTDAVGPPNGDGSRDWGLFQINDRYWCQSANYGNSHNICGVSCERLLSDDITTAVNCVRKIYAAHGFSGWNAWTQHCHSPSSVEHCFVESDCLPGGVSFDKHWL0.7440310.255969
Hill_BB_C1153ASGRQFERCELARILHNRYGFPRNQLADWICLVEWESSFRTNAVGPPNSDGSRDWGLFQINDRYWCKSSNYRNSHNMCGVSCEHLLSDDITTAVNCVRKIYAAHGFSGWNAWTQH0.3222150.677785
Hill_BB_C2676TVYSRCGFAQTLYYDYGVTDMNTLANWVCLVQYESSFNDQAVGAINYNGTQDFGLFQINNKYWCQGAVSSSDSCGIACTSLLGNLSASWSCAQLVYQQQGFSAWYGWLNNCNGTAPSVADCF0.5080410.491959
Hill_BB_C269KVFTRCQLAKELIRYDFPRTFLSNWVCLIESESGRSTSKTLQLPNTSANYGIFQINSKTWCRKGRKGGLCEMKCEDFLNDDISDDARCAKQIYNRHGFQGWPGWVNKCRGRALPDVLKC0.3537210.646279
Hill_BB_C1169SNGPRDYGLFQINNQYWCQGNVKSANECHIACTSLLSDDITHALNCAKKIKAQQGFKAWYGWLNYCQKSKPSVKECF0.9955370.004463
Hill_BB_C779KVYTRCEMARILYHDHGVKNLTTLANWVCLIEHESGFNDEAVGALNSNGTRDYGLFQINNKYWCKGNVASSDSCKIACTALLGNVDASWKCAQLVYKEQGFKAWYGW0.7174400.282560
Hill_LB_C36111KQFNKCSLATELSRLGVPKSELPDWVCLVQHESNFKTNWINKKNSNGSWDFGLFQINDKWWCEGHIRSHNTCNVKCEELVTEDIEKALECAKVIKRERGYKAWYGWLNNCQNKKPSVDECF0.6448900.355110
Hill_LB_C12085KTFTKCSLAKTLYAHGIPKSELPDWVCLVQHESGFRTDAVGALNSNGTRDYGLFQINNKYWCKGNISSYNECNIACSALLSDDI0.5000000.500000
Hill_BB_C1290QLNIQGGAKSPLSDFDLNVQGGARKYYNNGHKPLHGTEDYNQHLGGPYGYSRPNFGGGLLFTHRFKLCSLSKLLIVC0.8787920.121208
Hill_BB_C7347QLNIQGGGSPHSGFNLSIQGQKKLWESNNKRNTLHGTGQYSQHF0.0051020.994898
Hill_BB_C9109QIFAQGGGSPGKGYDIYAQGRAKLWESQNQRNSLHGTASYSQHLGGPYGNSRPNVGGGLIFTHRF0.1150820.884918
Hill_BB_C11804QLNIQGGGSPHSGFNLSIQGQKKLWESNNKRNTLHGTGQYSQHF0.0051020.994898
Hill_BB_C309VSCWFENENIKASACQMSCMYRKGRRGGMCVNGVCTCSPN0.4440020.555998
Hill_BB_C1827TTCTHLNCKLHCVLYRKRSGRCDRFNICKCI0.2152220.784778
Hill_BB_C5878LSCLFENQAISAIACGASCITRKGRRGGWCSNGVCRCTPN0.7246090.275391
Hill_BB_C8756QPYQLQYEEDGPEYARELPIEEEELPSQVVEQHHQAKRATCDLLSPFKVGHAACVLDGFAMGRRGGWC0.0000001.000000
Hill_BB_C13793KESSDPDSALYSDIHPRFRRQLPCDYLSGLGFGEDACNTDCIAKGHKSGFCTGLVCRCRTL0.0514850.948515
NHill_AD_C73537GQSEASWWKKVFKPVEKLGQRVRDATIQGIGIAQQGANVLATVRGGPPQ0.5083080.491692
NHill_AD_C16493GQSEAGWWKRVFKPVEKFGQRVRDAGVQGIAIAQQGANVLATARGGPPQQG0.5208650.479135
NHill_AD_C12927GWWKRVFKPVEKLGQRVRDAGIQGLEIAQQGANVLATARGGPPQQG0.3893740.610626
NHill_AD_C12928GWWKRVFKPVERLGQRVRDAGIQGLQIAQQGANVLATVRGGPPQQG0.4923180.507682
NHill_AD_C4669SWFKKVFKPVEKVGQRVRDAGIQGVAIAQQGANVLATARGGPPH0.9018510.098149
Hill_BB_C3195GWWKKVFKPVEKLGQRVRDAGIQGIAIAQQGANVLATVRGGPPQ0.8399030.160097
Hill_SB_C698GQSEAGWWKRVFKPVEKFGQRVRDAGIQGIEIAQQGANVLATARGGPPQQG0.5196330.480367
Hill_SB_C2730GWWKRVFKPVEKLGQRVRDAGIQGLEIAQQGANVLATVRGGPPQQG0.4811710.518829
Hill_SB_C1875GQGESRSLWKKIFKPVEKLGQRVRDAGIQGIAIAQQGANVLATVRGGPPQ0.7026950.297305
Hill_BB_C5151GQSESRSLWKKLFKPVERAGQRIRDATIKGIVIAQQGANVLATIRGGPAIPPGQG0.8707510.129249
Hill_BB_C390FNNLPICVEGLAGDIGSILLGVESDIGALAGAIANLALIAGECAAQGEAGAAICA0.9085530.091447
NHill_AD_C53857CINNGDGCQPDGRQGNCCSGYCHKEPGWVTGYCR0.9915930.008407
NHill_AD_C49215CIANGNGCQPDGRQGNCCSGFCYKQRGWVAGYCRRR0.9947310.005269
Hill_BB_C2323QLNIQGGGSPHSGFDLSVQGRAKIWESDNGRNTLYGTGQYGQHLGGPYGNSEPSFGGGLMFSHRF0.0711130.928887
Hill_BB_C7345SIDDLTLSEDGEDHVEIITDDEVQRAKR0.0141710.985829
Hill_BB_C7346QLNIQGGGSPHSGFDLNVQGRAKIWESNNGRNTLHGTGEYSQHLGGPYGNSRPNFGGGLLFTHRF0.0358450.964155
Hill_BB_C11803QLNIQGGGSPHSGFNLSIQGQKKLWESNNKRNTLHGTGQYSQHFGGPYGNSRPNFGGGLVFTHRF0.0662830.933717
Hill_BB_C21232QLNIQGGSKSTFLILISMSKVVRESNNGHETLHGTGDYNQHLGGPYGNSQPNFGGELLFTHRFKLCSLSKLLIVCVFSKCRK0.9451620.054838
NHill_AD_C17624QIFAQGGGSPGKGYDIYAQGRAKLWESQNQRNSLHGTASYSQHLGGPYGNSRPNVGGGLTFTHRF0.0754120.924588
Hill_LB_C16634IKCTASICTQICRILKYKCGYCASASRCVCLK0.9604330.039567
Hill_LB_C37730AFAFDVTRKINPETSAVERPEVSEYPEIPKGTKLQEFVMMDIEIEEEGADNRAETIQRIKCVPSQCNQICRVLGKKCGYCKNASTCVCLG0.0067980.993202
Hill_BB_C46948RKCTASQCTRVCKKLGYKRGYCQSSTKCVC0.7829320.217068
Hill_BB_C16137MNIQGNAVSNPAGGQDVTVTAGKQFGSDNANITAGGFAGGNTLRGPPNAGVFASANANGHSLSVSKTVVPGISSTTSHGASANLFR0.5742940.425706
Hill_BB_C16883QLSGSITPDMAGGNNVNIMASKFLGNPNHNIGGGVFASGNTRSNTPSLGAFGTLNLKDHSLGVSKTITPGVSDTFSQNARLIILKTPDHRVDANVFNSHTRLNNGFAFDKRGGSLDYTHRAGHSLSLGASHIPKFGTTAELTGKANLWKSPSGLSTFDLTGSAS0.8835430.116457
Hill_BB_C10074SPQDGRRGSASVTVNNESRRGTDVRADLNARLWEGNNRRSSLDANAYYQRHFGGPMGTGRPDAGVGLNFRHRF0.0000170.999983
Hill_BB_C9237MNIQGNAVSNPAGGQDVTVTAGKQFGSDNTNITAGAFAGGNTLRGPPNAGVFASANANSHSLSVSKTVVPGVSATTSHAASANLFRNDQHSVNAQAFSSATKLNDGFQFKQHGAGLNYNNANGHGASIGVNKIPGFGSSMDVGARANIFQNPNTSFDVMANSRTHLSGPFQGKTNFGVSAGITRRF0.4341550.565845
NHill_AD_C40487MNIQGNAVSNPAGGQDVTVTAGKQFGSDNTNITAGAFAGGNTLRGPPNAGVFASANANGHSLSVSKTVVPGVSSTTSHAASANLFRNDQHNVNAQAFSSATKLNDGFQFKQHGAGLNYNNANGHGASIGVNKIPGFGSSMDVGARANIFQNPNTSFDVMANSRTHLSGPFQGKTNF0.4430170.556983
Hill_BB_C7758AACDLFSALNVASSICAAHCLYLGYKGGYCDSKLVCVCR0.7915730.208427
Hill_BB_C14087VTCDLLEPFLGPAPCMIHCIVRFRKRTGYCNSQNVCVCRG0.3918090.608191
Hill_LB_C29142ATCDLLSPFKVGHAACAAHCIARGKRGGWCDKRAVCNCRK0.4501010.549899
Hill_BB_C308VSCWFENENIKASACQMSCMYRKGRRGGMCVNGVCTCSPN0.4440020.555998
Hill_BB_C1619LSCLFENQAVSAIACGSSCIARKGRRGGYCRNGVCVCTDN0.9542830.045717
Hill_BB_C1826TTCTHLNCKLHCLLQRKRSGRCDRFNICKCIS0.0685500.931450
Hill_BB_C6571ATCTNWNCRTQCIARGKRGGYCVERNICKCTS0.8421130.157887
Hill_BB_C7081ATCDLISGTKIENVACAAHCIAMGHKGGYCNSNLICICR0.9451430.054857
Hill_BB_C7985FTCSNLGCKAQCIILGNRSGGCNRLGVCQCN0.8223690.177631
Hill_BB_C7176ATCDLLSPFKVGHAACALHCIALGRRGGWCDGRAVCNCRR0.0110730.988927
Hill_BB_C2519ATCDLLSPFKVGHAACALHCIAMGRRGGWCDGRAVCNCRR0.0209270.979073
Hill_BB_C8473ATCDLLSPFGVGHAACAVHCIAMGRRGGWCDDRAVCNCRR0.1652170.834783
Hill_BB_C34351AMCDLLSGLNMGRSVCAMRCILKGHRGGWCDDQGVCNCRV0.0292240.970776
Hill_BB_C4683RPDNIEYLEDSQVAELVRHKRLSCLFENEAISALACGASCITRKGRRGGWCSNGVCHCTPN0.2248780.775122
Hill_BB_C4977LSCWFENEDIKATACAMSCIYRKGRKGGRCENGICRCTPN0.1066000.893400
Hill_BB_C13326LSCLFENQAVSAIACGASCITRKGKRGGWCSNGVCRCTPN0.7011910.298809
Hill_BB_C7171TTCDLISGTKIENIACAAHCIAMGHKGGYCNSNLICICR0.9523880.047612
Hill_BB_C10649QFDNLEDTGVEEKVRHKRLTCLFDNRPISAFACGSNCVSRKGKRGGWCVNGVCRCT0.9741030.025897
Hill_BB_C13792KQSSDPESALYSDIHPRFRRQLPCDYLSGLGFGEDACNTDCIAKGHKSGFCTGLVCRCRTL0.2952650.704735
Hill_BB_C15867VTCDLLKPFFGRAPCMMHCILRFKKRTGFCSRQNVCVCR0.1823600.817640
NHill_AD_C69719DVSIGSCVWGGSNYVSDCNGECKRRGYKGGHCGSFLNNICWCET0.9243930.075607
Hill_BB_C49430APQFGGQIGGFGGGGFGGGGFGPGGGFRPGGVAEFQESSSSVNVERETFDQGGFEISDSSVTSSSVSESFRD0.3300110.669989

From left to right are shown in order: peptide contig, peptide sequence, the anticancer and non-anticancer scores related to each sequence.

Table 3

Results obtained with the AVPpred server for the antiviral activity prediction and with Antifp server for the antifungal activity prediction.

PeptideAVPpred: antiviral activity predictionAntifp: antifungal activity prediction
AVP motif (model)Alignment modelComposition modelPhysio-chemical modelOverall predictionScorePrediction
Hill_BB_C14202Non-AVP53.2664.08Yes0.20892203Non-antifungal
Hill_BB_C3566Non-AVP42.6564.08No0.26737087Non-antifungal
Hill_BB_C1152Non-AVP31.3364.08No− 0.21250625Non-antifungal
Hill_BB_C1153Non-AVP38.8364.08No− 0.37506205Non-ANTIFUNGAL
Hill_BB_C2676Non-AVP46.6164.08No− 0.17216018Non-antifungal
Hill_BB_C269Non-AVP52.0764.08Yes− 0.025392142Non-antifungal
Hill_BB_C1169Non-AVP44.4764.08No0.072220496Non-antifungal
Hill_BB_C779Non-AVP41.264.08No− 0.33302841Non-antifungal
Hill_LB_C36111Non-AVP40.2564.08No− 0.21911853Non-antifungal
Hill_LB_C12085Non-AVP42.3164.08No0.139426Non-antifungal
Hill_BB_C1290Non-AVP31.5364.08No0.11095482Non-antifungal
Hill_BB_C7347Non-AVP39.2464.12No− 0.040857298Non-antifungal
Hill_BB_C9109Non-AVP23.764.08No− 0.068718526Non-antifungal
Hill_BB_C11804Non-AVP39.2464.12No− 0.040857298Non-antifungal
Hill_BB_C309Non-AVP48.8564.73No0.065455296Non-antifungal
Hill_BB_C1827Non-AVP46.8549.78No0.73998352Antifungal
Hill_BB_C5878YesNon-AVP50.5567.39Yes− 0.16644401Non-antifungal
Hill_BB_C8756Non-AVP26.3164.08No− 0.34776804Non-antifungal
Hill_BB_C13793Non-AVP42.6664.09No0.25709331Non-antifungal
NHill_AD_C73537Non-AVP33.763.94No− 0.36753515Non-antifungal
NHill_AD_C16493Non-AVP34.6664.07No− 0.43908213Non-antifungal
NHill_AD_C12927Non-AVP39.8964.07No− 0.47185039Non-antifungal
NHill_AD_C12928Non-AVP40.3364.09No− 0.40020762Non-antifungal
NHill_AD_C4669Non-AVP36.7163.87No− 0.031971647Non-antifungal
Hill_BB_C3195Non-AVP37.4364.08No− 0.24406508Non-antifungal
Hill_SB_C698Non-AVP33.2364.07No− 0.43908213Non-antifungal
Hill_SB_C2730Non-AVP39.8864.09No− 0.38062322Non-antifungal
Hill_SB_C1875Non-AVP34.9563.96No− 0.22572859Non-antifungal
Hill_BB_C5151Non-AVP31.7164.03No− 0.34876968Non-antifungal
Hill_BB_C390Non-AVP52.4564.08Yes− 0.67921544Non-antifungal
NHill_AD_C53857Non-AVP51.9665.69Yes0.12385895Non-antifungal
NHill_AD_C49215Non-AVP46.3565.52No0.2406468Non-antifungal
Hill_BB_C2323Non-AVP19.9264.08No− 0.10977439Non-antifungal
Hill_BB_C7345Non-AVP26.5647.85No− 0.87408278Non-antifungal
Hill_BB_C7346Non-AVP23.7564.08No− 0.059453989Non-antifungal
Hill_BB_C11803Non-AVP28.9964.08No− 0.052337869Non-antifungal
Hill_BB_C21232Non-AVP44.1464.08No− 0.070217673Non-antifungal
NHill_AD_C17624Non-AVP23.0164.08No− 0.15660532Non-antifungal
Hill_LB_C16634Non-AVP53.2964.88Yes0.7067461Antifungal
Hill_LB_C37730Non-AVP34.8564.08No0.38202837Non-antifungal
Hill_BB_C46948Non-AVP48.5964.22No0.71418843antifungal
Hill_BB_C16137Non-AVP28.0864.08No0.010457995Non-antifungal
Hill_BB_C16883Non-AVP25.1464.08No− 0.52680116Non-antifungal
Hill_BB_C10074Non-AVP12.4564.08No− 0.19881079Non-antifungal
Hill_BB_C9237Non-AVP28.7164.08No0.32515345Non-antifungal
NHill_AD_C40487Non-AVP28.5464.08No0.37181457Non-antifungal
Hill_BB_C7758Non-AVP61.8264.18Yes0.18741319Non-antifungal
Hill_BB_C14087YesNon-AVP63.0766.59Yes0.10302883Non-antifungal
Hill_LB_C29142Non-AVP52.0764.12Yes0.33363813Non-antifungal
Hill_BB_C308Non-AVP48.8564.73No0.065455296Non-antifungal
Hill_BB_C1619YesNon-AVP52.4768.2Yes− 0.12761437Non-antifungal
Hill_BB_C1826Non-AVP46.4249.91No0.2129187Non-antifungal
Hill_BB_C6571Non-AVP49.5467No0.5009657Antifungal
Hill_BB_C7081Non-AVP51.0364.65Yes0.35232096Non-antifungal
Hill_BB_C7985Non-AVP48.0665.99No0.44711187Non-antifungal
Hill_BB_C7176Non-AVP55.8264.95Yes0.27115344Non-antifungal
Hill_BB_C2519Non-AVP53.464.85Yes0.27115344Non-antifungal
Hill_BB_C8473Non-AVP47.764.69No0.21172458Non-antifungal
Hill_BB_C34351Non-AVP50.2564.13Yes0.10334371Non-antifungal
Hill_BB_C4683Non-AVP39.9464.09No− 0.25553273Non-antifungal
Hill_BB_C4977Non-AVP52.5265.92Yes0.0078493215Non-antifungal
Hill_BB_C13326YesNon-AVP56.2668.51Yes− 0.21725812Non-antifungal
Hill_BB_C7171Non-AVP44.0764.19No0.21225639Non-antifungal
Hill_BB_C10649Non-AVP45.7264.11No− 0.13179766Non-antifungal
Hill_BB_C13792Non-AVP47.3864.08No1.0166485Antifungal
Hill_BB_C15867Non-AVP66.163.61Yes0.70687492Antifungal
NHill_AD_C69719YesNon-AVP47.2764.08Yes0.91354184Antifungal
Hill_BB_C49430Non-AVP33.0364.08No− 0.36274044Non-antifungal

From left to right are shown in order: peptide contig, AVP motif model results, alignment model results, composition model results, the physio-chemical model results, the overall results for the antiviral prediction, antifungal score and prediction result for the antifungal activity.

Prediction of the antimicrobial activity through the CAMP database. From left to right are shown in order: peptide contig, peptide sequence, Support Vector Machine (SVM) score, Random Forest (RF) score, Artificial Neural Network (ANN) result and the Discriminant Analysis (DA) score. Prediction of the anticancer activity through the iACP tool. From left to right are shown in order: peptide contig, peptide sequence, the anticancer and non-anticancer scores related to each sequence. Results obtained with the AVPpred server for the antiviral activity prediction and with Antifp server for the antifungal activity prediction. From left to right are shown in order: peptide contig, AVP motif model results, alignment model results, composition model results, the physio-chemical model results, the overall results for the antiviral prediction, antifungal score and prediction result for the antifungal activity.

Physicochemical properties of the identified peptides

The 57 identified, putatively active, peptides belong to different classes of AMPs including defensins, cecropins, attacins and lysozyme (Fig. 1). Although attacins and lysozyme are proteins due to their high molecular weight, they belong to AMPs’ classes because of their antibacterial activity. The physicochemical properties of these peptides were evaluated with the Antimicrobial Peptide Database Calculator and Predictor APD3 (Table 4). Figure 2 shows the graphical representation of the calculated physicochemical properties of the 57 identified peptides, whereas Table 5 reports their amino acid composition and the amino acid frequency, compared to the amino acid composition of the patent AMPs available in the APD database. The highest amino acid content in all the analysed AMPs was found for Gly, Ala, Arg, Asn, Cys, Leu, Ser residues, whereas the lowest content was found for His, Met, Trp, Tyr residues (Table 5). A graphical representation of the amino acid composition of each identified peptide is shown in Supplementary Fig. 1. The molecular mass of the identified peptides ranges from 3000 Da for the smallest peptide Hill_BB_C7985 to 19,000 Da for the largest peptide Hill_BB_C9237, with an average of approximately 7000 Da. The amino acid sequences varied from a minimum value of 31 residues to a maximum of 186 residues, and an average of approximately 66 residues. The total hydrophobic ratio showed the lowest value of 26 for the peptide NHill_AD_C53857 and the highest of 60 for the peptide Hill_BB_C390, and an average value of approximately 40. The total net charge of the identified peptides ranged from − 6, for the Hill_BB_C390 peptide to + 9 for the Hill_BB_C14202 peptide, with an average value of + 3, while the Isoelectric Point (pI) varied from 3.34 for the Hill_BB_C390 peptide to 11.83 for the NHill_AD_C12928 peptide, with an average value of 8.79.
Figure 1

Graphic representation of the identified AMP classes from larvae and adult transcriptomes. The pie chart shows that the largest number of identified peptides belongs to the class of defensins.

Table 4

Prediction of physicochemical properties using the Antimicrobial Peptide Database Calculator and Predictor (APD3) and the Compute pI/Mw tool—Expasy.

PeptideLenght (aa)Molecular weight (g/mol)Total hydrophobic Ratio (%)Total net chargepIBoman Index (kcal/mol)
Hill_BB_C1420212114,282.44338+ 99.322.14
Hill_BB_C356613114,871.99336+ 68.991.87
Hill_BB_C115212614,259.79938− 55.551.8
Hill_BB_C115311213,084.60737+ 17.842.37
Hill_BB_C267612213,394.83841− 53.800.88
Hill_BB_C26911913,730.836+ 89.242.26
Hill_BB_C1169778763.95437+ 48.801.59
Hill_BB_C77910712,074.69942+ 17.761.32
Hill_LB_C3611112114,214.14537+ 28.152.13
Hill_LB_C12085849307.513806.881.45
Hill_BB_C1290778480.59829+ 49.301.39
Hill_BB_C309404422.1942+ 38.671.83
Hill_BB_C1827313686.45741+ 69.382.53
Hill_BB_C5878404204.90445+ 48.981.56
Hill_BB_C13793616712.5973406.882.22
NHill_AD_C73537495259.01436+ 410.431.49
NHill_AD_C16493515404.09937+ 410.931.63
NHill_AD_C12927464969.6936+ 410.931.65
NHill_AD_C12928465024.77736+ 511.831.78
NHill_AD_C4669444670.39840+ 511.071.32
Hill_BB_C3195444726.50640+ 511.071.16
Hill_SB_C698515476.16335+ 310.261.78
Hill_SB_C2730464997.74436+ 410.931.60
Hill_SB_C1875505312.12336+ 511.001.61
Hill_BB_C5151555823.74636+ 611.471.61
NHill_AD_C53857343679.0792606.702.23
NHill_AD_C49215363985.54133+ 59.182.69
Hill_BB_C21232829053.42734+ 59.461.32
Hill_LB_C16634323531.39553+ 69.180.75
Hill_LB_C377309010,059.61138− 25.171.93
Hill_BB_C46948303390.07133+ 89.642.58
Hill_BB_C16137868328.08134+ 29.981.11
Hill_BB_C1688316417,080.99232+ 59.891.51
Hill_BB_C923718618,942.72534+ 610.361.52
NHill_AD_C4048717617,910.51234+ 49.871.52
Hill_BB_C7758394089.84256+ 17.810.07
Hill_BB_C14087404501.42747+ 38.691.28
Hill_LB_C29142404275.05550+ 69.381.72
Hill_BB_C308404422.1942+ 38.671.83
Hill_BB_C1619404183.8445+ 38.691.7
Hill_BB_C1826323752.51740+ 69.432.7
Hill_BB_C6571323597.1937+ 59.182.7
Hill_BB_C7081394055.80951+ 17.830.55
Hill_BB_C7985313233.81945+ 38.701.18
Hill_BB_C7176404259.04952+ 48.981.45
Hill_BB_C2519404277.08852+ 48.981.52
Hill_BB_C8473404249.9852+ 28.371.62
Hill_BB_C34351404330.18950+ 28.361.46
Hill_BB_C4683616736.67439+ 17.792.25
Hill_BB_C4977404486.22940+ 38.662.33
Hill_BB_C13326404162.85945+ 48.961.35
Hill_BB_C7171394099.86248+ 17.540.64
Hill_BB_C10649566263.18137+ 47.542.58
Hill_BB_C13792616725.63934+ 17.782.17
Hill_BB_C15867394566.6551+ 79.691.68
NHill_AD_C69719444763.31334+ 16.711.66
Hill_BB_C390555182.98660− 64.06-

From left to right are shown in order: peptide contig, the peptide length, the molecular weight, the total hydrophobic ratio, the total net charge, the isoelectric point (pI) and the Boman index.

Figure 2

Graphical representation of the physicochemical properties of the 57 peptides with putative activity: (a) total hydrophobic ratio; (b) total net charge; (c) isoelectric point; (d) molecular weight; (e) peptide length; (f) Boman Index.

Table 5

Amino acid frequency and amino acid composition of the identified peptides.

Amino acid composition of peptides identified in Hermetia illucensAmino acid composition of patent AMPs in the APD database
Amino acid three letter codeAmino acid frequencyAmino acid composition (%)Amino acid composition (%)
Ala2977.988167.61
Arg2306.186125.81
Asn2586.939213.85
Asp1423.819262.65
Cys2627.046796.86
Glu1133.039272.69
Gln1664.464772.57
Gly40610.9198511.56
His892.393762.16
Ile1754.706835.93
Leu2426.508888.34
Lys2055.513729.55
Met421.129641.25
Phe1433.846154.08
Pro1243.335134.69
Ser2707.261976.07
Thr1684.518564.51
Trp852.286171.64
Tyr852.286172.48
Val2165.809575.7
Total3718100100

As it is shown, the Gly, Ala, Arg, Asn, Cys, Leu, Ser residues are the most abundant, whereas the lowest content is associated with the His, Met, Trp, Tyr residues.

Graphic representation of the identified AMP classes from larvae and adult transcriptomes. The pie chart shows that the largest number of identified peptides belongs to the class of defensins. Prediction of physicochemical properties using the Antimicrobial Peptide Database Calculator and Predictor (APD3) and the Compute pI/Mw tool—Expasy. From left to right are shown in order: peptide contig, the peptide length, the molecular weight, the total hydrophobic ratio, the total net charge, the isoelectric point (pI) and the Boman index. Graphical representation of the physicochemical properties of the 57 peptides with putative activity: (a) total hydrophobic ratio; (b) total net charge; (c) isoelectric point; (d) molecular weight; (e) peptide length; (f) Boman Index. Amino acid frequency and amino acid composition of the identified peptides. As it is shown, the Gly, Ala, Arg, Asn, Cys, Leu, Ser residues are the most abundant, whereas the lowest content is associated with the His, Met, Trp, Tyr residues.

Bacterial cell growth and viability

Four putative antimicrobial peptides, namely Hill_BB_C6571, Hill_BB_C16634, Hill_BB_C46948 and Hill_BB_C7985, that showed high antimicrobial score values with all prediction softwares were selected and chemically synthesised. The antimicrobial activity of these peptides was verified by monitoring E. coli cells growth in the presence of different concentrations of each peptide in comparison with untreated cells. Supplementary Fig. 2 shows the growth curves of E. coli cells in the presence of 3 µM (A) or 12 µM (B) concentrations of each peptide. A clear decrease in the growth curves was observed at both concentrations compared to untreated cells (blue line) with bacteria impaired to achieve the exponential phase at 12 µM due to rapid death. The reduction in cell viability was observed with increasing concentration of each peptide in comparison with untreated cells. Next, cell viability of E. coli was also evaluated by treatment with 3 µM of each peptide (Supplementary Fig. 2C) confirming a decrease of about 50% in cell viability after 100 min treatment with all four peptides analysed.

Discussion

AMPs are promising candidates as alternatives to conventional antibiotics, thanks to their low toxicity to eukaryotic cells and their broad spectrum of action against bacteria, mycobacteria, fungi, viruses and cancer cells[24]. AMPs can kill bacteria through different mechanisms including membrane disruption, targeting intracellular components, or interfering with the bacterial metabolism[25-27]. Furthermore, most AMPs are cationic, with the positive net charge promoting the electrostatic interaction with negatively charged bacterial membranes[28]. All living organisms produce AMPs with insects being among the richest sources due to their high biodiversity and their extremely varied living environments. The immune system of the insect H. illucens is very developed, as this species feeds on decaying substrates and manure, which are extremely rich in pathogenic microorganisms, as it possible to observe also in other species, such as in Eristalis tenax. Twenty-two AMPs were indeed identified in the Diptera E. tenax, that has been able to adapt to different aquatic habitats (sewage tanks and manure pits) with heavy microbial load[29]. AMPs, which are synthesized by the fat body and hemocytes and then secreted into the hemolymph, are an essential part of the immune defense[30, 31]. In this study, we focused on the gene level in order to identify all putative genes encoding AMPs (Fig. 3).
Figure 3

Strategies carried out in order to identify peptides from Hermetia illucens insect.

Strategies carried out in order to identify peptides from Hermetia illucens insect. The transcriptomes of H. illucens larvae as well as the combined male and female adults were assembled, and all the obtained contigs were functionally annotated through the Blast2Go software resulting in the identification of 68 putative peptides of interest. These sequences were analyzed in silico through the CAMP database and the iACP online tool in order to evaluate their antimicrobial and anticancer activity, respectively. Additionally, the AVPpred and the Antifp servers were used to predict the antiviral and the antifungal activity, respectively, of the identified peptides. Our results led to the identification of 57 peptides, 13 of which were predicted as endowed with an antimicrobial activity, 22 with an antimicrobial and anticancer activity, eight with an antimicrobial and antiviral activity, two with an antimicrobial and antifungal activity, seven with an antimicrobial, anticancer and antiviral activity (Supplementary Table S1). Only one peptide was predicted as antimicrobial, antiviral and antifungal activity, whereas two peptides were predicted to have a putative antimicrobial, anticancer and antifungal activity (Supplementary Table S1). Surprisingly, two peptides, corresponding to Hill_LB_C16634 and NHill_AD_C69719 contigs, resulted positive to all activity predictions (Supplementary Table S1). Most of the identified peptides belong to defensins and cecropins families, whose composition ranges from 34 to 51 amino acids[32, 33]. These peptides have a pattern of six cysteines, which are involved in the formation of three disulphide bonds, Cys1Cys4, Cys2Cys5 and Cys3Cys6, for insect defensins[34]. Insect defensins are active against Gram–negative bacteria such as Escherichia coli, but mainly against Gram-positive bacteria, such as Staphylococcus aureus, Micrococcus luteus, Bacillus subtilis, Bacillus thuringiensis, Aerococcus viridians and Bacillus megaterium. Moreover, some insect defensins are also active against fungi[35-39]. For example, the royalisin peptide, isolated from the royal jelly of Apis mellifera, consists of 51 amino acids, and the six cysteine residues are involved in the formation of three disulphide bonds and are active against Gram-positive bacteria and fungi[40]. Defensin targets have not been identified yet, and studies of the structure–activity relationship could be useful to understand the molecular mechanism underlying their bioactivity[41]. Cecropins were first purified from the moth H. cecropia and represent the most abundant family of linear α-helical AMPs in insects, active against both Gram-negative and Gram-positive bacteria[42]. Insect cecropins, mainly derived from lepidopteran and dipteran species, are the cecropins A, B and D. These consist of 35–37 amino acids with no cysteine residues and are able to lyse the bacterial membrane and to reduce the proline uptake. For example, cecropin B, a linear cationic peptide consisting of 35 amino acids, reduces the lethality of E. coli load and plasma endotoxin levels, and also shows an antifungal activity against Candida albicans[42,43]. Moreover, a cecropin-like peptide was isolated from the salivary glands of the female mosquito Aedes egypti, showing antiviral activity against the Dengue virus. Glycine residue is the most spread among the peptides that we identified and is particularly related to Attacin proteins[44,45]. Although the mechanism of action of the different AMPs has not yet been fully elucidated, it appears that AMPs, unlike antibiotics, have more difficulty in causing a microbial resistance, and most of them do not destroy normal cells of higher animals[46]. Recently, it has been demonstrated that the clavaspirin peptide from tunicate Styela clava exhibits the ability to kill drug-resistant pathogens, such as S. aureus, without a detectable resistance[47]. Moreover, it was demonstrated that two proline rich peptides (Lser-PRP2 and Lser-PRP3) do not interfere with protein synthesis but both were able to bind the bacterial chaperone DnaK and are therefore able to inhibit protein folding[48]. The characteristics of AMPs make them excellent candidates for the development of new drugs. The bioinformatic approach represents a powerful tool to predict the physicochemical properties and the putative function of amino acid sequences. However, we aimed to go beyond the simple functional annotation which typically exclusively relies on sequence similarities to peptides deposited in public databases. Indeed, the approach we reported is based on the use of several softwares, previously employed to perform similar analyses[49-51], that exploit different algorithms for the determination of a score that predicts the biological activity of unknown peptides. We demonstrated that a similar approach can provide reliable indications about the potential biological activities of candidate AMPs, as confirmed by our preliminary tests on the antimicrobial activity of four identified AMPs (Supplementary Fig. 2). However, validation studies were out of the scope of this study which was essentially aimed to identify a set of candidate peptides which could serve as a starting point for subsequent functional characterization of H. illucens AMPs by our group, as well as by other researchers in the field. Indeed, following the in silico analysis, the largest peptides could be produced by recombinant methodologies while chemical synthesis could be used for smaller ones. Structural analysis could be performed through mass spectrometry and circular dichroism (CD) and the biological activity could be evaluated by in vitro tests. The produced peptides, in fact, could be tested in vitro to validate their activity against different bacterial strains, both Gram-negative and Gram-positive bacteria, cancer cell lines, and fungi. Moreover, the peptides showing interesting biological activities, could be produced in fusion with suitable tags to investigate their mechanism of action through functional proteomics experiments and advanced mass spectrometry methodologies, in order to characterise their interaction(s) with target protein (mainly components of the biological membranes), thus identifying the possible protein targets.

Materials and methods

Rearing of Hermetia illucens and RNA isolation

Hermetia illucens larvae were reared on different diets in order to minimize the possible effect of a specific substrate on the expression of peptides, according to the protocol adopted by Vogel et al.[52]. The adults were reared in an environmental chamber under controlled conditions: temperature 27 ± 1.0 °C, humidity 70% ± 5%, and a photoperiod of 12:12 h [L:D]. Since it is not clear whether all AMPs are expressed in a similar fashion across different larval instars, RNA was obtained from two different instars, in order to identify the maximum number of expressed AMPs. Thus, using the TRI Reagent following the manufacturer’s instructions (Sigma, St. Louis, Missouri, USA), RNA was extracted from adults’ total body and from two larval stages: 2nd and 5th instar larvae whose isolated RNA was subsequently pooled in a 1:1 ratio for RNAseq. A DNase (Turbo DNase, Ambion Austin, Texas, USA) treatment was carried out to eliminate any contaminating DNA. After the DNase enzyme removal, the RNA was further purified using the RNeasy MinElute Clean up Kit (Qiagen, Venlo, Netherlands) following the manufacturer’s protocol, and eluted in 20 μL of RNA Storage Solution (Ambion Austin, Texas, USA). The RNA integrity was verified on an Agilent 2100 Bioanalyzer using the RNA Nano chips (Agilent Technologies, Palo Alto, CA), and the RNA quantity was determined by a Nanodrop ND1000 spectrophotometer.

RNA-Seq, de novo larvae and combined adult male and female transcriptomes assembly and gene identification

The transcriptome sequencing of all RNA samples was performed with a poly(A) + enriched mRNA fragmented to an average of 150 nucleotides. The sequencing was carried out by the Max Planck Genome Center (https://mpgc.mpipz.mpg.de/home/) using standard TruSeq procedures on an Illumina HiSeq2500 sequencer. The de novo transcriptome assembly was carried out using a CLC Genomics Workbench v7.1 (https://www.clcbio.com) which is designed to assemble large transcriptomes using sequences from short-read sequencing platforms. All obtained sequences (contigs) were used as queries for a BLASTX search[53] in the ‘National Center for Biotechnology Information’ (NCBI) non-redundant (nr) database, considering all hits with an E-value cut-off of 10–5. The transcriptomes were annotated using BLAST, Gene Ontology, and InterProScan searches using Blast2GO PRO v2.6.1 (https://www.blast2go.de)[54]. To optimize the annotation of the obtained data, GO slim was used, a subset of GO terms that provides a higher level of annotations and allows a more global view of the result. Candidate AMP genes were identified through an established reference set of insect-derived AMPs and lysozymes, and additional filtering steps to avoid interpreting incomplete genes or allelic variants as further AMP genes[52].

In silico analysis for the antimicrobial, anticancer, antiviral and antifungal activity prediction

The sequences, functionally annotated as antimicrobial peptides by the Blast2Go software, were analysed with Prop 1.0[55] and Signal P 4.0[56] Servers in order to identify the signal peptide and the pro-peptide region. The mature and active peptide regions were analysed in silico by four machine-learning algorithms, available on the CAMP database[57]: Support Vector Machine (SVM), Discriminant Analysis (DA), Artificial Neural Network (ANN), and Random Forest (RF), in order to predict their antimicrobial activity. The minimum calculated threshold for a sequence in order to be considered antimicrobial is 0.5[67-69]. When all the sequences were analyzed with the algorithms, the ones with a score higher than 0.5 were automatically considered putative antimicrobials by the software. We would like to point out that the threshold is intrinsically set by the software, and can’t be modified by the user. This is true for the SVM, RF and DA algorithms that report the result in a numerical form (score) while the ANN algorithm provides the results as categories, namely either AMP (antimicrobial) or NAMP (not-antimicrobial). All sequences that showed a positive result with all four statistical methods, were considered as antimicrobial. The iACP tool[58-62] was used to predict the anticancer activity of the same sequences, providing the results in a numerical form. The prediction of the antiviral activity was performed in silico with the online server AVPpred. It exploits four different models: (1) the AVP motif, which returns the result as YES or NO; (2) the Alignment model, which gives the result in the form AVP or Non-AVP; (3) the Composition model and the (4) the Physico-chemical model, which return their results in a numerical form (percentage). The overall result is expressed with a YES, if the peptide results have a putative antiviral activity, and with a NO, if otherwise[63]. The Antifp server was used to predict the antifungal activity, and provides the result as a numerical score[64]. For this analysis, a threshold of 0.5 was used.

Evaluation of the physicochemical properties

The corresponding physicochemical properties of identified putative active peptides following an in silico analysis, such as peptide length, molecular weight, total hydrophobic ratio, total net charge, isoelectric point, and the Boman Index, were determined by the Antimicrobial Peptide Database Calculator and Predictor (APD3)[65-67] and the Compute pI/Mw tool—Expasy[68, 69]. Four putative antimicrobial peptides, namely Hill_BB_C6571, Hill_BB_C16634, Hill_BB_C46948 and Hill_BB_C7985, that showed high antimicrobial score values with all prediction softwares were selected and chemically synthesised (Bio-Fab Research, Rome, Italy). E. coli cells were incubated overnight in LB medium at 37 °C. The culture was then diluted to a concentration of 0.08 OD600/mL in fresh medium and grown at 37 °C for 90 min. At an OD/mL value of 0.5, the antimicrobial peptides were added to the culture at a final concentration of 3 or 12 µM. Growth of the culture was evaluated every 20 min for a total of 120 min by assessing absorbance at 600 nm. Cell viability was evaluated by enumerating Colony Forming Units (CFU) after 16 h of incubation with 3 µM of each peptide. Serial dilutions of bacterial cultures up to a concentration of 10–6 cells both for treated and untreated samples were prepared. Finally, 100 µL of each sample was plated on LB agar every 20 min for a total of 100 min. Plates were incubated for 16 h at 37 °C and the CFUs occurring on each plate were then counted. Experiments were performed in triplicate. Supplementary Information.
  61 in total

Review 1.  Antibacterial peptides isolated from insects.

Authors:  L Otvos
Journal:  J Pept Sci       Date:  2000-10       Impact factor: 1.905

2.  APD: the Antimicrobial Peptide Database.

Authors:  Zhe Wang; Guangshun Wang
Journal:  Nucleic Acids Res       Date:  2004-01-01       Impact factor: 16.971

3.  Prediction of proprotein convertase cleavage sites.

Authors:  Peter Duckert; Søren Brunak; Nikolaj Blom
Journal:  Protein Eng Des Sel       Date:  2004-01       Impact factor: 1.650

4.  SignalP 4.0: discriminating signal peptides from transmembrane regions.

Authors:  Thomas Nordahl Petersen; Søren Brunak; Gunnar von Heijne; Henrik Nielsen
Journal:  Nat Methods       Date:  2011-09-29       Impact factor: 28.547

5.  Midgut-specific immune molecules are produced by the blood-sucking insect Stomoxys calcitrans.

Authors:  M J Lehane; D Wu; S M Lehane
Journal:  Proc Natl Acad Sci U S A       Date:  1997-10-14       Impact factor: 11.205

Review 6.  Therapeutic potential of antifungal plant and insect defensins.

Authors:  Karin Thevissen; Hans-Henrik Kristensen; Bart P H J Thomma; Bruno P A Cammue; Isabelle E J A François
Journal:  Drug Discov Today       Date:  2007-09-04       Impact factor: 7.851

7.  The focusing positions of polypeptides in immobilized pH gradients can be predicted from their amino acid sequences.

Authors:  B Bjellqvist; G J Hughes; C Pasquali; N Paquet; F Ravier; J C Sanchez; S Frutiger; D Hochstrasser
Journal:  Electrophoresis       Date:  1993-10       Impact factor: 3.535

8.  Antimicrobial activity and interactions of cationic peptides derived from Galleria mellonella cecropin D-like peptide with model membranes.

Authors:  José Oñate-Garzón; Marcela Manrique-Moreno; Steven Trier; Chad Leidy; Rodrigo Torres; Edwin Patiño
Journal:  J Antibiot (Tokyo)       Date:  2016-12-21       Impact factor: 2.649

9.  Antimicrobial Peptides from Rat-Tailed Maggots of the Drone Fly Eristalis tenax Show Potent Activity against Multidrug-Resistant Gram-Negative Bacteria.

Authors:  Rolf Hirsch; Jochen Wiesner; Armin Bauer; Alexander Marker; Heiko Vogel; Peter Eugen Hammann; Andreas Vilcinskas
Journal:  Microorganisms       Date:  2020-04-25

10.  Profiling antimicrobial peptides from the medical maggot Lucilia sericata as potential antibiotics for MDR Gram-negative bacteria.

Authors:  Rolf Hirsch; Jochen Wiesner; Alexander Marker; Yvonne Pfeifer; Armin Bauer; Peter E Hammann; Andreas Vilcinskas
Journal:  J Antimicrob Chemother       Date:  2019-01-01       Impact factor: 5.790

View more
  21 in total

1.  C/N-Dependent Element Bioconversion Efficiency and Antimicrobial Protein Expression in Food Waste Treatment by Black Soldier Fly Larvae.

Authors:  Ning Jin; Yanxia Liu; Shouyu Zhang; Shibo Sun; Minghuo Wu; Xiaoying Dong; Huiyan Tong; Jianqiang Xu; Hao Zhou; Shui Guan; Weiping Xu
Journal:  Int J Mol Sci       Date:  2022-05-01       Impact factor: 6.208

2.  Immunomodulatory potential of black soldier fly larvae: applications beyond nutrition in animal feeding programs.

Authors:  Elizabeth Koutsos; Bree Modica; Tarra Freel
Journal:  Transl Anim Sci       Date:  2022-06-22

3.  First Evidence of Past and Present Interactions between Viruses and the Black Soldier Fly, Hermetia illucens.

Authors:  Robert D Pienaar; Clément Gilbert; Carole Belliardo; Salvador Herrero; Elisabeth A Herniou
Journal:  Viruses       Date:  2022-06-11       Impact factor: 5.818

4.  Characterization of chitin and chitosan derived from Hermetia illucens, a further step in a circular economy process.

Authors:  Micaela Triunfo; Elena Tafi; Anna Guarnieri; Rosanna Salvia; Carmen Scieuzo; Thomas Hahn; Susanne Zibek; Alessandro Gagliardini; Luca Panariello; Maria Beatrice Coltelli; Angela De Bonis; Patrizia Falabella
Journal:  Sci Rep       Date:  2022-04-22       Impact factor: 4.996

Review 5.  Insect antimicrobial peptides: potential weapons to counteract the antibiotic resistance.

Authors:  M D Manniello; A Moretta; R Salvia; C Scieuzo; D Lucchetti; H Vogel; A Sgambato; P Falabella
Journal:  Cell Mol Life Sci       Date:  2021-02-17       Impact factor: 9.261

Review 6.  Insects, Rodents, and Pets as Reservoirs, Vectors, and Sentinels of Antimicrobial Resistance.

Authors:  Willis Gwenzi; Nhamo Chaukura; Norah Muisa-Zikali; Charles Teta; Tendai Musvuugwa; Piotr Rzymski; Akebe Luther King Abia
Journal:  Antibiotics (Basel)       Date:  2021-01-12

Review 7.  Insect Derived Lauric Acid as Promising Alternative Strategy to Antibiotics in the Antimicrobial Resistance Scenario.

Authors:  Luca Borrelli; Lorena Varriale; Ludovico Dipineto; Antonino Pace; Lucia F Menna; Alessandro Fioretti
Journal:  Front Microbiol       Date:  2021-02-26       Impact factor: 5.640

8.  Mechanical Processing of Hermetia illucens Larvae and Bombyx mori Pupae Produces Oils with Antimicrobial Activity.

Authors:  Alessio Saviane; Luca Tassoni; Daniele Naviglio; Daniela Lupi; Sara Savoldelli; Giulia Bianchi; Giovanna Cortellino; Paolo Bondioli; Liliana Folegatti; Morena Casartelli; Viviana Teresa Orlandi; Gianluca Tettamanti; Silvia Cappellozza
Journal:  Animals (Basel)       Date:  2021-03-11       Impact factor: 2.752

Review 9.  Antimicrobial Peptides: A New Hope in Biomedical and Pharmaceutical Fields.

Authors:  Antonio Moretta; Carmen Scieuzo; Anna Maria Petrone; Rosanna Salvia; Michele Dario Manniello; Antonio Franco; Donatella Lucchetti; Antonio Vassallo; Heiko Vogel; Alessandro Sgambato; Patrizia Falabella
Journal:  Front Cell Infect Microbiol       Date:  2021-06-14       Impact factor: 5.293

Review 10.  An Overview of Antimicrobial Compounds from African Edible Insects and Their Associated Microbiota.

Authors:  Cynthia M Mudalungu; Chrysantus M Tanga; Segenet Kelemu; Baldwyn Torto
Journal:  Antibiotics (Basel)       Date:  2021-05-22
View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.