Literature DB >> 32857976

Uclacyanin Proteins Are Required for Lignified Nanodomain Formation within Casparian Strips.

Guilhem Reyt1, Zhenfei Chao2, Paulina Flis1, Isai Salas-González3, Gabriel Castrillo1, Dai-Yin Chao2, David E Salt4.   

Abstract

Casparian strips (ass="Chemical">CSs) are cell wall modifications of ass="Chemical">pan class="Species">vascular plants restricting extracellular free diffusion into and out of the vascular system [1]. This barrier plays a critical role in controlling the acquisition of nutrients and water necessary for normal plant development [2-5]. CSs are formed by the precise deposition of a band of lignin approximately 2 μm wide and 150 nm thick spanning the apoplastic space between adjacent endodermal cells [6, 7]. Here, we identified a copper-containing protein, Uclacyanin1 (UCC1), that is sub-compartmentalized within the CS. UCC1 forms a central CS nanodomain in comparison with other CS-located proteins that are found to be mainly accumulated at the periphery of the CS. We found that loss-of-function of two uclacyanins (UCC1 and UCC2) reduces lignification specifically in this central CS nanodomain, revealing a nano-compartmentalized machinery for lignin polymerization. This loss of lignification leads to increased endodermal permeability and, consequently, to a loss of mineral nutrient homeostasis.
Copyright © 2020 The Author(s). Published by Elsevier Inc. All rights reserved.

Entities:  

Keywords:  Casparian strips; Uclacyanin; endodermis; extracellular diffusion barriers; lignin; nanodomain; phytocyanin; plant cell wall

Year:  2020        PMID: 32857976      PMCID: PMC7575197          DOI: 10.1016/j.cub.2020.07.095

Source DB:  PubMed          Journal:  Curr Biol        ISSN: 0960-9822            Impact factor:   10.834


Results and Discussion

Plant roots perform the critical function of ass="Chemical">controlling the uptake of ass="Chemical">pan class="Chemical">water and mineral nutrients from the soil essential for plant growth and development. A specialized cell layer in the root called the endodermis plays a key role in the selective uptake of mineral nutrients into the stele for translocation to the shoot [2, 5, 6, 8]. Of vital importance to this function are Casparian strips (CSs), which are belt-like lignin structures surrounding each endodermal cell, that interlock to form a barrier to diffusion in the apoplast [9, 10]. This barrier is thought to enable the endodermis to exert control over uptake of water and solutes from the environment into the plant and perhaps also to control biotic interactions [1, 11]. The precise deposition of ass="Chemical">lignin for ass="Chemical">pan class="Chemical">CS formation requires a signaling pathway involving the kinases SGN1 and SGN3 controlling the spatial production of reactive oxygen species (ROS) through the activation of the RBOHF NADPH oxidases [5, 9, 12, 13, 14]. Lignin polymerization requires the localized action of a peroxidase (PER64) [15] and a dirigent-like protein (ESB1) [6]. This biosynthetic machinery is likely placed at the CS deposition site by association with CASPARIAN STRIP MEMBRANE DOMAIN PROTEINS (CASPs) [7]. The CASPs form a highly scaffolded transmembrane domain guiding where the CS forms. Furthermore, the receptor-like kinase SGN3 acts as a sensor of CS integrity by inducing over-lignification of the endodermal cells when the CS is defective [4, 5]. A network of tranass="Gene">scriptional factors involving ass="Chemical">pan class="Gene">SHR, SCR, and MYB36 controls endodermal differentiation [16, 17]. The MYB36 transcription factor controls the expression of most of the described genes associated with CS formation, including CASPs, ESB1, and PER64 [2, 18]. Characterization of other MYB36-regulated genes could thus lead to the identification of new actors involved in CS formation. Among the genes downregulated in a ass="Gene">myb36 loss-of-function mutant [2, 18], we identified a ass="Chemical">pan class="Gene">Uclacyanin1 gene (UCC1) that belongs to the copper-containing phytocyanins family [19] (Figure 1A). This family is divided into three sub-families according to their copper binding amino acid: uclacyanins, stellacyanins, and plantacyanins. The functional role of these proteins remains unknown. However, biophysical and structural data of several phytocyanins suggest their implication in redox reactions with small molecular weight compounds [19, 20, 21, 22, 23, 24]. The expression of several members of this family have been previously shown to be associated with lignified tissues [25, 26, 27]. We looked at the endodermal spatiotemporal expression pattern of the different members of this family (Figure 1A). We found that UCC1, UCC2, and, to a lesser extent, UCC8 and STC1 are expressed in the endodermis similarly to that observed for CASP1 and ESB1. Additionally, UCC1 and UCC2 were found among the top 15 marker genes for endodermal specificity in a single-cell RNA sequencing dataset [28]. Due to the lack of T-DNA insertional mutants in the UCC1 gene, we generated two loss-of-function mutants, ucc1.1 and ucc1.2, using CRISPR/Cas9 technology (Figure 1B). These mutants bear a single base deletion (ucc1.1) and an insertion (ucc1.2), leading to shifts in the reading frame in both. For UCC2 characterization, we used two T-DNA mutants, ucc2.1 presenting an insertion in the coding sequence (Figure 1B) and ucc2.2 presenting an insertion in the 3′UTR. The two ucc1 alleles show a slight although significant delay in formation of an apoplastic barrier, as visualized by the uptake of the apoplastic tracer propidium iodide (PI) after 10 min of staining (Figure 1C). The T-DNA mutants ucc2.1 and ucc2.2 did not show an increase of PI permeability. Notably, in ucc1ucc2 double mutants, with strong reduction in expression of both UCC1 and UCC2 in ucc1.2ucc2.1 (Figure S1A), a strong increase of PI permeability is observed similar to that found in other CS mutants such as esb1 and casp1casp3 (Figure S1B). However, the number of cells permeable to PI in ucc1.2ucc2.1 is highly variable in comparison with casp1casp3 and esb1. When the incubation time with PI is increased to 20 min, ucc1.2ucc2.1 displays an enhanced permeability in comparison with esb1. Taken together, these results highlight the redundant role of UCC1 and UCC2 for establishing a functional apoplastic barrier. No additive effect on PI permeability was observed in the triple mutant ucc1.1casp1casp3 or in the doubles ucc1.2esb1 and ucc1.2sgn3 in comparison with casp1casp3, esb1, and sgn3, respectively (Figure S1B). The loss of CS integrity in esb1, myb36, and casp1casp3 is accompanied by an increased deposition of suberin [2, 5, 6] as a compensatory mechanism under the control of SGN3 [4]. We analyzed the pattern of suberin deposition using fluorol yellow 088 staining in the ucc mutants (Figure 1D). Deposition of suberin did not increase in the single mutants ucc1.1, ucc1.2, ucc2.1, or ucc2.2. However, the double mutant ucc1.2ucc2.1 induces an increase in endodermal suberization compared with wild-type (WT) plants. This increase is not as strong as that observed in esb1 or casp1casp3 (Figure S1C). The combination of ucc1 mutations in esb1 and casp1casp3 do not affect the enhanced suberization of esb1 or casp1casp3.
Figure 1

Uclacyanins UCC1 and UCC2 Are Required for a Functional Casparian Strip

(A) Left: figure shows a phylogenetic analysis of phytocyanins protein family in A. thaliana. The tree was built using the full-length amino acid sequences for all proteins. Different colors represent the three phytocyanins subfamilies: uclacyanins, stellacyanins, and plantacyanins (39). In the tree, branch lengths are proportional to the number of substitutions per site. AT3G17675 has been previously annotated as a stellacyanin (STC4), however, the signal peptide for the secretion pathway and the hydrophobic extension for Glycosylphosphatidylinositol (GPI) anchoring are missing. Right: heatmap showing the endodermal expression of the phytocyanins family in A. thaliana across the different root zones (Meristematic, Elongation, Maturation). For the analysis, expression data were collected from the Bio-Analytic Resource database, AtGenExpress Consortium. The expression of two endodermal localized proteins, CASP1 and ESB1, were added to the analysis as a reference. Asterisks indicate a significant downregulation in a myb36 mutant according to [18].

(B) Schematic representation of the UCC1 and UCC2 proteins showing the different protein domains and the types of mutations. Domains were defined according to [19] (see also Figure S1A).

(C) Boxplot analysis showing the number of the cells from the onset of elongation permeable to propidium iodide in wild-type (WT) plants, ucc1 mutants (ucc1.1 and ucc1.2), ucc2 mutant (ucc2.1 and ucc2.2), and the double ucc1 ucc2 mutants (ucc1.2 ucc2.1 and ucc1.2ucc2.2). Data were collected from two independent experiments (n ≥ 29). Different letters represent significant statistical differences between genotypes using one-way ANOVA and Tukey’s test (p < 0.01) (see also Figure S1B).

(D) Diagram shows the quantification analysis of the endodermal suberization in roots of WT plants, ucc1.1, ucc1.2, ucc2.1, ucc2.2 and ucc1.2 ucc2.1. Each color in the graph represents the percentage of the root length (percentage of root length [%]) that is unsuberized (white), discontinuously suberized (yellow), continuously suberized (orange). Suberin was staining with Fluorol yellow 088. (n ≥ 18). Error bars in the figure are the standard deviation (SD). Different letters represent significant differences between genotypes using a Mann-Whitney test (p < 0.01) (See also Figure S1C).

(E) Heatmap representing the ionomic profiles (Z-scores) of WT plants, and a collection of mutants with a defective Casparian strip: ucc2.1, ucc1.1, ucc1.2, ucc1.2 ucc2.1, esb1, ucc1.1 esb1, ucc1.2 esb1, sgn3, ucc1.1 sgn3, and ucc1.2 sgn3 grown in full nutrient conditions on agar plate for 2 weeks (n = 10). Elements concentration were determined by ICP-MS and the raw data are available in the Table S1. Significant differences were determined in comparison with WT using a t test (p < 0.01). Genotypes were subjected to hierarchical clustering analysis.

ass="Chemical">Uclacyanins ass="Chemical">pan class="Gene">UCC1 and UCC2 Are Required for a Functional Casparian Strip (A) Left: figure shows a phylogenetic analysis of ass="Chemical">phytocyanins protein family in A. thaliana. The tree was built using the full-length amino acid sequences for all proteins. Different ass="Chemical">pan class="Chemical">colors represent the three phytocyanins subfamilies: uclacyanins, stellacyanins, and plantacyanins (39). In the tree, branch lengths are proportional to the number of substitutions per site. AT3G17675 has been previously annotated as a stellacyanin (STC4), however, the signal peptide for the secretion pathway and the hydrophobic extension for Glycosylphosphatidylinositol (GPI) anchoring are missing. Right: heatmap showing the endodermal expression of the phytocyanins family in A. thaliana across the different root zones (Meristematic, Elongation, Maturation). For the analysis, expression data were collected from the Bio-Analytic Resource database, AtGenExpress Consortium. The expression of two endodermal localized proteins, CASP1 and ESB1, were added to the analysis as a reference. Asterisks indicate a significant downregulation in a myb36 mutant according to [18]. (B) Schematic representation of the ass="Gene">UCC1 and ass="Chemical">pan class="Gene">UCC2 proteins showing the different protein domains and the types of mutations. Domains were defined according to [19] (see also Figure S1A). (C) Boxplot analysis showing the number of the cells from the onset of elongation permeable to ass="Chemical">propidium iodide in wild-type (WT) plants, ass="Chemical">pan class="Gene">ucc1 mutants (ucc1.1 and ucc1.2), ucc2 mutant (ucc2.1 and ucc2.2), and the double ucc1 ucc2 mutants (ucc1.2 ucc2.1 and ucc1.2ucc2.2). Data were collected from two independent experiments (n ≥ 29). Different letters represent significant statistical differences between genotypes using one-way ANOVA and Tukey’s test (p < 0.01) (see also Figure S1B). (D) Diagram shows the quantification analysis of the endodermal suberization in roots of WT plants, ass="Gene">ucc1.1, ass="Chemical">pan class="Gene">ucc1.2, ucc2.1, ucc2.2 and ucc1.2 ucc2.1. Each color in the graph represents the percentage of the root length (percentage of root length [%]) that is unsuberized (white), discontinuously suberized (yellow), continuously suberized (orange). Suberin was staining with Fluorol yellow 088. (n ≥ 18). Error bars in the figure are the standard deviation (SD). Different letters represent significant differences between genotypes using a Mann-Whitney test (p < 0.01) (See also Figure S1C). (E) Heatmap representing the ionomic profiles (Z-sass="Chemical">cores) of WT plants, and a ass="Chemical">pan class="Chemical">collection of mutants with a defective Casparian strip: ucc2.1, ucc1.1, ucc1.2, ucc1.2 ucc2.1, esb1, ucc1.1 esb1, ucc1.2 esb1, sgn3, ucc1.1 sgn3, and ucc1.2 sgn3 grown in full nutrient conditions on agar plate for 2 weeks (n = 10). Elements concentration were determined by ICP-MS and the raw data are available in the Table S1. Significant differences were determined in comparison with WT using a t test (p < 0.01). Genotypes were subjected to hierarchical clustering analysis. Diass="Chemical">sruption of ass="Chemical">pan class="Chemical">CS is known to affect the composition of the leaf ionome as observed in esb1, myb36, casp1casp3, sgn3, and lotr1 [2, 3, 5, 6]. In order to determine the contribution of UCC1 and UCC2 in maintaining mineral nutrient homeostasis, we analyzed the leaf ionome in different mutant combinations (Figure 1E; Table S1) using inductively coupled plasma mass spectrometry (ICP-MS). The ucc1 and ucc2 single mutants have similar leaf ionomes, which group together in a hierarchical clustering (Figure 1E). However, the leaf ionome of the ucc1.2ucc2.1 double mutant separates from the single mutants, grouping instead with esb1. The leaf ionome of the double mutants ucc1sgn3 group with the sgn3 mutant, and the double mutants ucc1esb1 group with the esb1 mutant (Figure 1E). This confirms that there is no or little additivity of the leaf ionomic phenotype between ucc1 and sgn3 or esb1. The higher endodermal permeability and the atypical ionomic profile observed in the ucc(s) mutants (Figures 1 and S1) strongly suggest that UCass="Chemical">Cs play an important role in ass="Chemical">pan class="Chemical">CS formation. To identify the cell type in which the UCC1 promoter is activated, we fused the UCC1 promoter to GFP (Figure S2A). GFP was accumulated only in the endodermis, from the elongation zone and further up into the zone of differentiated endodermal cells. According to the literature, the phytocyanin proteins are predicted to be located on the cell surface and anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) anchor [29]. Several members of this family, including UCC2, have been shown to be GPI-anchored using a proteomic approach [29]. In order to determine the precise UCC1 localization, we generated a line (pUCC1::mCherry-UCC1) expressing a tagged UCC1 (Figure 2A). The mCherry-UCC1 fusion accumulates at the endodermal cell junctions where the CS is located (Figure 2B). It first appears in a discontinuous manner in the early stage of endodermal differentiation, and then forms a more continuous band later in the endodermis development.
Figure 2

UCC1 Defines a New Central Sub-domain in the Casparian Strip

(A) Diagram representing the construct pUCC1::mCherry-UCC1 (UTR, untranslated region; SP, signal peptide; H Cter, hydrophobic C terminus for GPI anchoring).

(B) Maximum intensity projection, orthogonal, median, and surface views of confocal sections of plants expressing pUCC1::mCherry-UCC1 (red) in cleared roots. In the case of maximum intensity projection (maximum projection), the figure represents different regions of the root measured as number of cells after the onset of elongation. For the orthogonal, median, and surface views, cell walls were stained with Calcofluor white (gray in the figures). Scale bar, 20 μm for the maximum projection and orthogonal views. Scale bar, 5 μm for the median and surface views. Ep, epidermis; Co, cortex; End, endodermis (see also Figure S2A).

(C) Maximum intensity projection, median, and surface view of confocal sections of plants expressing CASP1-GFP (cyan) and mCherry-UCC1 (red). Signal was captured at the 10th endodermal cell after the onset of elongation observed in vivo. Scale bar, 20 μm for maximum projection and 3 μm for median and surface view (see also Figure S2B).

(D) In vivo observation of the surface view of an endodermal cell expressing pESB1::ESB1-mCherry or pCASP1::CASP1-GFP. Scale bar, 2 μm.

(E) Immunolocalization assay of UCC1 protein (red) in plant expressing pCASP1::CASP1-GFP (cyan). A primary polyclonal antibody targeting UCC1 was used in combination with a secondary antibody conjugated with Dylight 633. Scale bar, 2 μm see also Figures S2C–S2H.

(F) Graph presenting the distribution of normalized pixels intensity (relative pixel intensity, 0–1) across the Casparian strip (distance in μm) for CASP1-GFP fluorescence (cyan) and UCC1 immunofluorescence (red, Dylight 633). Light curves represent individual replicates coming from individual plants (n = 4). Each replicate is the average pixel intensity across a segment of 25 μm along the Casparian strip axis. Dark curves represent the mean values for CASP1-GFP and UCC1 immunofluorescence.

pan class="Gene">UCC1 Defines a New Central Sub-domain in the Casass="Chemical">parian Strip (A) Diagram representing the ass="Chemical">construct pass="Chemical">pan class="Gene">UCC1::mCherry-UCC1 (UTR, untranslated region; SP, signal peptide; H Cter, hydrophobic C terminus for GPI anchoring). (B) Maximum intensity projection, orthogonal, median, and surface views of ass="Chemical">confocal sections of plants expressing pass="Chemical">pan class="Gene">UCC1::mCherry-UCC1 (red) in cleared roots. In the case of maximum intensity projection (maximum projection), the figure represents different regions of the root measured as number of cells after the onset of elongation. For the orthogonal, median, and surface views, cell walls were stained with Calcofluor white (gray in the figures). Scale bar, 20 μm for the maximum projection and orthogonal views. Scale bar, 5 μm for the median and surface views. Ep, epidermis; Co, cortex; End, endodermis (see also Figure S2A). (ass="Species">C) Maximum intensity projection, median, and surface view of ass="Chemical">pan class="Chemical">confocal sections of plants expressing CASP1-GFP (cyan) and mCherry-UCC1 (red). Signal was captured at the 10th endodermal cell after the onset of elongation observed in vivo. Scale bar, 20 μm for maximum projection and 3 μm for median and surface view (see also Figure S2B). (D) In vivo observation of the surface view of an endodermal cell expressing pass="Gene">ESB1::ass="Chemical">pan class="Gene">ESB1-mCherry or pCASP1::CASP1-GFP. Scale bar, 2 μm. (E) Immunolocalization assay of ass="Gene">UCC1 protein (red) in plant expressing pass="Chemical">pan class="Gene">CASP1::CASP1-GFP (cyan). A primary polyclonal antibody targeting UCC1 was used in combination with a secondary antibody conjugated with Dylight 633. Scale bar, 2 μm see also Figures S2C–S2H. (F) Graph presenting the distribution of normalized pixels intensity (relative pixel intensity, 0–1) acass="Chemical">ross the Casass="Chemical">parian strip (distance in μm) for ass="Chemical">pan class="Gene">CASP1-GFP fluorescence (cyan) and UCC1 immunofluorescence (red, Dylight 633). Light curves represent individual replicates coming from individual plants (n = 4). Each replicate is the average pixel intensity across a segment of 25 μm along the Casparian strip axis. Dark curves represent the mean values for CASP1-GFP and UCC1 immunofluorescence. When we analyzed the localization of mCherry-ass="Gene">UCC1 in plants expressing ass="Chemical">pan class="Gene">CASP1-GFP, we observed a similar pattern of localization at the CS as seen in the maximum projection view of endodermal cells in Figure 2C. However, at higher magnification, in both the median and surface views, we observed mCherry-UCC1 to occupy a more central position in comparison with CASP1-GFP. This was further confirmed using super-resolution structured illumination microscopy (Figure S2B). Moreover, CASP1-GFP does not form a homogeneous domain but is found to accumulate more at the periphery of the CS and less in the center where UCC1 is observed. Subsequently, we checked whether mCherry-UCC1 colocalizes with lignin deposition in the CS (Figure S2C). At the early stage of endodermal differentiation, lignin presents a nearly perfect colocalization with mCherry-UCC1. However, the line expressing mCherry-UCC1 also presents ectopic lignification later in development. This ectopic lignification is similar to that observed in other CS mutants such as casp1casp3 and esb1 [6, 7]. Expression of mCherry-UCC1 in two independent lines also delayed the formation of a functional barrier to PI, and this is not the case for plants expressing the same construct with no mCherry. It also promotes a significant increase of suberin deposition (Figures S2D–S2F). These observations taken together show that expressing UCC1 with a fluorescent tag in a WT background acts as a dominant negative mutation causing disruption of the CS. To establish whether the expression of mCherry-ass="Gene">UCC1 can affect the ass="Chemical">pattern of acass="Chemical">pan class="Chemical">cumulation of CASP1-GFP presented in Figures 2C and S2B, we examined plants expressing CASP1-GFP only (Figure 2D). CASP1-GFP is still more accumulated at the periphery, and this was also observed for another member of the CS machinery ESB1-mCherry. Immunolocalization confirmed that native UCC1 protein is specifically localized to the CS (Figures 2E and S2G). Its CS localization was reduced in ucc1.2, further decreased in ucc1.2ucc2.1 mutants, and abolished in an myb36 mutant (Figures S2G and S2H). This difference between ucc1.2 and ucc1.2ucc2.1 shows that the antibody is promiscuous and able to bind to UCC2, strongly suggesting a CS localization for UCC2. Immunolocalization confirmed our previous observations of a central localization of UCC1 in the CS as compared with CASP1-GFP (Figure 2E). Quantification of pixel intensity across the CS reveals that UCC1 is highly accumulated in the middle of the CS, where CASP1-GFP is less accumulated compared with the periphery of the CS domain (Figure 2F). The CASP1 domain of the plasma membrane is defined as a microdomain [30] as its width is around 1.5 μm. UCC1 with a more central accumulation has a width equal or slightly smaller than 1 μm, UCC1 can then be classified as a nanodomain of the CS. This subdomain structure has not been previously reported. However, previous studies for CASP1, ESB1, and PER64 [7, 31] do appear to show an enrichment of these proteins at the periphery of the CS. This means that the level of organization observed at the plasma membrane for CASP1 is conserved for cell wall proteins such as ESB1 and PER64. To date, UCC1 is the only protein found in the central nanodomain of the CS, revealing a new level of internal structure within the CS. To characterize the formation of the ass="Gene">UCC1 and ass="Chemical">pan class="Gene">CASP1 subdomains, we tracked endodermal differentiation cell-by-cell. CASP1-GFP and mCherry-UCC1 are found to be accumulated in the endodermis concomitantly between 4 and 6 cells after the onset of elongation, at the periphery of the cells and not yet at the CS (Figures 3A and 3B), which is consistent with a common transcriptional regulation by MYB36. We then tracked the central accumulation of CASP1-GFP and mCherry-UCC1 at the CS. We observed that the localization of CASP1-GFP and mCherry-UCC1 at the CS mainly occurs at the eighth endodermal cell after the onset of elongation (Figure 3B). However, mCherry-UCC1, but not CASP1-GFP, was observed to be centrally localized in several independent events at the seventh cell after the onset of elongation. This suggests that CASP1 localization at the CS is not required for the recruitment of UCC1. This was further confirmed by the normal accumulation of UCC1 at the CS in a casp1casp3 mutant (Figures 3C and S3A). However, UCC1 is not able to form a continuous domain in casp1casp3 as in WT. This was also observed in the esb1, sgn3, and esb1sgn3 mutants. We then tested the reciprocity to know whether UCC1 and UCC2 are required for CASP1-GFP localization (Figure 3D). In the ucc1.1 and ucc1.1ucc2.1 mutants, CASP1-GFP is able to localize at the CS domain and form a continuous domain without disruption. This demonstrates that UCC1 and UCC2 are not required for CASP1 localization to the CS domain. However, the absence of UCC1 and UCC2 does affect CASP1-GFP localization at a nanoscale resolution (Figures 3E and 3F). The exclusion of CASP1-GFP from the central nanodomain of the CS is reduced in the ucc1 mutants and tends to disappear in the double ucc1.1ucc2.1 mutant. This indicates a role for UCC1 and UCC2 in the formation of the central CS nanodomain. We then tested whether ROS production and lignin polymerization are required for the exclusion of CASP1-GFP from the central nanodomain. We observed that CASP1-GFP is still more accumulated at the periphery of the CS when ROS production is abolished in a rbohf mutant (Figures S3B and S3C) [12, 15] and when lignin polymerization is prevented using piperonilyc acid, an inhibitor of the phenylpropanoid pathway [10, 32]. This suggests a direct role for UCC1 and UCC2 in excluding CASP1-GFP from the central nanodomain of the CS.
Figure 3

Relations between UCC1 Positioning and Other Components of the Casparian Strips Machinery

(A) Analysis of the spatial distribution of CASP1 and UCC1 at the endodermal cell junctions. Images were generated from the same plant co-expressing CASP1-GFP and mCherry-UCC1 using confocal microscopy. The numbers at the bottom of the figure indicate the number of cells after the onset of elongation. White arrows indicate the central accumulation for CASP1-GFP or mCherry-UCC1. Scale bar, 6 μm.

(B) Histograms showing the frequency distribution (Frequency [%]) of the onset of expression (upper plot, n = 18) and the onset of localization at the Casparian strip of CASP1-GFP and mCherry-UCC1 (lower plot, n = 28).

(C) Maximum intensity projection (left) and surface view (right) of UCC1 immunolocalization (red) at 10 cells after the onset of elongation in WT plants and a collection of Casparian strips mutants: casp1 casp3, esb1, sgn3, esb1 sgn3. White arrows show gaps in the UCC1 localization. Scale bar, 20 μm for the maximum projections and 2 μm the surface views. see also Figure S3A.

(D) Maximum intensity projection of CASP1-GFP localization in cleared root of WT plants and the mutants ucc1.1 and ucc1.1 ucc2.1. Scale bar, 20 μm.

(E) Surface view of the localization of CASP1-GFP in cleared root of WT plants and the mutants: ucc1.1, ucc1.2, and ucc1.1 ucc2.1. Scale bar, 2 μm.

(F) Quantification of normalized pixels intensity (relative pixel intensity; 0–1) across the Casparian strip in plants expressing CASP1-GFP. The plots are showing the intensity profile for individual replicates (n ≥ 10), the mean value (black line), and the 95% confidence interval (gray interval). Each replicate corresponds to the quantification of one picture containing a Casparian strip segment of approximately 25 μm long. The pictures were generated at the 15th cells after the onset of elongation from at least 8 individual plants per genotype. Intensity profiles across the Casparian strip were always measured in the same orientation—from the cortical side toward the pericycle side of the endodermis. Letters indicate statistically significant differences between genotypes for the intensity values comprised between the dashed lines using an ANOVA and Tukey’s test as post hoc analysis (p < 0.01) (see also Figures S3B and S3C).

Relations between ass="Gene">UCC1 Positioning and Other ass="Chemical">pan class="Chemical">Components of the Casparian Strips Machinery (A) Analysis of the spatial distribution of ass="Gene">CASP1 and ass="Chemical">pan class="Gene">UCC1 at the endodermal cell junctions. Images were generated from the same plant co-expressing CASP1-GFP and mCherry-UCC1 using confocal microscopy. The numbers at the bottom of the figure indicate the number of cells after the onset of elongation. White arrows indicate the central accumulation for CASP1-GFP or mCherry-UCC1. Scale bar, 6 μm. (B) Histograms showing the frequency distribution (Frequency [%]) of the onset of expression (upper plot, n = 18) and the onset of localization at the Casparian strip of pan class="Gene">CASP1-GFP and mCherry-ass="Chemical">pan class="Gene">UCC1 (lower plot, n = 28). (ass="Species">C) Maximum intensity projection (left) and surface view (right) of ass="Chemical">pan class="Gene">UCC1 immunolocalization (red) at 10 cells after the onset of elongation in WT plants and a collection of Casparian strips mutants: casp1 casp3, esb1, sgn3, esb1 sgn3. White arrows show gaps in the UCC1 localization. Scale bar, 20 μm for the maximum projections and 2 μm the surface views. see also Figure S3A. (D) Maximum intensity projection of ass="Gene">CASP1-GFP localization in cleared root of WT plants and the mutants ass="Chemical">pan class="Gene">ucc1.1 and ucc1.1 ucc2.1. Scale bar, 20 μm. (E) Surface view of the localization of ass="Gene">CASP1-GFP in cleared root of WT plants and the mutants: ass="Chemical">pan class="Gene">ucc1.1, ucc1.2, and ucc1.1 ucc2.1. Scale bar, 2 μm. (F) Quantification of normalized pixels intensity (relative pixel intensity; 0–1) acass="Chemical">ross the Casass="Chemical">parian strip in plants expressing ass="Chemical">pan class="Gene">CASP1-GFP. The plots are showing the intensity profile for individual replicates (n ≥ 10), the mean value (black line), and the 95% confidence interval (gray interval). Each replicate corresponds to the quantification of one picture containing a Casparian strip segment of approximately 25 μm long. The pictures were generated at the 15th cells after the onset of elongation from at least 8 individual plants per genotype. Intensity profiles across the Casparian strip were always measured in the same orientation—from the cortical side toward the pericycle side of the endodermis. Letters indicate statistically significant differences between genotypes for the intensity values comprised between the dashed lines using an ANOVA and Tukey’s test as post hoc analysis (p < 0.01) (see also Figures S3B and S3C). Knowing that ass="Gene">UCC1 localizes at the ass="Chemical">pan class="Chemical">CS (Figures 2C–2F) and mutations in UCC1 and UCC2 cause a strong defect in root apoplastic permeability (Figures 1C and S1B), we looked at lignin deposition at the CS in ucc1&2 mutants (Figure S4A). Mutations in UCC1 and/or UCC2 do not cause an obvious disruption in the CS as observed in casp1casp3, esb1, sgn3 (Figure S4A), and other previously identified CS mutants, where clear gaps can be observed [3, 5, 6, 7, 11, 13, 14, 15, 33]. Further, there is no additivity between ucc1, esb1, and casp1casp3 observed for the deposition of ectopic lignin (Figure S4A). Importantly, mutations in UCC1 do reduce the amount of lignin in the central nanodomain of the CS, as observed using confocal imaging (Figure 4A), and super-resolution structured illumination microscopy (Figure 4B). Pixel quantification across the CS reveals that ucc1 mutants show a lower lignification in the central nanodomain (Figure 4B) where UCC1 accumulates (Figures 2C–2F). This decrease is not observed in ucc2.1. A further decrease is observed in the double mutant ucc1.2ucc2.1 in comparison with ucc1 mutants. This is consistent with the increased root permeability observed in ucc1.2ucc2.1 in comparison with the single mutants (Figures 1C and S1B). This reveals that CS permeability can be strongly affected in the absence of clear gaps in the CS. Furthermore, we observed ectopic lignification on the cortical side of the endodermis on a few occasions in the ucc1 mutants and at a higher frequency in the double mutant ucc1.2ucc2.1 (Figures 4A, 4B, and S4). This is a typical phenotype, along with increased suberin deposition, that is due to the SGN3-dependent compensatory mechanism observed in most mutants with defective CS [2, 5, 6, 7, 12]. However, the ectopic lignification and enhanced suberization are observed to a lesser degree in ucc1.2ucc2.1 in comparison with other CS mutants such as casp1casp3 and esb1 mutants (Figures 1D, 4, S1C, and S4). This could be explained by a more conditional leakiness of the CS in ucc1ucc2 mutants. Discontinuities below the resolution of light microscopy could occur in ucc1ucc2 mutants. This could lead to a full permeability for low molecular weight compounds, such as ions and PI, but an intermediate permeability for high molecular weight compounds, such as the CIF peptides required for ectopic lignification and enhanced suberization [13, 14].
Figure 4

UCC1 and UCC2 Are Necessary for the Central Lignification of the Casparian Strip

(A) Surface view of the Casparian strip lignin stained with Basic fuchsin in WT plants and the mutants ucc2.1, ucc1.1, ucc1.2, and ucc1.2 ucc2.1. Whites arrows show lack of lignification in the central domain of the Casparian strip across the different genotypes. Scale bar, 2 μm. see also Figure S4A.

(B) Quantification of normalized pixels intensity (0–1) (relative pixel intensity) across the Casparian strip using surface views as shown in (A). The plots show the intensity profile for individual plants (n ≥ 13). In the figure, the mean value is represented by a black line and the 95% confidence interval is in gray. The data were generated using individual pictures containing a Casparian strip segment of approximately 25 μm long. The pictures were taken at the 15th cells after the onset of elongation and the intensity profiles were measured in the same direction, from the cortex side toward the pericycle side of the endodermis. Letters indicate statistically significant differences between genotypes using an ANOVA and Tukey’s test as post hoc analysis (p < 0.01) (see also Figure S4B).

ass="Gene">UCC1 and ass="Chemical">pan class="Gene">UCC2 Are Necessary for the Central Lignification of the Casparian Strip (A) Surface view of the Casparian strip ass="Chemical">lignin stained with ass="Chemical">pan class="Chemical">Basic fuchsin in WT plants and the mutants ucc2.1, ucc1.1, ucc1.2, and ucc1.2 ucc2.1. Whites arrows show lack of lignification in the central domain of the Casparian strip across the different genotypes. Scale bar, 2 μm. see also Figure S4A. (B) Quantification of normalized pixels intensity (0–1) (relative pixel intensity) acass="Chemical">ross the Casass="Chemical">parian strip using surface views as shown in (A). The plots show the intensity profile for individual plants (n ≥ 13). In the figure, the mean value is represented by a black line and the 95% ass="Chemical">pan class="Chemical">confidence interval is in gray. The data were generated using individual pictures containing a Casparian strip segment of approximately 25 μm long. The pictures were taken at the 15th cells after the onset of elongation and the intensity profiles were measured in the same direction, from the cortex side toward the pericycle side of the endodermis. Letters indicate statistically significant differences between genotypes using an ANOVA and Tukey’s test as post hoc analysis (p < 0.01) (see also Figure S4B). In ass="Chemical">conclusion, this study reveals the first loss-of-function phenotype for members of the plant-specific ass="Chemical">pan class="Species">blue copper protein family of phytocyanins. Several studies suggested their implication in lignin polymerization [25, 26, 27], but this has never previously been shown. Our analysis indicates a role for the uclacyanins in the deposition of lignin in a newly discovered nanoscale domain within the CS. Further, the subcellular localization of UCC1, and the phenotype of the ucc(s) mutants, reveals a sub-compartmentalization of the machinery required for lignin polymerization at the CS.

STAR★Methods

Key Resources Table

Resource Availability

Lead Contact

Further information and requests for resources and reagents should be directed to and will be fulfilled by the Lead ass="Chemical">Contact, David E ass="Chemical">pan class="Chemical">Salt (David.Salt@nottingham.ac.uk).

Material Availability

Materials from this study are available on request.

Data and Code Availability

This study did not generate or ANALYZE datasets or pan class="Chemical">code.

Experimental Model and Subject Details

Plant material

ass="Species">Arabidopsis thaliana eass="Chemical">pan class="Chemical">cotype Columbia (Col_0) and the following mutants and transgenic lines were used in this study: ucc1.1 (this study), ucc1.2 (this study), sgn3 (sgn3.3; SALK_043282 [5]), myb36 (myb36.2; GK-543B11 [2]), casp1 casp3 (casp1.1 casp3.1 [7]), pCASP1::CASP1-GFP [7], pESB1::ESB1-mCherry [6], ucc2.1 (GK_250F04), ucc2.2 (salk_049638) and rbohf (salk_059888 [15]). The ass="Chemical">corresponding gene AGI are: ass="Chemical">pan class="Gene">UCC1, AT2G32300; UCC2, AT2G44790; SGN3, At4g20140; ass="Gene">MYB36, At5g57620; ass="Chemical">pan class="Gene">CASP1, At2g36100; CASP3, AT2G27370; pan class="Gene">ESB1, At2g28670; ass="Chemical">pan class="Gene">RBOHF, At1g64060.

Growth Conditions

All seeds were surface sterilized, and then stratified for two days at 4°C. Seeds were directly germinated on plates ass="Chemical">containing MS medium (Murashige and Skoog, Sigma) solidified with 0.8% ass="Chemical">pan class="Chemical">agar, pH 5.7, and grown in a vertical position in a growth chamber under long-day conditions (16 h light 22°C/8 h dark 19°C, light intensity 100μE). The lignin biosynthesis inhibitor piperonylic acid (PA, Sigma Aldrich) was used at the concentration of 10 μM from germination. Seedlings were analyzed at 6-day-old for microscopy analysis, and 2-week-old for ionomic analysis.

Method Details

Generation of transgenic lines and CRISPR/Cas9 mutants

The line pass="Gene">UCC1::mCherry-ass="Chemical">pan class="Gene">UCC1 was obtained using Gateway Cloning Technology (Invitrogen). A genomic DNA fragment containing the UCC1 promoter (−3083bp before ATG), the UCC1 5′UTR and the UCC1 signal peptide (+78bp after ATG) was amplified by PCR using the following primers: F: GGGGACAACTTTGTATAGAAAAGTTGGTTGAATTTCGTAAGAGTTAGG and R: GGGGACTGCTTTTTTGTACAAACTTGCATGGTCAGTAGCTACTGTTAAACC; and cloned in a pDONR P4-P1R. A second fragment containing the rest of the genomic UCC1 sequence (from +79 to +1081 from ATG) was amplified by PCR with the primers: F: GGGGACAGCTTTCTTGTACAAAGTGGTAACCATTGGTGGTCCTAGTGGTTGG and R: GGGGACAACTTTGTATAATAAAGTTGACCCATATAAATTGTAATAATGTATTATAAAC and cloned in a pDONR P2R-P3. Both fragments and a pEN-L1-mCherry-L2 vector were assembled in the expression vector pB7m34GW [34]. The line pass="Gene">UCC1::ass="Chemical">pan class="Gene">UCC1 was obtained using Gateway Cloning Technology. A genomic DNA fragment containing the UCC1 promoter (−3083bp before ATG) was amplified by PCR using the following primers: F: GGGGACAACTTTGTATAGAAAAGTTGGTTGAATTTCGTAAGAGTTAGG and R: GGGGACTGCTTTTTTGTACAAACTTGGATGACATATGGTGTCAAATGTGTG; and cloned in a pDONOR P4-P1R. A second fragment containing the genomic UCC1 sequence was amplified by PCR with the primers: GGGGACAAGTTTGTACAAAAAAGCAGGCTCGGCACAAAACATCATCATCTCTTG and R: GGGGACCACTTTGTACAAGAAAGCTGGGTCCCATATAAATTGTAATAATGTATTATAAAC; and cloned in a pDONOR P1-P2. Both fragments and a vector were assembled in the expression vector pH7m24GW. The ass="Chemical">construct pass="Chemical">pan class="Gene">UCC1::GFP-GUS was generated using Gateway cloning technology. The UCC1 promoter (−3083bp to −83bp before ATG) was amplified by PCR with these primers: F: GGGGACAAGTTTGTACAAAAAAGCAGGCTGTTGAATTTCGTAAGAGTTAGG; Primer R: GGGGACCACTTTGTACAAGAAAGCTGGGTATGACATATGGTGTCAAATGTGTG and cloned in pBGWFS7 [35]. Following Agrobacterium strain pan class="Chemical">GV3101 transformation with the resulting vector, transgenic plants were generated by floral dipping [39]. The ass="Gene">ucc1.1 and ass="Chemical">pan class="Gene">ucc1.2 mutants were obtained using CRISPR/Cas9 according to [36]. Two sgRNA targeting UCC1 coding sequence (GTCCTCGCTACTACACTCA and GGTCCTAGTGGTTGGACTG) were inserted in to the pHEE401 vector following Agrobacterium strain GV3101 transformation with the resulting vector, transgenic plants were generated by floral dipping [39]. Two individual homozygous lines (ucc1.1; ucc1.2) were identified at the generation T1.

Phylogeny

A BLASTP was performed using ass="Gene">UCC1 amino acid sequence against the Araport11 protein sequences dataset [40]. Only the matches with an Expect value (E-value) lower than 0.05 were ass="Chemical">pan class="Chemical">considered. A first alignment was performed to select the protein sequence containing the amino acid required for copper binding as described in [19]. Genes were named and classified as stellacyanin, uclacyanin and plantacyanin according to the amino acid binding copper as described in [41]. A second alignment and tree assembling were performed using Clustal Omega with amino acid sequence of the putative copper containing protein [42].

Endodermal spatio-temporal expression pattern

The spatio-temporal endodermal expression pattern of the pan class="Chemical">corresponding genes was checked using the Bio-Analytic Resource database from the AtGenExpress ass="Chemical">pan class="Chemical">Consortium [43].

Gene expression analysis

The plants were grown for 6 days on 1/2 M/S plates. Seeds were sown in three parallel lines per square plates (12∗12 cm) at high density. The first 5 mm of root tips were ass="Chemical">collected. One plate was used as a biological replicate. The samples were snap-frozen at harvest and ground into fine powder in a 2 mL centrifuge tube. Total RNA was extracted acass="Chemical">pan class="Chemical">cording to [44]. Samples were homogenized in 400 μL of Z6-buffer containing 8 M guanidine-HCl, 20 mM MES, 20 mM EDTA pH 7.0 After the addition of 400 μl phenol:chloroform:isoamylalcohol, 25:24:1, samples were vortexed and centrifuged (15,000 g 10 min.) for phase separation. The aqueous phase was transferred to a new 1.5 mL tube and 0.05 volumes of 1 N acetic acid qnd 0.7 volumes 96% ethanol was added. The RNA was precipitated at −20°C overnight. Following centrifugation (15,000 g 10 min, 4°C), the pellet was washed with 200μL 3M sodium acetate at pH 5.2 and 70% ethanol. The RNA was dried and dissolved in 30 μL of ultrapure water and store at −80°C until use. DNase treatment (DNase I, Amplification Grade, 18068015, Invitrogen) was carried out on the samples to remove genomic DNA. The RNA Concentration and quality were determined using Qubit (Invitrogen; Q10210) and TapeStation (Agilent; G2991A) protocols. Librairies were generated using the Lexogen Quant Seq 3′ mRNA Seq (FWD) Library Prep Kit (Lexogen; 015) which employs polyA selection to enrich for mRNA. Library yield was measured by Qubit (Invitrogen; Q10210) and TapeStation (Agilent; G2991A) systems. protocols to determine concentration and library size, these are then pooled together in equimolar concentrations. The concentration of the pool of libraries were confirmed using the Qubit and qPCR and then loaded onto an Illlumina NextSeq 500 on a NextSeq 500/550 High Output Kit v2.5 (75 Cycles) (Illumina; 20024906), to generate approximately 5 million 75bp single-end reads per sample. Initial quality assessment of the Illumina RNA-Seq reads was performed using FastQC v0.11.8. (Babraham Bioinformatiass="Chemical">cs, Cambridge, UK). Trimmomatic v0.36 was used to identify and RNA-Seq read processing discard reads ass="Chemical">pan class="Chemical">containing the Illumina adaptor sequence [45]. The resulting high-quality reads were then mapped against the TAIR10 Arabidopsis reference genome using HISAT2 v2.1.0 with default parameters [46]. The featureCounts function from the Subread package was then used to count reads that mapped to each one of the 27,206 nuclear protein-coding genes. To visualize the expression of the different genes sets we applied the DESeq2 v.1.24.0 package variance stabilizing transformation to the raw ass="Chemical">count gene matrix [47]. We then standardized each gene along the samples to generate a standardized matrix. This standardized matrix was used to visualize the expression of genes acass="Chemical">pan class="Chemical">ross the genotypes assayed. Boxplot of expressions were constructed using the R package ggplot2 [48].

Ionome analysis

The shoot elemental ass="Chemical">content was measured using Inductively ass="Chemical">pan class="Chemical">Coupled Plasma Mass Spectrometry (ICP-MS) and the analysis was performed as described [49]. Briefly, shoots of 2-week-old plants grown on agar plates were harvested into Pyrex test tubes (16 × 100 mm) to be then dried at 88°C for 20 h. After weighing the appropriate number of samples (these weights were used to calculate the weights of rest of the sample), the trace metal grade nitric acid Primar Plus (Fisher Chemicals) spiked with indium internal standard was added to the tubes (1 mL per tube). The samples were then digested in a dry block heater (DigiPREP MS, SCP Science; QMX Laboratories, Essex, UK) at 115°C for 4 h. The digested samples were diluted to 10 mL with 18.2 MΩcm Milli-Q Direct water (Merck Millipore). Elemental analysis was performed using an ICP-MS, PerkinElmer NexION 2000 equipped with Elemental Scientific Inc. autosampler, in the collision mode (He). Twenty-three elements (Li, B, Na, Mg, P, S, K, Ca, Mn, Fe, Co, Ni, Cu, Zn, As, Rb, Sr, Mo, Cd) were monitored. Liquid reference material composed of pooled samples was prepared before the beginning of sample run and was used throughout the whole samples run. It was run after every ninth sample to correct for variation within ICP-MS analysis run. The calibration standards (with indium internal standard and blanks) were prepared from single element standards (Inorganic Ventures; Essex Scientific Laboratory Supplies Ltd, Essex, UK) solutions. Sample concentrations were calculated using external calibration method within the instrument software. Further data processing was performed using Microsoft Excel spreadsheet.

Histological staining of roots

ass="Chemical">Propidium iodide (PI) staining was performed as previously deass="Chemical">pan class="Gene">scribed [9]. 6day-old seedlings were incubated in 15 μM propidium iodide for 10 min in the dark, then incubated in water for 30 s, mounted in water using a slide and coverslip and immediately observed with microscope. Block of PI in the endodermis was quantified as the number of endodermal cells after onset of elongation. Onset of elongation was defined as the point where the length of an endodermal cell was more than twice its width. Root clearing and staining with ass="Chemical">Calcofluor White, ass="Chemical">pan class="Chemical">Basic Fuchsin and Auramine-O was performed using Clearsee solution according to [50]. Six-day old seedlings were fixed with 4% PFA for 60–120 min at 20°C. Seedlings were then washed twice for 1 min in 1x PBS and moved to the Clearsee solution (10% xylitol, 15% Sodium deoxycholate, 25% urea). For Basic Fuchsin staining, the seedlings were stained overnight in 0.2% Basic Fuchsin prepared in ClearSee. The next day, Basic Fuchsin solution was removed and the seedlings were washed twice for 60 min in ClearSee with gentle shaking. Auramine-O staining (0.1% in Clearsee) was performed as for Basic Fuchsin. For Calcofluor White staining, the seedlings were stained for 30 min in 0.1% Calcofluor White in ClearSee solution. The seedlings were washed twice in ClearSee for 30 min. ass="Chemical">Fluorol Yellow 088 staining of the ass="Chemical">pan class="Chemical">suberin was performed as previously described [8, 10]. Seedlings were incubated in Fluorol Yellow 088 (0.01%w/v, lactic acid) at 70°C for 30 min, rinsed with water and counterstained with aniline blue (0.5% w/v, water) at RT for 30 min in darkness, washed with water, and observed with a microscope.

UCC1 immunolocalization

ass="Chemical">Custom affinity-purified polyclonal anti-ass="Chemical">pan class="Gene">UCC1 antibodies were produced by Genscript, USA and were used as a primary antibody. Anti-UCC1 antibodies were generated in rabbits against a recombinant truncated UCC1 (TDHTIGGPSGWTVGASLRTWAAGQTFAVGDNLVFSYPAAFHD VVEVTKPEFDSCQAVKPLITFANGNSLVPLTTPGKRYFICGMPGHCSQGMKLEVNVVPTATVAPTA) produced in E. coli. ass="Gene">UCC1-immunolocalization was performed acass="Chemical">pan class="Chemical">cording to [51]. 6-day-old seedlings were vacuum infiltrated and fixed with 2% formaldehyde in MTSB buffer (microtubule-stabilizing buffer) supplemented with 0.1% Triton for 1 h. A stock solution of 2x MTSB was prepared with: 15 g PIPES, 1.90 g EGTA, 1.22 g MgSO4·7H2O and 2.5 g KOH and dissolved in a total volume of 500 mL water at pH 7.0 (adjusted with 10 M KOH). Seedlings were washed twice in water that was then replaced by 100% methanol. Methanol content in the wash was gradually decreased until its final concentration reached ∼20%. Seedlings were then washed twice in water and incubated in a cell wall digestion solution (0.2% Driselase, 0.15% Macerozyme in 2mM MES, pH 5.0) for 30 min at 37°C. After washing with MTSB buffer, the seedlings were incubated in a solution containing 3% IGEPAL CA-630, 10% DMSO in MTSB buffer for 15min at 37°C in order to permeabilize the cell membranes. Seedling were then washed 4 times with MTSB buffer and blocked using a blocking solution containing 2% albumin fraction V BSA in MTSB buffer for 20 min at room temperature. The primary anti-UCC1 antibody was diluted (1/500) in the blocking solution and added to the seedlings for 1 h incubation at 37°C.Then seedlings were washed twice with MTSB buffer and incubated with the secondary antibody goat anti-Rabbit IgG DyLight 633 (Invitrogen) in MTSB buffer for 1 h at 37°C. After washing three times in MTSB buffer, the seedlings were mounted on microscopic slides in MTSB buffer for the microscopy analysis. Antibody specificity was tested on myb36, ucc1.2 and ucc1.2ucc2.1 mutants and by using no primary antibody as a negative control. Pixel intensity quantification was performed along a 1.2 μm-wide line following the CS (defined as Dylight 633 signal) in WT, ucc1.2 and ucc1.2 ucc2 using Fiji. For “No primary Ab” control and myb36, pixel intensity was measures in the endodermal cells at random locations due to the absence of visible CS.

Microscopy

Laser scanning ass="Chemical">confocal micass="Chemical">pan class="Chemical">roscopy was performed with a Zeiss LSM500 and a Leica SP8. Structured illumination microscopy was performed with a Zeiss PS1 Super Resolution Microscope. The following excitation and emission detection settings were applied: Calcofluor White, 405 nm/425-475 nm; GFP, 488 nm/500-550 nm; Fluorol yellow 088, 488 nm/500-550 nm; Auramine-O 488nm/505-530nm; propidium iodide, 561 nm/600-620 nm; Basic Fuchsin, 561 nm/570-650 nm; mCherry, 561 nm/ 570-620 nm; Dylight 633, 633 nm/640-670 nm.

Pixel intensity quantification across the Casparian strip

Images of ass="Chemical">CS surface view were analyzed for ass="Chemical">pan class="Gene">CASP1-GFP, lignin (Basic fuchsin), mCherry-UCC1 and DyLight 633 using Fiji [37]. A segmented line with a width of at least 3.8 μm was traced along the central part of the CS. This selection was then straighten using the “Straighten…” function. A profile of pixels intensity along the y axis was then generated from the pericycle side toward the cortical side. Each replicate represents the average value of pixels intensity across 13 μm approximately and it was generated from one picture. The pixels intensity values were normalized to compare the profile of pixel intensity across the different pictures. The intensity values were scaled from 0 to 1 using the following formula: (x-xMIN)/(xMAX-xMIN). In order to obtain a normalization based solely on CS signal and not on ectopic lignification, the values corresponding to ectopic lignification were intentionally omitted, in the cases the fluorescence signal intensity coming from ectopic lignification (corner of the endodermal cells) was higher than the one coming from the CS itself in the single picture. The profiles of normalized pixel intensity were plotted using PlotTwist [38] and RStudio. Statistical analysis was performed on normalized data in the ranges defined in the figures.

Timing of expression and localization of CASP1 and UCC1

The timing of ass="Gene">CASP1 and ass="Chemical">pan class="Gene">UCC1 accumulation and localization at the CS domain were quantified as number of cells after the onset of elongation as previously described [31, 33]. The cell number for the endodermal accumulation of CASP1 and UCC1 was determined in the first cell after the onset of elongation where GFP or mCherry signal were detectable using confocal microscopy.

Quantification and Statistical Analysis

For all the experiments, detail of statistical tests used and error-bars on barplots are indicated in the figure legends.
REAGENT or RESOURCESOURCEIDENTIFIER
Antibodies

Rabbit polyclonal anti-UCC1This paperN/A
Goat anti-Rabbit IgG (H+L) Secondary Antibody, DyLight 633InvitrogenSA5-10034, RRID:AB_2556614

Chemicals, Peptides, and Recombinant Proteins

MS basal salt mixture, powderSigma-AldrichM5524
AgarSigma-AldrichP49805, CAS: 94-53A7921, CASS: 9002-18-01
Piperonylic acidSigma-AldrichP49805, CAS: 94-53-1
guanidine-HClSigma-AldrichG7294
MESSigma-AldrichM8250CAS: 1266615-59-1
EDTASigma-AldrichEDS, CAS:60-00-4
Phenol:chloroform:isoamylalcohol, 25:24:1Sigma-AldrichP2069
Acetic acidSigma-AldrichA6283CAS: 64-19-7
Sodium acetateSigma-AldrichS2889CAS, 127-09-3
DNase I, Amplification GradeInvitrogen18068015
Nitric acid Primar PlusFisher ChemicalsN/2272/PB17CAS: 7697-37-2
Propidium iodideInvitrogenP1304MP, CAS: 25535-16-4
Calcofluor WhitePolysciences,CAT#4359
Basic FuchsinFluka, AnalyticalCAS: 58969-01-0
Auramine-OSigma-AldrichSLA 1027 CAS: 2465-27-2
paraformaldehydeSigma-AldrichP6148, CAS:3052-89-4
xylitolSigma-AldrichW507930, CAS: 87-99-0
Sodium deoxycholateSigma-AldrichD6750, CAS: 302-95-4
ureaSigma-AldrichU5378, CAS:57-13-6
Fluorol Yellow 088Santa Cruz BiotechnologySC215052, CAS: 81-37-8
PIPESSigma-AldrichP-3768, CAS: 76836-02-7
EGTASigma-AldrichE3889, CAS: 67-42-5
MgSO4·7H2OSigma-Aldrich63138, CAS:10034-99-8
KOHSigma-AldrichP5958, CAS:1310-58-3
MethanolSigma-Aldrich82762, CAS:67-56-1
DriselaseSigma-AldrichD9515, CAS:85186-71-6
MacerozymeDuchefacat. N M8002.0010
IGEPAL CA-630Sigma-AldrichI8896, CAS:9002-93-1
DMSOSigma-AldrichD8418, CAS: 67-68-5
albumin fraction V BSASigma-Aldrich10735078001

Critical Commercial Assays

QubitInvitrogenQ10210
TapeStationAglentG2991A
Lexogen Quant Seq 3′ mRNA Seq (FWD) Library Prep KitLexogen015

Experimental Models: Organisms/Strains

Arabidopsis thaliana Columbia 0 accession (Col-0)
ucc1.1, CRISPR line in Col-0This studyN/A
ucc1.2, CRISPR line in Col-0This studyN/A
sgn3.3, t-DNA line in Col-0[5]SALK_043282
myb36.2, t-DNA line in Col-0[2]GK-543B11
casp1.1 casp3.1, t-DNA line in Col-0[7]N/A
pCASP1::CASP1-GFP, line in Col-0[7]N/A
pESB1::ESB1-mCherry, line in Col-0[6]N/A
ucc2.1, t-DNA line in Col-0N/AGK_250F04
ucc2.2, t-DNA line in Col-0N/Asalk_049638
Rbohf, t-DNA line in Col-0[15]salk_059888
pUCC1::mCherry-UCC1, line in Col-0This studyN/A
pUCC1::GFP-GUS, line in Col-0This studyN/A
pUCC1::UCC1, line in Col-0This studyN/A

Oligonucleotides

For pUCC1::mCherry-UCC1GGGGACAACTTTGTATAGAAAAGTTGGTTGAATTTCGTAAGAGTTAGGThis studyN/A
For pUCC1::mCherry-UCC1GGGGACTGCTTTTTTGTACAAACTTGCATGGTCAGTAGCTACTGTTAAACCThis studyN/A
For pUCC1::mCherry-UCC1GGGGACAGCTTTCTTGTACAAAGTGGTAACCATTGGTGGTCCTAGTGGTTGGThis studyN/A
For pUCC1::mCherry-UCC1GGGGACAACTTTGTATAATAAAGTTGACCCATATAAATTGTAATAATGTATTATAAACThis studyN/A
For pUCC1::UCC1GGGGACAACTTTGTATAGAAAAGTTGGTTGAATTTCGTAAGAGTTAGGThis studyN/A
For pUCC1::UCC1GGGGACTGCTTTTTTGTACAAACTTGGATGACATATGGTGTCAAATGTGTGThis studyN/A
For pUCC1::UCC1GACAAGTTTGTACAAAAAAGCAGGCTCGGCACAAAACATCATCATCTCTTGThis studyN/A
For pUCC1::UCC1GGGGACCACTTTGTACAAGAAAGCTGGGTCCCATATAAATTGTAATAATGTATTATAAACThis studyN/A
For pUCC1::GFP-GUSGGGGACAAGTTTGTACAAAAAAGCAGGCTGTTGAATTTCGTAAGAGTTAGGThis studyN/A
For pUCC1::GFP-GUSGGGGACCACTTTGTACAAGAAAGCTGGGTATGACATATGGTGTCAAATGTGTGThis studyN/A

Recombinant DNA

pUCC1::mCherry-UCC1This studyN/A
pUCC1::GFP-GUSThis studyN/A
pEN-L1-mCherry-L2VIB [34],https://gatewayvectors.vib.be/collection/pen-l1-mcherry-l2
pB7m34GW,3VIB [34],https://gatewayvectors.vib.be/collection/pb7m34gw0
pH7m24GWVIB [34],https://gatewayvectors.vib.be/collection/ph7m24gw2
pBGWFS7VIB [35],https://gatewayvectors.vib.be/collection/pbgwfs7
pUCC1::UCC1This studyN/A
pHEE401[36]Addgene Plasmid # 71286

Software and Algorithms

Fiji[37]N/A
RThe R Project for Statistical ComputingN/A
PlotTwist[38]N/A
RStudioRStudioN/A
  46 in total

1.  Casparian strip diffusion barrier in Arabidopsis is made of a lignin polymer without suberin.

Authors:  Sadaf Naseer; Yuree Lee; Catherine Lapierre; Rochus Franke; Christiane Nawrath; Niko Geldner
Journal:  Proc Natl Acad Sci U S A       Date:  2012-06-04       Impact factor: 11.205

2.  A developmental framework for endodermal differentiation and polarity.

Authors:  Julien Alassimone; Sadaf Naseer; Niko Geldner
Journal:  Proc Natl Acad Sci U S A       Date:  2010-02-08       Impact factor: 11.205

3.  The MYB36 transcription factor orchestrates Casparian strip formation.

Authors:  Takehiro Kamiya; Monica Borghi; Peng Wang; John M C Danku; Lothar Kalmbach; Prashant S Hosmani; Sadaf Naseer; Toru Fujiwara; Niko Geldner; David E Salt
Journal:  Proc Natl Acad Sci U S A       Date:  2015-06-29       Impact factor: 11.205

4.  Role of LOTR1 in Nutrient Transport through Organization of Spatial Distribution of Root Endodermal Barriers.

Authors:  Baohai Li; Takehiro Kamiya; Lothar Kalmbach; Mutsumi Yamagami; Katsushi Yamaguchi; Shuji Shigenobu; Shinichiro Sawa; John M C Danku; David E Salt; Niko Geldner; Toru Fujiwara
Journal:  Curr Biol       Date:  2017-02-23       Impact factor: 10.834

Review 5.  The endodermis.

Authors:  Niko Geldner
Journal:  Annu Rev Plant Biol       Date:  2013-03-01       Impact factor: 26.379

6.  The structure of a phytocyanin, the basic blue protein from cucumber, refined at 1.8 A resolution.

Authors:  J M Guss; E A Merritt; R P Phizackerley; H C Freeman
Journal:  J Mol Biol       Date:  1996-10-11       Impact factor: 5.469

7.  A mechanism for localized lignin deposition in the endodermis.

Authors:  Yuree Lee; Maria C Rubio; Julien Alassimone; Niko Geldner
Journal:  Cell       Date:  2013-03-28       Impact factor: 41.582

8.  GATEWAY vectors for Agrobacterium-mediated plant transformation.

Authors:  Mansour Karimi; Dirk Inzé; Ann Depicker
Journal:  Trends Plant Sci       Date:  2002-05       Impact factor: 18.313

9.  Uclacyanins, stellacyanins, and plantacyanins are distinct subfamilies of phytocyanins: plant-specific mononuclear blue copper proteins.

Authors:  A M Nersissian; C Immoos; M G Hill; P J Hart; G Williams; R G Herrmann; J S Valentine
Journal:  Protein Sci       Date:  1998-09       Impact factor: 6.725

10.  Protocol: an improved and universal procedure for whole-mount immunolocalization in plants.

Authors:  Taras Pasternak; Olaf Tietz; Katja Rapp; Maura Begheldo; Roland Nitschke; Benedetto Ruperti; Klaus Palme
Journal:  Plant Methods       Date:  2015-10-28       Impact factor: 4.993

View more
  6 in total

1.  Three OsMYB36 members redundantly regulate Casparian strip formation at the root endodermis.

Authors:  Zhigang Wang; Baolei Zhang; Zhiwei Chen; Mingjuan Wu; Dong Chao; Qiuxing Wei; Yafeng Xin; Longying Li; Zhenhua Ming; Jixing Xia
Journal:  Plant Cell       Date:  2022-07-30       Impact factor: 12.085

2.  The metabolic and proteomic repertoires of periderm tissue in skin of the reticulated Sikkim cucumber fruit.

Authors:  Gulab Chand Arya; Yonghui Dong; Uwe Heinig; Nir Shahaf; Yana Kazachkova; Elinor Aviv-Sharon; Gal Nomberg; Ofir Marinov; Ekaterina Manasherova; Asaph Aharoni; Hagai Cohen
Journal:  Hortic Res       Date:  2022-04-22       Impact factor: 7.291

3.  High-order mutants reveal an essential requirement for peroxidases but not laccases in Casparian strip lignification.

Authors:  Nelson Rojas-Murcia; Kian Hématy; Yuree Lee; Aurélia Emonet; Robertas Ursache; Satoshi Fujita; Damien De Bellis; Niko Geldner
Journal:  Proc Natl Acad Sci U S A       Date:  2020-11-02       Impact factor: 11.205

Review 4.  Suberin Biosynthesis, Assembly, and Regulation.

Authors:  Kathlyn N Woolfson; Mina Esfandiari; Mark A Bernards
Journal:  Plants (Basel)       Date:  2022-02-19

5.  Development and diversity of lignin patterns.

Authors:  Aurélia Emonet; Angela Hay
Journal:  Plant Physiol       Date:  2022-08-29       Impact factor: 8.005

6.  Physiological roles of Casparian strips and suberin in the transport of water and solutes.

Authors:  Monica Calvo-Polanco; Zoe Ribeyre; Myriam Dauzat; Guilhem Reyt; Christopher Hidalgo-Shrestha; Patrick Diehl; Marc Frenger; Thierry Simonneau; Bertrand Muller; David E Salt; Rochus B Franke; Christophe Maurel; Yann Boursiac
Journal:  New Phytol       Date:  2021-10-21       Impact factor: 10.323

  6 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.