Literature DB >> 30845142

Multiple functional neurosteroid binding sites on GABAA receptors.

Zi-Wei Chen1,2, John R Bracamontes1, Melissa M Budelier1, Allison L Germann1, Daniel J Shin1, Krishnan Kathiresan3, Ming-Xing Qian3, Brad Manion1, Wayland W L Cheng1, David E Reichert2,4, Gustav Akk1, Douglas F Covey1,2,3, Alex S Evers1,2,3.   

Abstract

Neurosteroids are endogenous modulators of neuronal excitability and nervous system development and are being developed as anesthetic agents and treatments for psychiatric diseases. While gamma amino-butyric acid Type A (GABAA) receptors are the primary molecular targets of neurosteroid action, the structural details of neurosteroid binding to these proteins remain ill defined. We synthesized neurosteroid analogue photolabeling reagents in which the photolabeling groups were placed at three positions around the neurosteroid ring structure, enabling identification of binding sites and mapping of neurosteroid orientation within these sites. Using middle-down mass spectrometry (MS), we identified three clusters of photolabeled residues representing three distinct neurosteroid binding sites in the human α1β3 GABAA receptor. Novel intrasubunit binding sites were identified within the transmembrane helical bundles of both the α1 (labeled residues α1-N408, Y415) and β3 (labeled residue β3-Y442) subunits, adjacent to the extracellular domains (ECDs). An intersubunit site (labeled residues β3-L294 and G308) in the interface between the β3(+) and α1(-) subunits of the GABAA receptor pentamer was also identified. Computational docking studies of neurosteroid to the three sites predicted critical residues contributing to neurosteroid interaction with the GABAA receptors. Electrophysiological studies of receptors with mutations based on these predictions (α1-V227W, N408A/Y411F, and Q242L) indicate that both the α1 intrasubunit and β3-α1 intersubunit sites are critical for neurosteroid action.

Entities:  

Mesh:

Substances:

Year:  2019        PMID: 30845142      PMCID: PMC6424464          DOI: 10.1371/journal.pbio.3000157

Source DB:  PubMed          Journal:  PLoS Biol        ISSN: 1544-9173            Impact factor:   8.029


Introduction

Neurosteroids are cholesterol metabolites produced by neurons [1] and glia [2] in the central nervous system (CNS) that are thought to play important roles in both nervous system development and behavioral modulation [3]. Neurosteroid analogues are also being developed as sedative hypnotics [4], antidepressants [5], and anticonvulsants [6]. Gamma amino-butyric acid Type A (GABAA) receptors, the principal ionotropic inhibitory neurotransmitter receptors in the CNS, have been identified as the primary functional target of neurosteroids. The major endogenous neurosteroids—allopregnanolone and tetrahydroxy-desoxycorticosterone (THDOC)—are positive allosteric modulators (PAMs) of GABAA receptors, potentiating the effects of GABA at nanomolar concentrations and directly activating currents at micromolar concentrations. GABAA receptors are members of the pentameric ligand-gated ion channel (pLGIC) superfamily and are typically composed of two α subunits, two β subunits, and one γ or δ subunit [7]. There are 19 homologous GABAA receptor subunits (including six α, three β and two γ isoforms), with each subunit composed of a large extracellular domain (ECD), a transmembrane domain (TMD) formed by four membrane-spanning helices (TMD1–4), a long intracellular loop between TMD3 and TMD4, and a short extracellular C-terminus. These distinctive structural domains form binding sites for a number of ligands: GABA and benzodiazepines bind to the ECD, picrotoxin to the channel pore [8], and general anesthetics—such as propofol [9, 10], etomidate [11], barbiturates [12], and neurosteroids—to the TMDs [13-18]. Substantial evidence indicates that neurosteroids produce their effects on GABAA receptors by binding to sites within the TMDs [13–15, 19, 20]. Whereas the TMDs of β-subunits are critically important to the actions of propofol and etomidate [11, 21–26], the α-subunit TMDs appear to be essential for neurosteroid action. Mutagenesis studies in α1β2γ2 GABAA receptors identified several residues in the α1 subunit, notably Q241 in TMD1, as critical to neurosteroid potentiation of GABA-elicited currents [14, 27]. More recent crystallographic studies have shown that, in homo-pentameric chimeric receptors in which the TMDs are derived from either α1 [16] or α5 subunits [17], the neurosteroids THDOC and pregnanolone bind in a cleft between the α-subunits, with the C3-hydroxyl substituent of the steroids interacting directly with α1Q241. Neurosteroids are PAMs of these chimeric receptors, and α1Q241L and α1Q241W mutations eliminate this modulation. These studies posit a single critical binding site for neurosteroids that is conserved across the six α-subunit isoforms [14, 27]. A significant body of evidence also suggests that neurosteroid modulation of GABAA receptors may be mediated by multiple sites. Site-directed mutagenesis identified multiple residues that affect neurosteroid action on GABAA receptors, suggestive of two neurosteroid binding sites, with one site mediating potentiation of GABA responses and the other mediating direct activation [14, 27]. Single channel electrophysiological studies as well as studies examining neurosteroid modulation of [35S]t-butylbicyclophosphorothionate (TBPS) binding, have also identified multiple distinct effects of neurosteroids with various structural analogues producing some or all of these effects, consistent with multiple neurosteroid binding sites [28-30]. Finally, neurosteroid photolabeling studies in the bacterial pLGIC, Gloeobacter ligand-gated ion channel (GLIC), demonstrate two neurosteroid binding sites per monomer [31], one analogous to the canonical intersubunit site and one located in an intrasubunit pocket previously shown to bind propofol [32, 33] and the inhalational anesthetics [33, 34]. Both of these sites contribute to neurosteroid modulation of GLIC currents, suggesting the possibility of analogous sites in GABAA receptors. We have developed a suite of neurosteroid analogue photolabeling reagents with photolabeling groups positioned around the neurosteroid ring structure to identify all of the neurosteroid binding sites on GABAA receptors and determine the orientation of neurosteroid binding within each site. Photolabeling was performed in membranes from a mammalian cell line that stably expresses α1His-FLAGβ3 receptors (rather than in detergent-solubilized receptors) to optimize the likelihood that the receptors were in native conformations and environment. Finally, we deployed a middle-down mass spectrometry (MS) approach, coupled with a stable-heavy isotope encoded click chemistry tag for neurosteroid-peptide adduct identification to circumvent challenges associated with MS identification (predominantly neutral loss) and quantification of neurosteroid-peptide adducts [35]. Using these approaches, we have identified three clusters of neurosteroid-photolabeled residues on the human α1β3 GABAA receptor. Computational docking studies, guided by the photolabeling data, were used to describe three binding sites and the orientation of the neurosteroids within each site. The docking studies were also used to predict critical residues to test the contribution of each of these sites to neurosteroid modulation of GABAA currents. Site-directed mutagenesis of these sites and electrophysiological studies indicate that at least two of three structurally distinct sites contribute to allosteric modulation of GABA currents.

Results

Development and characterization of allopregnanolone-analogue photolabeling reagents

Allopregnanolone (3α-hydroxy-5α-pregnan-20-one) is a potent, endogenous PAM of GABAA receptors (Fig 1A). We synthesized three photolabeling analogues of allopregnanolone in which photolabeling moieties were placed at various positions around the steroid backbone. KK123 has a 6-diazirine photolabeling group on the C5-C6-C7 edge of the sterol, which is a likely binding interface with α-helices [36] and minimally perturbs neurosteroid structure [37]. KK123 is, however, an aliphatic diazirine and, as such, may preferentially label nucleophilic amino acids [38]. The two other reagents, KK202 and KK200, incorporate a trifluoromethylphenyl-diazirine (TPD) group at either the 3- or 17-carbon. These were designed to sample the space in the plane of the steroid off either the A-ring (KK202) or the D-ring (KK200). Following UV irradiation, TPD groups generate a carbene which can insert into any bond [39, 40]. Thus, while the TPD groups are bulky and removed several angstroms from the neurosteroid pharmacophore, they should form an adduct precisely at their binding site in the GABAA receptor. Where feasible (KK123, KK202), an alkyne was incorporated in the photolabeling reagents to allow attachment of a fluorophore, purification tag, or an MS reporter tag (FLI-tag) via click chemistry [35].
Fig 1

Allopregnanolone-analogue photolabeling reagents.

(A) The structure of allopregnanolone, KK123, KK200, and KK202. (B). Allopregnanolone (1 μM) and the photolabeling reagents (10 μM) potentiate GABA-elicited currents of α1β3-GABAA receptors; potentiation is blocked by mutation of α1Q242Lβ3, indicating that these photolabeling reagents mimic the action of allopregnanolone. The numerical data are included in S1 Data. AlloP, allopregnanolone; GABAA, gamma amino-butyric acid Type A; NS, neurosteroid; WT, wild-type.

Allopregnanolone-analogue photolabeling reagents.

(A) The structure of allopregnanolone, KK123, KK200, and KK202. (B). Allopregnanolone (1 μM) and the photolabeling reagents (10 μM) potentiate GABA-elicited currents of α1β3-GABAA receptors; potentiation is blocked by mutation of α1Q242Lβ3, indicating that these photolabeling reagents mimic the action of allopregnanolone. The numerical data are included in S1 Data. AlloP, allopregnanolone; GABAA, gamma amino-butyric acid Type A; NS, neurosteroid; WT, wild-type. A useful photoaffinity labeling reagent must bind to the same site on a protein as the ligand it mimics and should produce the same effects on protein functions. To determine whether our photoaffinity labeling reagents mimic allopregnanolone as modulators of GABAA receptor function, we assessed modulation of α1β3 GABAA receptors currents in Xenopus laevis oocytes, and enhancement of [3H]muscimol binding in human embryonic kidney (HEK) cell membranes expressing α1β3 GABAA receptors. KK123 enhanced GABA-elicited (0.3 μM) currents 4.2 ± 3.3-fold at 1 μM (n = 5 cells) and 8.2 ± 6.7-fold at 10 μM (n = 7). KK123 (10 μM) also directly activated α1β3 GABAA receptors, eliciting 6.3% ± 3.8% (n = 5) of the maximum current elicited by a saturating concentration of GABA. KK123 potentiation of GABA-elicited currents and direct activation were absent in α1Q242Lβ3 GABAA receptors, indicating that KK123 closely mimics the actions of allopregnanolone (the human α1Q242L mutation is equivalent to rat α1Q241L and is known to selectively prevent neurosteroid action (Fig 1B and Table 1) [14, 27]). KK200 and KK202 also potentiated GABA-elicited currents at 1 and 10 μM and directly activated the channels at 10 μM (Table 1). Positive allosteric modulation by KK202 was somewhat surprising, given that an ether-linked TPD group replaces the 3α-OH group thought to be critical for neurosteroid action [41, 42]. While the effects of KK200 were abolished in α1Q242Lβ3 receptors, the potentiation by KK202 was reduced by 50% in α1Q242Lβ3 receptors, suggesting that KK202 may have actions at both the canonical neurosteroid site and other binding sites. Because photolabeling experiments were performed in membranes prepared from cells expressing α1β3 GABAA receptors, we also examined the ability of the photolabeling reagents to enhance [3H]muscimol binding in these membranes. A stable HEK-293 cell line was established with tetracycline-inducible expression of human α1His-FLAG β3 GABAA receptors (See Materials and methods); receptor density in these membranes was 20–30 pmol [3H]muscimol binding/mg membrane protein. Consistent with previous determinations [43], the average stoichiometry of the receptors was estimated at two α1 subunits and three β3 subunits using MS label-free quantitation [44] (spectral count). Allopregnanolone enhanced [3H]muscimol binding to these recombinant receptors 4-fold with a half maximal effective concentration (EC50) of 3.9 ± 5.6 μM (S1 Fig). KK123, KK200, and KK202 all enhanced [3H]muscimol binding with EC50 values similar to or lower than allopregnanolone (S1 Fig). Collectively, the electrophysiology and radioligand binding data indicate that KK123, KK200, and KK202 are functional mimetics of allopregnanolone.
Table 1

AlloP and the photolabeling analogues modulate and activate α1β3-GABAA receptor currents in X. laevis oocytes, tested by two-electrode voltage clamp.

NeurosteroidsPotentiation1 μM NSPotentiation10 μM NSDirect activation10 μM NS
KK1234.2 ± 3.3 (5)8.2 ± 6.7 (7)6.3 ± 3.8 (5)
KK2001.6 ± 0.2 (5)4.9 ± 2.7 (5)0.14 ± 0.08 (5)
KK2021.4 ± 0.2 (6)3.9 ± 2.1 (9)8.97 ± 8.9 (6)
Potentiation0.1 μM AlloPPotentiation1 μM AlloPDirect activation10 μM AlloP
AlloP4.9 ± 1.3 (7)9.7 ± 4.7 (7)3.4 ± 1.2 (5)

Potentiation is expressed as potentiation response ratio, calculated as the ratio of the peak response in the presence of GABA and neurosteroids to the peak response in the presence of GABA alone. Direct activation is expressed as percentage of the response to saturating GABA. Data are shown as mean ± SD (number of cells).

Abbreviation: AlloP, allopregnanolone; GABAA, gamma amino-butyric acid Type A; NS, neurosteroid.

Potentiation is expressed as potentiation response ratio, calculated as the ratio of the peak response in the presence of GABA and neurosteroids to the peak response in the presence of GABA alone. Direct activation is expressed as percentage of the response to saturating GABA. Data are shown as mean ± SD (number of cells). Abbreviation: AlloP, allopregnanolone; GABAA, gamma amino-butyric acid Type A; NS, neurosteroid. To determine whether KK123—which contains an aliphatic diazirine—photolabels GABAA receptors, we utilized the butynyloxy (alkyne) moiety on KK123 to attach a biotin purification tag for selective enrichment of photolabeled GABAA receptor subunits. HEK-293 cell membranes containing α1β3 GABAA receptors were photolabeled with 15 μM KK123, solubilized in SDS, and coupled via Cu2+-catalyzed cycloaddition to MQ112 (S2A Fig), a trifunctional linker containing an azide group for cycloaddition, biotin for biotin-streptavidin affinity purification, and a cleavable azobenzene group for elution of photolabeled proteins. The photolabeled-MQ112-tagged receptors were bound to streptavidin beads and eluted by cleavage of the linker with sodium dithionite. The purified, photolabeled GABAA receptor subunits were assayed by western blot using anti-α1 and anti-β3. A band at 52 kDa was observed with both α1 and β3 subunit antibodies in the KK123 photolabeling group (S2B Fig), indicating that both α1 and β3 subunits are photolabeled by KK123. In control samples photolabeled with ZCM42—an allopregnanolone photolabeling analogue containing a diazirine at the 6-carbon but no alkyne (S2C Fig)—neither α1 nor β3 subunits were purified. These data indicated that KK123 can photolabel both α1 and β3 subunits and is thus an appropriate reagent to use for site identification. A 35 kDa band was intermittently observed in replicate anti-α1 western blots (S2B Fig); this is likely to be a proteolytic fragment of the α1-subunit that retains the antibody-recognition epitope but was not further analyzed.

Identification of KK123 photolabeling sites on α1 and β3 subunits of GABAA receptors

Identification of sterol adducts in hydrophobic peptides has been impeded by multiple challenges, including peptide insolubility during sample digestion, ineffective chromatographic separation of hydrophobic TMD peptides, and neutral loss of sterol adducts from small hydrophobic peptides during ionization and fragmentation. To circumvent these problems, we employed middle-down MS to analyze GABAA receptor TMD peptides and their sterol adducts. This approach identifies each TMD as a single, large peptide and attenuates neutral loss of adduct, facilitating identification of the sites of neurosteroid incorporation. In our studies, α1His-FLAGβ3 GABAA receptors were photolabeled in native HEK cell membranes. The photolabeled proteins were then solubilized in n-dodecyl-β-D-maltoside (DDM)-containing lysis buffer. The pentameric GABAA receptors were purified using anti-FLAG agarose beads, and eluted receptors were digested with trypsin in the presence of the MS-compatible detergent DDM. These conditions generated peptides containing each of the GABAA receptor TMDs in their entirety. The peptides were separated using PLRP-S nano-liquid chromatography and analyzed on a Thermo ELITE orbitrap mass spectrometer. This workflow (S3 Fig) minimized protein/peptide aggregation, simplified MS1-level identification of TMD-sterol adducts, and optimized fragmentation of TMD peptides and their adducts. All eight of the TMD peptides were reliably sequenced with 100% residue-level coverage. In addition, the covalent addition of neurosteroid to the TMD peptides increased the hydrophobicity of TMD peptides and shifted their chromatographic elution to later retention times (S3 Fig). The delayed retention time was used as a critical criterion for identification of photolabeled peptides. Two photolabeled peptides were found in the mass spectra of tryptic digests of α1β3 GABAA receptors photolabeled with KK123 (Fig 2A and S4 Fig). A KK123 adduct of the α1-TM4 peptide, 398IAFPLLFGIFNLVYWATLNREPQLK423 (m/z = 875.503, z = 4), was identified (add weight of KK123 = 316.27). Site-defining ions in the fragmentation spectra identified the site of KK123 insertion as Y415, at the C-terminus of α1-TM4 (underlined in the sequence; see Fig 2A). In a separate series of experiments, α1β3 receptors were photolabeled with KK123, which was then coupled to FLI-tag using click chemistry. FLI-tag, an azide-containing tag, adds both charge and a heavy/light stable isotope pair to a photolabeled peptide, enhancing identification by creating doublets in the MS1 spectra [35]. MS1 level search for pairs of ions differing by 10.07 mass units found two peptide ion features (m/z = 1,073.246 and m/z = 1,076.580, z = 3) that had identical chromatographic retention times (Fig 2B). Fragmentation spectra revealed both of these peptides as β3-TM4 peptide (426IVFPFTFSLFNLVYWLYVN445) with a KK123-FLI-tag adduct (adduct mass = 672.432 and mass = 682.441) on Y442 (Fig 2C). In the fragmentation spectrum, ions containing KK123 plus light FLI-tag (Fig 2C, black) were different by 10.07 mass units from the corresponding fragment ions from KK123 plus heavy FLI-tag (Fig 2C, red), confirming that KK123 photolabels Y442 of the β3 subunit. β3-Y442 is located on the C-terminus of β3-TM4 in a homologous position to α1-Y415, the KK123 photolabeling site in α1-TM4 (Fig 2D, upper right panel). Thus, KK123 labeling data identified two discrete sites, one in α1 and the other in β3. We employed additional photolabeling reagents containing TPD groups arrayed around the sterol backbone to confirm whether the KK123-labeled residues represent neurosteroid binding sites and to determine the orientation of the neurosteroids in these sites.
Fig 2

KK123 photolabels α1-TM4 and β3-TM4 peptides.

(A) A representative MS fragmentation spectrum of a KK123 photolabeled α1-TM4 peptide (m/z = 875.503, z = 4). The y9-y14 ions (red) contain the KK123 adduct. The site-defining ions y8 and y9 indicate that α1-Y415 (red) was photolabeled by KK123. Fragment ions y10− to y14− represent neutral loss of the KK123 adduct. (B). MS1 pair of light and heavy form of FLI-tag-KK123 photolabeled β3 TM4 peptide (m/z = 1,073.246 and m/z = 1,076.580, z = 3). (C) An overlay of light (black) and heavy (red) MS fragmentation spectra of FLI-tag-KK123 photolabeled β3 TM4 peptide. The KK123 adduct-containing b or y ions are labeled with “*”. Site-defining y4 and b17 ions identify β3-Y442 as the photolabeled residue. The photolabeled residues in α1- and β3-TM4 were identified in three replicate experiments. (D) KK123 photolabeled residues are shown in a homology model of the structure of an α1β3 GABAA receptor. In the α1 subunit, the labeled TM4 tyrosine (red) points toward TM1, whereas in the β3 subunit, the labeled tyrosine residue (orange) points toward TM3. The numerical data are included in S2 Data. GABAA, gamma amino-butyric acid Type A; MS, mass spectrometry; TM, transmembrane helix.

KK123 photolabels α1-TM4 and β3-TM4 peptides.

(A) A representative MS fragmentation spectrum of a KK123 photolabeled α1-TM4 peptide (m/z = 875.503, z = 4). The y9-y14 ions (red) contain the KK123 adduct. The site-defining ions y8 and y9 indicate that α1-Y415 (red) was photolabeled by KK123. Fragment ions y10− to y14− represent neutral loss of the KK123 adduct. (B). MS1 pair of light and heavy form of FLI-tag-KK123 photolabeled β3 TM4 peptide (m/z = 1,073.246 and m/z = 1,076.580, z = 3). (C) An overlay of light (black) and heavy (red) MS fragmentation spectra of FLI-tag-KK123 photolabeled β3 TM4 peptide. The KK123 adduct-containing b or y ions are labeled with “*”. Site-defining y4 and b17 ions identify β3-Y442 as the photolabeled residue. The photolabeled residues in α1- and β3-TM4 were identified in three replicate experiments. (D) KK123 photolabeled residues are shown in a homology model of the structure of an α1β3 GABAA receptor. In the α1 subunit, the labeled TM4 tyrosine (red) points toward TM1, whereas in the β3 subunit, the labeled tyrosine residue (orange) points toward TM3. The numerical data are included in S2 Data. GABAA, gamma amino-butyric acid Type A; MS, mass spectrometry; TM, transmembrane helix.

Photolabeling sites identified by KK200 and KK202

KK200, which has a TPD photolabeling group attached at C17 on the steroid backbone, has been previously used to map neurosteroid binding sites on GLIC [31]. Analysis of α1β3 receptors photolabeled with 15 μM KK200 detected two photolabeled TMD peptides: an α1-TM4 peptide, 398IAFPLLFGIFLVYWATYLNREPQLK423, was photolabeled with KK200 (m/z = 898.002; z = 4); site-defining ions in the fragmentation spectra identified N408 as the modified residue (Fig 3A). The N408 residue (N407 in rat) has previously been shown to be critical to neurosteroid potentiation of GABA-elicited currents [14, 15]. A β3-TM3 peptide, 280AIDMYLMGCNEM+DTTFVFVFLALLEYAFVNYIFFGPQR313 (m/z = 1,188.352; z = 4; N-ethylmaleimide [NEM]; 1, 4-dithiothreitol [DTT]; alkylation adduct), was also photolabeled with KK200. Fragmentation spectra narrowed the possible sites of adduction to G308 or R309, both at the junction of TM3 with the M3–M4 intracellular loop (Fig 3B).
Fig 3

Fragmentation spectra of KK200- and KK202-photolabeled GABAA receptor peptides.

(A) An α1-TM4 peptide (m/z = 898.002, z = 4) is photolabeled by KK200 at N408; (B) A β3-TM3 peptide (m/z = 1,188.352, z = 4) is photolabeled by KK200 at [308GR309]. (C and D) β3-TM3 peptides (m/z = 811.453, z = 6) are photolabeled by KK202 at 226VKA228 (panel C) and L294 (panel D). Fragment ions labeled in red contain the neurosteroid adduct. The C* indicates that the cysteine is alkylated by NEM or NEM + DTT. The photolabeled residues shown in panels A–D were all observed in three replicate experiments. The inset schematic of a GABAA receptor subunit in each panel indicates the approximate location of the residues labeled by KK200 (green) and KK202 (blue). The numerical data are included in S3 Data. DTT, 1, 4-dithiothreitol; GABAA, gamma amino-butyric acid Type A; NEM, N-ethylmaleimide; TM, transmebrane helix.

Fragmentation spectra of KK200- and KK202-photolabeled GABAA receptor peptides.

(A) An α1-TM4 peptide (m/z = 898.002, z = 4) is photolabeled by KK200 at N408; (B) A β3-TM3 peptide (m/z = 1,188.352, z = 4) is photolabeled by KK200 at [308GR309]. (C and D) β3-TM3 peptides (m/z = 811.453, z = 6) are photolabeled by KK202 at 226VKA228 (panel C) and L294 (panel D). Fragment ions labeled in red contain the neurosteroid adduct. The C* indicates that the cysteine is alkylated by NEM or NEM + DTT. The photolabeled residues shown in panels A–D were all observed in three replicate experiments. The inset schematic of a GABAA receptor subunit in each panel indicates the approximate location of the residues labeled by KK200 (green) and KK202 (blue). The numerical data are included in S3 Data. DTT, 1, 4-dithiothreitol; GABAA, gamma amino-butyric acid Type A; NEM, N-ethylmaleimide; TM, transmebrane helix. Analysis of GABAA receptors photolabeled with KK202 (Fig 3C and 3D), identified two photolabeled peptides eluting two minutes apart. Both peptides were identified as the β3-TM3 peptide, 278IDMYLMGCNEMFVFVFALLEYAFVNYIFFGRGPQR313 (m/z = 811.453, z = 6). Fragmentation spectra of the earlier eluting peptide localized labeling to a three-residue sequence, 278VKA280, at the N-terminus of β3-TM3 (Fig 3C). The fragmentation spectrum of the later eluting peptide, identified L294 as the site of adduction (Fig 3D). (The different retention time of the two photolabeled peptides is likely due to differences in peptide conformation and surface hydrophobicity resulting from incorporation of the photolabeling reagent into different residues.)

Allopregnanolone prevents photolabeling by neurosteroid analogue photolabeling reagents

An important test of whether the photolabeled sites constitute specific allopregnanolone binding sites is the ability of excess allopregnanolone to competitively prevent photolabeling. Photolabeling studies for site identification were performed using 15 μM photolabeling reagent and achieved levels of labeling efficiency varying from 0.06% to 3.0% (S1 Table). Because allopregnanolone has limited aqueous solubility (about 30 μM) and a large competitor excess is needed to demonstrate competition (particularly with an irreversibly bound ligand), we were limited to studying competition at the photolabeled residues that could be detected following photolabeling at a concentration of 3 μM. Accordingly, we measured the photolabeling efficiency obtained following photolabeling of α1β3 GABAA receptors with 3 μM KK123, KK200, or KK202 in the presence or absence of 30 μM allopregnanolone. KK123 photolabeled both α1-Y415 (0.77% efficiency) and β3 -Y442 (0.37% efficiency). For both of these residues, photolabeling was reduced by >90% in the presence of excess allopregnanolone (Fig 4A). KK200 photolabeled β3 -G308/R309 (0.19% efficiency), and labeling was reduced by 98% in the presence of allopregnanolone. KK202 labeled both β3-L294 (0.29% efficiency) and β3-278VKA280 (0.21% efficiency) in TM3; labeling of both of these sites was undetectable in the presence of 30 μM allopregnanolone. Studies were also performed to determine whether the orthosteric agonist GABA (1 mM) enhanced photolabeling by 3 uM KK123 or KK200. Labeling efficiency was not significantly enhanced in the presence of GABA. This suggests that there is a small difference in neurosteroid affinity for closed versus open/desensitized states, which is consistent with the fact that neurosteroids have very low efficacy as direct activators of GABAA receptors [45].
Fig 4

The α1 subunit is critical for neurosteroid modulation of α1β3 GABAA receptors.

(A) Photolabeling with 3 μM KK123, KK200, and KK202 (black) is prevented by labeling in the presence of 30 μM allopregnanolone (red). Each circle represents a replicate experiment, and the bars represent mean ± SD, n = 3. (B) Sample current traces showing modulation of WT α1β3, α1V227Wβ3 and α1N408A/Y411Fβ3 GABAA receptors by allopregnanolone or propofol. (C1) Allopregnanolone potentiation of GABA-elicited currents is reduced in α1V227Wβ3 (orange) and α1N408A/Y411Fβ3 (blue) receptors compared to WT (black). Potentiation is given as the ratio of peak responses to GABA + steroid to GABA alone. Potentiation value of 1 indicates no potentiation by neurosteroids. (C2) Direct activation of α1β3 GABAA receptors by allopregnanolone is reduced in α1V227Wβ3 receptors (orange). Direct activation is given in percentage of the peak response to steroid to peak response to saturating GABA + 100 μM propofol. (C3) Potentiation of GABA-elicited currents by propofol, or (C4) direct activation of the receptor in the presence of propofol is not affected by the α1V227W or α1N408A/Y411F mutations. Each data point represents a replicate experiment. Bars show the mean ± SD (n = 6–8). Data were compared by a one-way analysis of variance followed by a Dunnett’s multiple comparison tests of the means. ***p < 0.001; **p < 0.01; *p < 0.05. The numerical data are included in S4 Data. AlloP, allopregnanolone; GABAA, gamma amino-butyric acid Type A; WT, wild-type.

The α1 subunit is critical for neurosteroid modulation of α1β3 GABAA receptors.

(A) Photolabeling with 3 μM KK123, KK200, and KK202 (black) is prevented by labeling in the presence of 30 μM allopregnanolone (red). Each circle represents a replicate experiment, and the bars represent mean ± SD, n = 3. (B) Sample current traces showing modulation of WT α1β3, α1V227Wβ3 and α1N408A/Y411Fβ3 GABAA receptors by allopregnanolone or propofol. (C1) Allopregnanolone potentiation of GABA-elicited currents is reduced in α1V227Wβ3 (orange) and α1N408A/Y411Fβ3 (blue) receptors compared to WT (black). Potentiation is given as the ratio of peak responses to GABA + steroid to GABA alone. Potentiation value of 1 indicates no potentiation by neurosteroids. (C2) Direct activation of α1β3 GABAA receptors by allopregnanolone is reduced in α1V227Wβ3 receptors (orange). Direct activation is given in percentage of the peak response to steroid to peak response to saturating GABA + 100 μM propofol. (C3) Potentiation of GABA-elicited currents by propofol, or (C4) direct activation of the receptor in the presence of propofol is not affected by the α1V227W or α1N408A/Y411F mutations. Each data point represents a replicate experiment. Bars show the mean ± SD (n = 6–8). Data were compared by a one-way analysis of variance followed by a Dunnett’s multiple comparison tests of the means. ***p < 0.001; **p < 0.01; *p < 0.05. The numerical data are included in S4 Data. AlloP, allopregnanolone; GABAA, gamma amino-butyric acid Type A; WT, wild-type.

Structural characterization of the photolabeling sites

Modification of ligand analogues with labeling groups at different locations has been used to determine the orientation of the ligands within their binding pockets [46]. Here, the six residues photolabeled by KK123, KK200, and KK202 were examined in a model of the α1β3 receptor created by threading the aligned sequence of the α1 subunit on the structure of the β3 subunit (PDB 4COF) [47]. The photolabeling sites grouped into the following three clusters: cluster 1 (brown circle), β3-L294 (KK202) and β3-G308/R309 (KK200); cluster 2 (red circle), α1-Y415 (KK123) and α1-N408 (KK200); and cluster 3 (blue circle), β3-Y442 (KK123) and β3-278VKA280 (KK202) (Fig 5A).
Fig 5

Allopregnanolone docking in the three neurosteroid binding sites identified by photolabeling.

(A) The six photolabeling sites identified by photolabeling with KK123, KK200, and KK202 grouped into three clusters: β3(+)/α1(−) intersubunit sites (brown circle), β3 intrasubunit sites (blue circle), and α1 intrasubunit sites (red circle); docking of allopregnanolone to the β3 intrasubunit site (B), α1 intrasubunit site (C), and β3(+)/α1(−) intersubunit site (D). Residues photolabeled by KK123, α1-Y415, and β3-Y442 are colored red; Residues photolabeled by KK200 α1-N408 and β3-G308 are colored green; and residues photolabeled by KK202 β3-278VKA280 and L294 are colored blue. Residues previously identified as contributing to an intersubunit neurosteroid binding site—α1-Q242 and β3-F301—are shown in yellow, as is α1-V227, a residue in the α1 intrasubunit site shown to affect neurosteroid action by site-directed mutagenesis.

Allopregnanolone docking in the three neurosteroid binding sites identified by photolabeling.

(A) The six photolabeling sites identified by photolabeling with KK123, KK200, and KK202 grouped into three clusters: β3(+)/α1(−) intersubunit sites (brown circle), β3 intrasubunit sites (blue circle), and α1 intrasubunit sites (red circle); docking of allopregnanolone to the β3 intrasubunit site (B), α1 intrasubunit site (C), and β3(+)/α1(−) intersubunit site (D). Residues photolabeled by KK123, α1-Y415, and β3-Y442 are colored red; Residues photolabeled by KK200 α1-N408 and β3-G308 are colored green; and residues photolabeled by KK202 β3-278VKA280 and L294 are colored blue. Residues previously identified as contributing to an intersubunit neurosteroid binding site—α1-Q242 and β3-F301—are shown in yellow, as is α1-V227, a residue in the α1 intrasubunit site shown to affect neurosteroid action by site-directed mutagenesis. In cluster 1 (brown circle, Fig 5A and 5D), β3-L294 faces into the β(+)/α(−) intersubunit cleft, and G308/R309 is at the junction between the bottom of TM3 and the TM3–4 intracellular loop. G308/R309 is two α-helical turns below β3-F301 (i.e., toward the intracellular terminus of TM3), a residue previously photolabeled by 6-azi pregnanolone in β3 homomeric receptors [13]. These data support neurosteroid binding in the β(+)/α(−) interface, consistent with the canonical THDOC and pregnanolone binding sites identified in crystal structures of α1(+)/α1(−) interfaces in chimeric proteins [16] and in substituted cysteine modification protection studies of α1β2γ2 receptors [18]. The pattern of labeling also indicates that the A-ring of the steroid is oriented upwards in the intersubunit cleft toward the center of the membrane, the D-ring is pointing toward the intracellular termini of the TMDs, and the C5-C6-C7 edge of the steroid is pointing toward the β3(+) side of the cleft. Cluster 1 corresponds to a β3(+)/α1(−) intersubunit site. In cluster 2 (red circle, Fig 5A and 5C), N408 and Y415 are both on the C-terminal end of α1-TM4, facing toward TM1 within the same α1 subunit, consistent with an α1 intrasubunit neurosteroid binding site. N408, the residue labeled by the C17-TPD of KK200, is two α-helical turns closer to the center of TM4 than is Y415, the residue labeled by the C6-diazirine of KK123. This labeling pattern suggests that neurosteroids orient in this site with the A-ring pointing toward the ECD and the D-ring facing to the center of the TMD. Cluster 2 corresponds to an α1 intrasubunit site. In cluster 3 (blue circle, Fig 5A and 5B), Y442 is located at the C-terminal end of β3-TM4, and 278VKA280 is located on the TM2–TM3 loop near the extracellular end of β3-TM3. The adjacency of these two photolabeling sites suggests an intrasubunit neurosteroid binding site at the extracellular end of β3, analogous to the α1 intrasubunit site. The labeling of 278VKA280 in the extracellular loop by the C3-TPD group of KK202 suggests that neurosteroids orient in this site with the A-ring facing the ECD. Cluster 3 corresponds to a β3 intrasubunit site.

Molecular dynamic simulations and docking of neurosteroids

A homology model of the α1β3 GABAA receptor based on the structure of a β3 homomeric GABAA receptor (PDB 4COF) [47] was used to examine the preferred energetic poses of neurosteroid binding to the three binding sites. The homology model was embedded in a 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC) bilayer and the structure refined by molecular dynamics. We then docked each of the three photoaffinity labeling reagents as well as allopregnanolone to each of the proposed binding sites, using a time course series of snapshots from the simulation trajectory to account for receptor flexibility. All of the neurosteroid photolabeling reagents docked in the three sites; the identified sites are relatively shallow with respect to the protein–lipid interface. Moreover, the neurosteroid analogues were all found to adopt multiple poses in each of the sites with minimal energy differences between the poses (see Materials and methods). Photolabeling data combined with the docking scores (binding energy) and population of a given pose were used to guide selection of the preferred steroid orientation in each site. In the α1 intrasubunit site, the poses clustered between TM1 and TM4. The preferred pose (Fig 5C) for allopregnanolone (lowest energy cluster of poses) shows the A-ring oriented toward the ECD with the walls of the predicted binding site lined on one side by N408 and Y415 and on the other by V227. Docking of KK200 in this site has a similar orientation with the A-ring oriented toward the ECD and the TPD group on the D-ring proximal to N408 (Fig 6A). Docking of KK-123 shows a preferred pose in which the A-ring is oriented toward the ECD and the C6-diazirine proximal to Y415 (Fig 6B). These data elucidate a prior finding that mutations to N408 and Y411 eliminate potentiation by steroid analogues that lack a hydrogen bonding group on the D-ring [48].
Fig 6

Computational docking of neurosteroid photolabeling analogues to their photolabeling sites on α1β3-GABAA receptors.

(A) KK200 (light green) and (B) KK123 (pink) in α1 intrasubunit site. (C) KK123 and (D) KK202 (light blue) in β3 intrasubunit site. (E) KK200 and (F) KK202 in β3 (+)/-α1(−) intersubunit site. The KK123 photolabeled residues α1-Y415 and β3-Y442 are colored red, the KK200 photolabeled residues α1-N408 and β3-G308 are colored green, and the KK202 β3-278VKA280 and L294 are colored blue. The canonical neurosteroid binding site residues Q242, F301, and the new mutation site V227 are colored yellow. The photolabeling diazirine group is indicated with red “*”. GABAA, gamma amino-butyric acid Type A.

Computational docking of neurosteroid photolabeling analogues to their photolabeling sites on α1β3-GABAA receptors.

(A) KK200 (light green) and (B) KK123 (pink) in α1 intrasubunit site. (C) KK123 and (D) KK202 (light blue) in β3 intrasubunit site. (E) KK200 and (F) KK202 in β3 (+)/-α1(−) intersubunit site. The KK123 photolabeled residues α1-Y415 and β3-Y442 are colored red, the KK200 photolabeled residues α1-N408 and β3-G308 are colored green, and the KK202 β3-278VKA280 and L294 are colored blue. The canonical neurosteroid binding site residues Q242, F301, and the new mutation site V227 are colored yellow. The photolabeling diazirine group is indicated with red “*”. GABAA, gamma amino-butyric acid Type A. In the β3 intrasubunit site, the poses are clustered between TM3 and TM4. Allopregnanolone preferred a pose with the A-ring oriented toward the ECD near Y442 and the D-ring proximal to V290 (Fig 5B). KK123 was found to dock at the top of the TM helices with the A-ring oriented toward the ECD, placing the 6-diazirine in proximity to Y442 (Fig 6C). KK202 was found to dock in a similar orientation but lower in the TM region, with the TPD group in proximity to A280 and Y442 (Fig 6D). In the intersubunit site, the preferred pose for allopregnanolone was one of the lowest energy clusters of poses with the A-ring proximal to α1-Q242 (equivalent to rat α1-Q241), the D-ring pointing toward the cytoplasmic termini of the TMDs, and the D-ring facing β3-F301 (Fig 5D). Docking of KK200 showed a similar orientation although shifted slightly upwards toward the ECD, placing the A-ring near α1-Q242,the benzene ring of the TPD near β3-F301, and the diazirine in proximity to G308 (Fig 6E). The preferred pose of KK202 was closer to TM3 of the β3 subunit with the A-ring near α1-Q242 and the D-ring near the β3-F301 placing the diazirine in proximity to β3-L294 (Fig 6F). The orientation of allopregnanolone docked in our α1β3 model is nearly identical to the orientation of THDOC in the crystal structure of α1-GLIC [16] (PDB 5OSB). As a confirmation of our docking, we also docked allopregnanolone to the apo-neurosteroid crystal structures of the α1-GLIC [16] and α5-β3 chimeric [17] proteins (PDB 5OSA and PDB 5OJM, respectively) (S5 Fig). The preferred poses for allopregnanolone in the β3-α1 intersubunit site are nearly identical between the three models. The preferred poses are also very similar in the α1 intrasubunit site between our α1β3 homology model and the structures of the α-homomeric TMDs. The A-ring/D-ring orientation of allopregnanolone in the three neurosteroid sites was consistent with the orientations identified by the photolabeling data in all of the GABAA receptor structures. The calculated binding energies from the docking studies (S4 Table) indicate that the rank order of allopregnanolone affinity for the three sites is β3/α1 intersubunit site > α1 intrasubunit site > β3 intrasubunit site.

Effects of mutations in putative binding sites on neurosteroid action

The β3-α1 intersubunit binding site identified in our photolabeling studies has been extensively validated by site-directed mutagenesis as a functionally important site. Mutations on the α(−) side of the interface, including Q241(rat)L/W and W246(rat)L, have been shown to eliminate neurosteroid potentiation and gating of α1β2γ2 GABAA receptors [14, 27, 49]; mutations on the β(+) side of the interface, including F301A and L297A, have also been shown to partially reduce neurosteroid effect [17]. In the current study, we showed that α1Q242Lβ3 prevented the action of allopregnanolone, KK123, and KK200 while reducing the effect of KK202 in α1β3 receptors, confirming the β–α interface as a functionally significant neurosteroid binding site and validating the relevance of our photolabeling reagents (Fig 1B). Based on computational simulation and docking results, we also identified residues in the proposed α1- and β3-intrasubunit binding sites that we predicted could be involved in allopregnanolone binding or action (S2 Table and S3 Table for all mutated subunits tested). N408 and Y411 in α1-TM4 line one side of the putative α1 intrasubunit site, and V227 in α1-TM1 lines the other (Fig 5C). α1N407(rat)A and α1Y410(rat)W mutations have previously been shown to prevent neurosteroid potentiation of GABA-elicited currents in α1β2γ2 GABAA receptors [15]. Our data confirm that the double mutant α1N408A/Y411Fβ3 substantially reduces allopregnanolone potentiation of GABA-elicited currents (Fig 4B and 4C1, ***p < 0.001 versus α1β3 wild-type). Allopregnanolone (1 μM) potentiation of GABA-elicited currents and direct activation (10 μM) of α1V227Wβ3 receptors was also significantly reduced in comparison to α1β3 wild-type (*p < 0.05 and **p < 0.01; Fig 4B, 4C1 and 4C2). To test whether these mutations selectively affected neurosteroid actions, we also compared the effect of propofol in α1V227Wβ3 and α1N408A/Y411Fβ3 to its effect on wild-type α1β3 receptors. Propofol action was not different between the mutant and wild-type receptors, indicating a selective effect on neurosteroid action (Fig 4B, 4C3 and 4C4). The finding that multiple mutations lining the α1-intrasubunit binding pocket selectively reduce allopregnanolone action buttresses the evidence that the photolabeled residues identify a specific, functionally important neurosteroid binding site. Multiple mutations within the putative β3-intrasubunit binding site were also tested. However, none of the mutations significantly altered potentiation or activation by allopregnanolone (S2 Table and S3 Table for all of the mutations that were tested). These data suggest that allopregnanolone occupancy of the β3 intrasubunit site does not contribute to channel gating. Direct activation of α1β2Y284Fγ2 receptors by THDOC has previously been shown to be markedly reduced in comparison to wild-type receptors [15], although we found no significant effect of the β3-Y284 mutation in α1β3 receptors (S2 Table and S3 Table). The difference in results between experiments in α1β3 and α1β2γ2 GABAA receptors suggests possible receptor subtype specificity in the functional effects of neurosteroid binding at a β-intrasubunit site.

Discussion

Collectively, the photolabeling, modeling, and functional data indicate that heteropentameric α1β3 GABAA receptors contain at least seven binding sites for neurosteroids, of three different types. The use of multiple photolabeling reagents also enabled determination of the orientation of neurosteroids in each proposed class of sites. At least two of these classes are involved in producing the allosteric effect of steroids, the β3-α1 intersubunit site (two copies per receptor) and the α1 intrasubunit site (two copies). Mutations of residues in the proposed β3 intrasubunit site (three copies) had no effect on modulation by allopregnanolone although residues were labeled by two photolabeling reagents and labeling was prevented by excess allopregnanolone. Accordingly, the functional significance of this proposed site is not known. Previous, site-directed mutagenesis studies using electrophysiology readout identified multiple residues, including α1-Q241, N407, Y410, T236, and β3-Y284, that selectively contribute to the positive allosteric effects of neurosteroids [14, 27]. Based on homology to the structure of the muscle nicotinic acetylcholine receptor [50], it was hypothesized that there are two neurosteroid binding sites on GABAA receptors: an α1-intrasubunit site spanning Q241 and N407 and an intersubunit site between β3-Y284 and α1-T236. Subsequent data [16-18] have clearly established the existence of a β–α intersubunit site. Our photolabeling experiments and homology modeling now show that the previously identified residues contribute to multiple distinct neurosteroid binding sites, albeit differently than originally proposed. It is noteworthy that the α1-intrasubunit site was not identified in the X-ray crystallographic structures of α1-GLIC chimeras bound with THDOC or the α5-β3 chimera bound with pregnanolone. This is likely because the proteins with steroid bound in the intrasubunit site did not form stable crystals. Mutations in either the β3-α1 intersubunit site or the α1-intrasubunit site can ablate both potentiation and direct activation by allopregnanolone, indicating that these are not distinct sites mediating potentiation and direct activation. The data also do not conform to simple energetic additivity for the two sites. The observation that mutations in either binding site can largely eliminate neurosteroid effect indicates that these two sites do not function completely independently and suggests allosteric interaction between the two sites. Development of site-selective neurosteroid analogues (PAMs and antagonists) should facilitate clarification of the mechanisms of allosteric interaction between these two sites. In light of the demonstration of multiple neurosteroid binding sites in α1β3 GABAA receptors, the possibility of additional isoform-specific sites must be considered. The strong sequence homology between the TMDs of the six α-subunits and three β-subunits suggests that there will not be large isoform differences in the intersubunit site [27]. In contrast, the contribution of ECD residues to the α- and β-intrasubunit sites suggests possible isoform-specific differences. The sequence homology between the γ and δ subunits and α and β subunits suggests that there may also be intrasubunit neurosteroid binding sites in these isoforms. Identification of a neurosteroid binding site on a δ-subunit would be of particular relevance because GABAA receptors containing δ-subunits are particularly sensitive to neurosteroids [51-53]. High-resolution, cryo-electron microscopy structures of α1β3γ2 GABAA receptors [54-56] have been published since initial submission of this work. The structural homology between γ2 subunits and α and β subunits suggests that there may also be intrasubunit neurosteroid binding sites in the γ2 subunit. The existence of multiple sites in which neurosteroids bind with different orientation may also offer some explanation for the difficulty in identifying neurosteroid antagonists [57] and for the differences in single-channel electrophysiological effects of various neurosteroid analogues [28, 30]. The possibility of multiple isoform-specific sites with distinct patterns of neurosteroid affinity, binding orientation, and effect offers the exciting potential for the development of isoform-specific agonists, partial agonists, and antagonists with targeted therapeutic effects.

Materials and methods

cDNA constructs

The human α1 and β3 subunits were subcloned into pcDNA3 for molecular manipulations and cRNA synthesis. Using QuikChange mutagenesis (Agilent), a FLAG tag was first added to the α1 subunit then an 8xHis tag was added to generate the following His-FLAG tag tandem (QPSLHHHHHHHHDYKDDDDKDEL), inserted between the fourth and fifth residues of the mature peptide. The α1 and β3 subunits were then transferred into the pcDNA4/TO and pcDNA5/TO vectors (ThermoFisher Scientific, Waltham, MA), respectively, for tetracycline-inducible expression. For X. laevis oocytes, point mutations were generated using the QuikChange site-directed mutagenesis kit (Agilent Technologies, Santa Clara, CA) and the coding region fully sequenced prior to use. The cDNAs were linearized with Xba I (NEB Labs, Ipswich, MA), and the cRNAs were generated using T7 mMessage mMachine (Ambion, Austin, TX).

Cell culture

The tetracycline-inducible cell line HEK T-RexTM-293 (ThermoFisher) was cultured under the following conditions: cells were maintained in DMEM/F-12 50/50 medium containing 10% fetal bovine serum (tetracycline-free, Takara, Mountain View, CA), penicillin (100 units/ml), streptomycin (100 g/ml), and blastcidine (2 μg/ml) in a humidified atmosphere containing 5% CO2. Cells were passaged twice each week, maintaining subconfluent cultures. Stably transfected cells were cultured as above with the addition of hygromycin (50 μg/ml) and Zeocin (20 μg/ml).

Generation of high-expression stable cell line

A stable cell line was generated by transfecting HEK T-RexTM-293 cells with human α1-8x His-FLAG pcDNA4/TO and human β3 pcDNA5/TO in a 150 mm culture dish, using the Effectene transfection reagent (Qiagen). Two days after transfection, selection of stably transfected cells was performed with hygromycin and zeocin until distinct colonies appeared (usually after two weeks). Medium was exchanged several times each week to maintain antibiotic selection. Individual clones (about 65) were selected from the dish and transferred to 24-well plates for expansion of each clone selected. When the cells grew to a sufficient number, about 50% confluency, they were split into two other plates, one for a surface ELISA against the FLAG epitope and a second for protein assay, to normalize surface expression to cell number [58]. The best eight clones were selected for expansion into 150 mm dishes, followed by [3H]muscimol binding. Once the best expressing clone was determined, the highest-expressing cells of that clone were selected through fluorescence-activated cell sorting (FACS).

FACS

FACS was done against the FLAG epitope, using a phycoerythrin (PE)-conjugated anti-FLAG antibody. Fluorescent-activated cells (1 ml containing about 10 million cells) were sorted on the AriaII cell sorter (Washington University Pathology Core), collecting 0.5% of the highest-fluorescing cells in a culture tube containing complete medium. The cells were plated in a 35 mm dish and expanded until a near confluent 150 mm dish was obtained. Cells were enriched for expression by FACS three times. A final FACS was performed to select individual cells into a 96-well plate, which resulted in only 10 colonies of cells. These colonies were expanded and assayed for [3H]muscimol binding; the highest-expressing clone was used for experiments.

Induction of GABAA receptor expression

Stably transfected cells were plated into fifty 150 mm dishes. After reaching 50% confluency, GABA receptors were expressed by inducing cells with 1 μg/ml of doxycycline with the addition of 5 mM sodium butyrate. Cells were harvested after 48 to 72 hours after induction.

Membrane protein preparation

HEK cells, after tetracycline induction, grown to 70%–80% confluency, were washed with 10 mM sodium phosphate/proteinase inhibitors (Sigma-Aldrich, St. Louis, MO) two times and harvested with cell scrapers. The cells were washed with 10 mM sodium phosphate/proteinase inhibitors and collected by centrifugation at 1,000 g at 4°C for 5 minutes. The cells were homogenized with a glass mortar Teflon pestle for 10 strokes on ice. The pellet containing the membrane proteins was collected after centrifugation at 34,000 g at 4°C for 30 minutes and resuspended in a buffer containing 10 mM potassium phosphate and 100 mM KCl. The protein concentration was determined with micro-BCA protein assay and stored at −80°C.

[3H]muscimol binding

[3H]muscimol binding assays were performed using a previously described method with minor modification [59]. Briefly, HEK cell membranes proteins (50 μg/ml final concentration) were incubated with 1–2 nM [3H]muscimol (30 Ci/mmol; PerkinElmer Life Sciences), neurosteroid in different concentrations (1 nM-10 μM), binding buffer (10 mM potassium phosphate, 100 mM KCl [pH 7.5]), in a total volume of 1 ml. Assay tubes were incubated for 1 hour at 4°C in the dark. Nonspecific binding was determined by binding in the presence of 1 mM GABA. Membranes were collected on Whatman/GF-C glass filter paper using a Brandel cell harvester (Gaithersburg, MD). To determine the Bmax of [3H]muscimol binding, 100 μg/ml of proteins were incubated with 250 nM [3H]muscimol, with specific activity reduced to 2 Ci/mmol, for 1 hour at 4°C in the dark. The membranes were collected on Whatman/GF-B glass filter papers using manifold. Radioactivity bound to the filters was measured by liquid scintillation spectrometry using Bio-Safe II (Research Products International Corporation). Each data point was determined in triplicate.

Photolabeling of α1β3 GABAA receptor

For all the photolabeling experiments, 10–20 mg of HEK cell membrane proteins (about 300 pmol [3H]muscimol binding) were thawed and resuspended in buffer containing 10 mM potassium phosphate, 100 mM KCl (pH 7.5) at a final concentration of 1.25 mg/ml. For photolabeling site identification experiments, 15 μM neurosteroid photolabeling reagent was added to the membrane proteins and incubated on ice for 1 hour. For the photolabeling competition experiments, 3 μM neurosteroid photolabeling reagent in the presence of 30 μM allopregnanolone or the same volume of ethanol was added for incubation. The samples were then irradiated in a quartz cuvette for 5 minutes, by using a photoreactor emitting light at >320 nm [59]. The membrane proteins were then collected by centrifugation at 20,000 g for 45 minutes. All of the photolabeling experiments to identify sites of neurosteroid photolabeling were performed at least three times. The photolabeled peptides and residues described in the text were all observed in replicate experiments.

Cycloaddition (click reaction) of FLI-tag to KK123-photolabeled proteins

The amount of 10 mg of KK123 or ZCM42 photolabeled HEK membrane proteins were solubilized in 1 ml 2% SDS/PBS and incubated at room temperature for 2 hours. The protein lysate was collected by centrifugation at 21,000 g for 30 minutes. FLI-tag was clicked to the KK123- or ZCM-photolabeled proteins at room temperature overnight in PBS buffer containing 2% SDS, 100 μM FLI-tag [35], 2.5 mM sodium ascorbate, 250 μM Tris [(1-benzyl-1H-1,2,3triazol-4-yl)methyl]amine, and 2.5 mM CuSO4. The amount of 1% Triton/PBS was added to the protein lysate to an SDS final concentration of 0.05%. The protein lysate was loaded onto a streptavidin agarose column. The flow through was reloaded to the column two times or till the flow through was colorless and the streptavidin column was dark orange yellow. The column was washed with 10 ml 0.05% Triton/PBS and eluted by 10 ml 100 mM sodium dithionite/0.05%Triton/PBS. The column was turned into colorless after elutions. The eluted proteins were concentrated into 100 μl with 30 kDa cutoff Centricon apparatus. The supernatant of the Centricon tube was added into SDS-sample loading buffer, loaded to a 10% SDS-PAGE, and transferred to a PVDF membrane, followed by western blot with polyclonal rabbit anti-α1 raised against a peptide mapping within a cytoplasmic domain of human GABAR α1 subunit [60] (Santa Cruz Biotechnology) or monoclonal anti-β3 antibody against 370–433 of mouse GABAR β3 subunit [61] (NeuroMab).

Purification of α1β3 GABAA receptors

The photolabeled membrane proteins were resuspended in lysis buffer containing 1% DDM, 0.25% cholesteryl hemisuccinate (CHS), 50 mM Tris (pH 7.5), 150 mM NaCl, 2 mM CaCl2, 5 mM KCl, 5 mM MgCl2, 1 mM EDTA, and 10% glycerol at a final concentration of 1 mg/ml. The membrane protein suspension was homogenized using a Teflon pestle in a motor-driven homogenizer and incubated at 4°C overnight. The protein lysate was centrifuged at 20,000 g for 45 minutes, and supernatant was incubated with 0.5 ml anti-FLAG agarose (Sigma) at 4°C for 2 hours. The anti-FLAG agarose was then transferred to an empty column, followed by washing with 20 ml washing buffer (50 mM triethylammonium bicarbonate and 0.05% DDM). The GABAA receptors were eluted with ten 1-ml 200 μg/ml FLAG peptide and 100 μg/ml 3X FLAG (ApexBio) in the washing buffer. The 10 ml effective elutions containing GABAA receptors (tested by western blot with anti-α1 or anti-β3 antibody) were concentrated by 100 kDa cutoff Centricon filters into 0.1 ml.

Middle-down MS

The purified GABAA receptors (100 ul) were reduced by 5 mM tris (2-carboxyethyl) phosphine (TCEP) at for 30 minutes followed by alkylation with 7.5 mM NEM for 1 hour in the dark. The NEM was quenched by 7.5 mM DTT for 15 minutes. These three steps were done at room temperature. Eight μg of trypsin was added to the protein samples and incubated at 4°C for 7–10 days. The digest was terminated by adding formic acid (FA) in a final concentration of 1%. The samples were then analyzed by an OrbiTrap ELITE mass spectrometer (ThermoFisher) as in previous work [13, 31] with some modifications. Briefly, a 20 μl aliquot was injected by an autosampler (Eksigent) at a flow rate of 800 nl/min onto a home-packed polymeric reverse phase PLRP-S column (Agilent, 12 cm × 75 μm, 300 Å). An acetonitrile (ACN) 10%–90% concentration gradient was applied in the flow rate of 800 nl/min for 145 minutes to separate peptides. Solvent A was 0.1% FA/water, and solvent B was 0.1%FA/ACN. The ACN gradient was as follows: isocratic elution at 10% solvent B, 1–60 minutes; 10%–90% solvent B, 60–125 minutes; 90% solvent B, 125–135 minutes; 90%–10% solvent B, 135–140 minutes; isocratic solvent B, 140–145 minutes. For the first 60 minutes, a built-in divert valve on the mass spectrometer was used to remove the hydrophilic contaminants from the mass spectrometer. The survey MS1 scans were acquired at acquired at high resolution (60,000 resolution) in the range of m/z = 100–2,000, and the fragmentation spectra were acquired at 15,000 resolution. Data-dependent acquisition of the top 20 MS1 precursors with exclusion of singly charged precursors was set for MS2 scans. Fragmentation was performed using collision-induced dissociation or high-energy dissociation with normalized energy of 35%. The data were acquired and reviewed with Xcalibur 2.2 (ThermoFisher). The MS experiments of identification of the photolabeling sites and competition of photolabeling were replicated at least three times.

MS data processing and analysis

The LC-MS data were searched against a customized database containing the sequence of the GABAA receptor 8X His-FLAG-α1 and β3 subunit and filtered with 1% false discovery rate using PEAKS 8.5 (Bioinformatics Solutions Inc.). Search parameters were set for a precursor mass accuracy of 30 ppm, fragmentation ion accuracy of 0.1 Da, up to three missed cleavage on either side of peptide with trypsin digestion. Methionine oxidation, cysteine alkylation with NEM and DTT, any amino acids with adduct of KK123 (mass = 372.16), KK200 (mass = 462.27), KK202 (mass = 500.31), KK123 with light FLI-tag (mass = 672.4322), and KK123 with heavy FLI-tag (mass = 682.44) were included as variable modification.

Receptor expression in X. laevis oocytes

The GABAA receptors were expressed in oocytes from the African clawed frog (X. laevis). Frogs were purchased from Xenopus 1 (Dexter, MI) and housed and cared for in a Washington University Animal Care Facility under the supervision of the Washington University Division of Comparative Medicine. Harvesting of oocytes was conducted under the Guide for the Care and Use of Laboratory Animals as adopted and promulgated by the National Institutes of Health. The animal protocol was approved by the Animal Studies Committee of Washington University in St. Louis (approval No. 20170071). The oocytes were injected with a total of 12 ng cRNA in 5:1 ratio (α1:β3) to minimize the expression of β3 homomeric receptors. Following injection, the oocytes were incubated in ND96 with supplements (96 mM NaCl, 2 mM KCl, 1.8 mM CaCl2, 1 mM MgCl2, 2.5 mM Na pyruvate, 5 mM HEPES, and 100 U/ml + 100 μg/ml penicillin + streptomycin and 50 μg/ml gentamycin [pH 7.4]) at 16°C for 1–2 days prior to conducting electrophysiological recordings.

Electrophysiological recording

The electrophysiological recordings were conducted using standard two-electrode voltage clamp. Borosilicate capillary glass tubing (G120F-4, OD = 1.20 mm, ID = 0.69 mm; Warner Instruments, Hamden, CT) were used for voltage and current electrodes. The oocytes were clamped at −60 mV. The chamber (RC-1Z; Warner Instruments, Hamden, CT) was perfused with ND96 at 5–8 ml min−1. Solutions were gravity-applied from 30-ml glass syringes with glass luer slips via Teflon tubing. The current responses were amplified with an OC-725C amplifier (Warner Instruments), digitized with a Digidata 1200 series digitizer (Molecular Devices) and were stored using pClamp (Molecular Devices). The peak amplitude was determined using Clampfit (Molecular Devices). The stock solution of GABA was made in ND96 bath solution at 500 mM, stored in aliquots at −20°C, and diluted as needed on the day of experiment. Stock solution of propofol (200 mM in DMSO) was stored at room temperature. The steroids were dissolved in DMSO at 10 mM and stored at room temperature.

Electrophysiology data analysis

The α1β3 wild-type and mutant receptors were tested (see Table 1 and S2 and S3 Tables) for potentiation by steroids (3α5α-allopregnanolone, 3α5β-pregnanolone, KK123, KK200, and KK-202) and direct activation by steroids (allopregnanolone KK123, KK200, KK-202, and pregnanolone). As control, several receptor isoforms were tested for potentiation by propofol. For each receptor type, we also determined constitutive open probability (Po,const). To estimate Po,const, the effect of 100 μM picrotoxin (estimated Po = 0) on the holding current was compared to the peak response to saturating GABA + 100 μM propofol (estimated Po = 1). Po,const was then calculated as Ipicrotoxin ÷ (Ipicrotoxin − IGABA+propofol) [62]. Potentiation is expressed as the potentiation response ratio, calculated as the ratio of the peak response to GABA + modulator (steroid or propofol) to the peak response to GABA alone. The concentration of GABA was selected to produce a response of 5%–15% of the response to saturating GABA + 100 μM propofol. Direct activation by steroids was evaluated by comparing the peak response to 10 μM neurosteroid to the peak response to saturating GABA + 100 μM propofol. Direct activation by steroids is expressed in units of open probability that includes constitutive open probability. All data are given as mean ± SD and analyzed by one-way ANOVA followed by Dunnet’s multiple comparison to the control wild-type group.

Docking simulations

A homology model of the α1β3 GABAA receptor was developed using the crystal structure of the human β3 homopentamer published in 2014 (PDB ID: 4COF) [47]. In this structure, the large cytoplasmic loops were replaced with the sequence SQPARAA used by Jansen and colleagues [63] The pentamer subunits were organized as A α1, B β3, C α1, D β3, E β3. The α1 sequence was aligned to the β3 sequence using the program MUSCLE [64]. The pentameric alignment was then used as input for the program Modeller [65], using 4COF as the template; a total of 25 models were generated. The best model as evaluated by the DOPE score [66] was then oriented into a POPC membrane, and the system was fully solvated with 40715 TIP3 water molecules and ionic strength set to 0.15 M KCl. A 100 ns molecular dynamics trajectory was then obtained using the CHARMM36 force field and NAMD. The resulting trajectory was then processed using the utility mdtraj [67], to extract a snapshot of the receptor at each nanosecond of time frame. These structures were then mutually aligned by fitting the alpha carbons, providing a set of 100 mutually aligned structures used for docking studies. The docking was performed using AutoDock Vina [68] on each of the 100 snapshots in order to capture the receptor flexibility. Docking boxes were built for the β3 intrasubunit site (cluster 3), the α1 intrasubunit site (cluster 2), and the β3-α1 intersubunit site (cluster 1). The boxes were centered around the residues photolabeled by KK123, KK200, and KK202 and had dimensions of 25 × 25 × 25 Ångströms, large enough to easily fit the linear dimensions of all of the steroids. For docking studies of allopregnanolone, the docking boxes were placed in the same locations but had smaller dimensions of 20 × 20 × 20 Ångströms. Docking was limited to an energy range of 3 kcal from the best docking pose and was limited to a total of 20 unique poses. The docking results for a given site could result in a maximum of 2,000 unique poses (20 poses × 100 receptor structures); these were then clustered geometrically using the program DIVCF [69]. The resulting clusters were then ranked by Vina score and cluster size and visually analyzed for compatibility with the photolabeling results, which is the photolabeling group oriented in the correct direction to produce the observed photo adducts.

Chemicals

The inorganic salts used in the buffers, GABA, picrotoxin, and the steroids 3α, 5α-allopregnanolone, and 3α,5β-pregnanolone were purchased from Sigma-Aldrich. Propofol was purchased from MP Biomedicals (Solon).

Enhancement of [3H]-muscimol binding to α1β3 GABAA receptors by allopregnanolone and its photolabeling analogues.

The EC50 values (in μM) are 3.9 ± 5.7 (n = 9) for allopregnanolone; 1.6 ± 0.2 (n = 9) for KK123; 0.54 ± 0.18 (n = 9) for KK200; and 1.1 ± 0.27 (n = 9) for KK202. The numerical data are included in S5 Data. EC50, half maximal effective concentration. (PPTX) Click here for additional data file.

Purification of KK123 photolabeled α1β3 GABAA receptors via a trifunctional linker MQ112.

(a) The structure of MQ112. (b) Purification of KK123 photolabeled GABAA receptor α1 and β3 subunit by MQ112, via a click reaction, visualized by western blot with anti-α1 and anti-β3. (c) The structure of ZCM42. (PPTX) Click here for additional data file.

Workflow for identifying neurosteroid photolabeling sites in GABAA receptors.

(PPTX) Click here for additional data file.

Fragmentation spectrum of KK123 photolabeled β3TM4 peptide.

Y4 and b17 (in red) fragment ions containing a KK123 adduct indicate that Y442 is photolabeled by KK123. The fragment ions with neutral loss of the adduct are labeled as b17*2+, b18*2+, b19*2+, and y20*2+. The numerical data are included in S6 Data. (PPTX) Click here for additional data file.

Computational docking of allopregnanolone to the putative intersubunit and intrasubunit neurosteroid sites on α1β3-GABAA receptors, α5-β3 chimeric receptors (PDB 5OJM), and α1-GLIC chimeric receptors (PDB 5OSA).

Each panel shows the structural model of an α1β3 GABAA receptor (based on the structure of the β3 homomeric GABAA receptor [PDB 4COF] superimposed on models based on the X-ray crystallographic structures of the α5-β3 chimera (panels a and c) or the α1-GLIC chimera (panels b and d). Docking of allopregnanolone to β3-α1 intersubunit site is shown above (panels a and b) and to the α1 intrasubunit site below (panels c and d). The β3 subunit in the α1β3 GABAA receptor model is colored light gray, and the α1 subunit is colored dark gray. TMDs in the α5-β3 chimera (panels a and c) are colored gold; TMDs in the α1-Glic chimera (panels b and d) are pink. The preferred pose of allopregnanolone docking to the α1β3-GABAA receptors is shown in cyan and to the chimeric receptors in dark red. The KK123 photolabeled residue α1-Y415 is colored in red, and the KK200 photolabeled residue α1-N408 is colored green. The canonical neurosteroid binding residues Q242, F301, and the new mutation residue—V227—are colored yellow. GLIC, Gloeobacter ligand-gated ion channel; TMD, transmembrane domain. (PPTX) Click here for additional data file.

Photolabeling efficiency of the photolabeling analogues (15 μM) in each of the identified sites.

Data are presented as area under the curve of selected ion chromatograms of photolabeled peptides as a percentage of the area under the curve of corresponding nonphotolabeled peptides. (DOCX) Click here for additional data file.

Potentiation of α1β3 receptors GABAA receptors in X. laevis oocytes.

Potentiation is expressed as potentiation response ratio, calculated as the ratio of the peak responses in the presence of GABA and neurosteroids to the peak response in the presence of GABA alone. The GABA concentrations were selected to generate a response of 5%–15% of the response to saturating GABA. Data are shown as mean ± SD (number of cells). One-way ANOVA followed by Dunnett’s multiple comparison to the control wild-type group was used for statistical analysis. *p < 0.05; **p < 0.01; and ***p < 0.001. (DOCX) Click here for additional data file.

Direct activation of α1β3 GABAA receptors in X. laevis oocytes by 10 μM allopregnanolone (3α5αP) and pregnanolone (3α5βP).

Direct activation is expressed in units of open probability. Data are shown as mean ± SD (number of cells). One-way ANOVA followed by Dunnett’s multiple comparison to the control wild-type group was used for statistical analysis. *p < 0.05 and ***p < 0.001. (DOCX) Click here for additional data file.

Docking results for S5 Fig.

Free energies of binding are predicted by Vina and are in kilocalories per mole. (DOCX) Click here for additional data file.

The numerical data for construction of Fig 1B.

Table of GABA-elicited currents (in μA) in numerical form in wild-type α1β3 GABAA receptors and mutant α1Q242Lβ3 receptors in the presence or absence of allopregnanolone, KK123, KK200, and KK202. (XLSX) Click here for additional data file.

The numerical data for the MS spectra in Fig 2.

Each set of data represents an MS spectrum of a KK123-photolabeled peptide in numerical form with m/z of ions and their corresponding ion intensity listed in columns. MS, mass spectrometry. (XLSX) Click here for additional data file.

The numerical data for the MS fragmentation spectra in Fig 3.

Each set of data represents an MS fragmentation spectrum of a KK200- or KK202-photolabeled peptide in numerical form. The m/z of fragmentation ions and their corresponding ion intensity are listed in columns. MS, mass spectrometry. (XLSX) Click here for additional data file.

The numerical data for construction of Fig 4.

Fig 4A. Summary of the photolabeling efficiency of different peptides by KK123, KK200, or KK20 in the presence or absence of 30 μM allopregnanolone, from three replicate experiments. Fig 4B. The magnitude of GABA-elicited currents (in μA) recorded from wild-type α1β3 GABAA receptors, mutant α1V227Wβ3, or α1N408A/Y411Fβ3 receptors in the presence or absence of allopregnanolone or propofol. Fig 4C. Summary of potentiation or direct activation of wild-type α1β3 GABAA receptors, mutant α1V227Wβ3, or α1N408A/Y411Fβ3 receptors by allopregnanolone or propofol in replicate samples. (XLSX) Click here for additional data file.

Summary of data showing enhancement of [3H]-muscimol binding to α1β3 GABAA receptors by different neurosteroids in S1 Fig.

Each data point represents an individual replicate expressed as percentage of control. Control is defined as the average of the replicate values obtained with 0 μM neurosteroid. (XLSX) Click here for additional data file.

The numerical data for the MS fragmentation spectrum of the KK123-photolabeled β3-TM4 peptide in S4 Fig.

The table lists the fragmentation ions (m/z) and their corresponding ion intensities in the spectrum. MS, mass spectrometry; TM, transmembrane. (XLSX) Click here for additional data file.

The material and methods for chemical synthesis and verification of structure of novel neurosteroid photolabeling analogues (KK200 and KK202) and the trifunctional linker (MQ112).

(DOCX) Click here for additional data file.
  68 in total

1.  Occupation of either site for the neurosteroid allopregnanolone potentiates the opening of the GABAA receptor induced from either transmitter binding site.

Authors:  John Bracamontes; Megan McCollum; Caroline Esch; Ping Li; Jason Ann; Joe Henry Steinbach; Gustav Akk
Journal:  Mol Pharmacol       Date:  2011-04-15       Impact factor: 4.436

2.  Endogenous gamma-aminobutyric acid (GABA)(A) receptor active neurosteroids and the sedative/hypnotic action of gamma-hydroxybutyric acid (GHB): a study in GHB-S (sensitive) and GHB-R (resistant) rat lines.

Authors:  Maria Luisa Barbaccia; Mauro A M Carai; Giancarlo Colombo; Carla Lobina; Robert H Purdy; Gian Luigi Gessa
Journal:  Neuropharmacology       Date:  2005-03-31       Impact factor: 5.250

3.  Enhanced anticonvulsant activity of ganaxolone after neurosteroid withdrawal in a rat model of catamenial epilepsy.

Authors:  D S Reddy; M A Rogawski
Journal:  J Pharmacol Exp Ther       Date:  2000-09       Impact factor: 4.030

4.  Specificity of intersubunit general anesthetic-binding sites in the transmembrane domain of the human α1β3γ2 γ-aminobutyric acid type A (GABAA) receptor.

Authors:  David C Chiara; Selwyn S Jayakar; Xiaojuan Zhou; Xi Zhang; Pavel Y Savechenkov; Karol S Bruzik; Keith W Miller; Jonathan B Cohen
Journal:  J Biol Chem       Date:  2013-05-15       Impact factor: 5.157

Review 5.  GABA A receptors: subtypes provide diversity of function and pharmacology.

Authors:  Richard W Olsen; Werner Sieghart
Journal:  Neuropharmacology       Date:  2008-08-08       Impact factor: 5.250

6.  Crystal structure of a human GABAA receptor.

Authors:  Paul S Miller; A Radu Aricescu
Journal:  Nature       Date:  2014-06-08       Impact factor: 49.962

7.  Crystal structures of a GABAA-receptor chimera reveal new endogenous neurosteroid-binding sites.

Authors:  Duncan Laverty; Philip Thomas; Martin Field; Ole J Andersen; Matthew G Gold; Philip C Biggin; Marc Gielen; Trevor G Smart
Journal:  Nat Struct Mol Biol       Date:  2017-10-02       Impact factor: 15.369

Review 8.  Neurosteroid binding sites on GABA(A) receptors.

Authors:  Alastair M Hosie; Megan E Wilkins; Trevor G Smart
Journal:  Pharmacol Ther       Date:  2007-04-21       Impact factor: 12.310

9.  MUSCLE: a multiple sequence alignment method with reduced time and space complexity.

Authors:  Robert C Edgar
Journal:  BMC Bioinformatics       Date:  2004-08-19       Impact factor: 3.169

10.  Structural basis for GABAA receptor potentiation by neurosteroids.

Authors:  Paul S Miller; Suzanne Scott; Simonas Masiulis; Luigi De Colibus; Els Pardon; Jan Steyaert; A Radu Aricescu
Journal:  Nat Struct Mol Biol       Date:  2017-10-09       Impact factor: 15.369

View more
  23 in total

1.  Multiple neurosteroid and cholesterol binding sites in voltage-dependent anion channel-1 determined by photo-affinity labeling.

Authors:  Wayland W L Cheng; Melissa M Budelier; Yusuke Sugasawa; Lucie Bergdoll; María Queralt-Martín; William Rosencrans; Tatiana K Rostovtseva; Zi-Wei Chen; Jeff Abramson; Kathiresan Krishnan; Douglas F Covey; Julian P Whitelegge; Alex S Evers
Journal:  Biochim Biophys Acta Mol Cell Biol Lipids       Date:  2019-06-05       Impact factor: 4.698

2.  The molecular determinants of neurosteroid binding in the GABA(A) receptor.

Authors:  Yusuke Sugasawa; John R Bracamontes; Kathiresan Krishnan; Douglas F Covey; David E Reichert; Gustav Akk; Qiang Chen; Pei Tang; Alex S Evers; Wayland W L Cheng
Journal:  J Steroid Biochem Mol Biol       Date:  2019-05-28       Impact factor: 4.292

3.  Isobolographic Analysis of Antiseizure Activity of the GABA Type A Receptor-Modulating Synthetic Neurosteroids Brexanolone and Ganaxolone with Tiagabine and Midazolam.

Authors:  Shu-Hui Chuang; Doodipala Samba Reddy
Journal:  J Pharmacol Exp Ther       Date:  2019-12-16       Impact factor: 4.030

Review 4.  Towards a Comprehensive Understanding of Anesthetic Mechanisms of Action: A Decade of Discovery.

Authors:  Hugh C Hemmings; Paul M Riegelhaupt; Max B Kelz; Ken Solt; Roderic G Eckenhoff; Beverley A Orser; Peter A Goldstein
Journal:  Trends Pharmacol Sci       Date:  2019-05-27       Impact factor: 14.819

5.  Maternally derived hormones, neurosteroids and the development of behaviour.

Authors:  James C Mouton; Renée A Duckworth
Journal:  Proc Biol Sci       Date:  2021-01-27       Impact factor: 5.349

6.  Steady-State Activation and Modulation of the Concatemeric α1β2γ2L GABAA Receptor.

Authors:  Allison L Germann; Spencer R Pierce; Ariel B Burbridge; Joe Henry Steinbach; Gustav Akk
Journal:  Mol Pharmacol       Date:  2019-07-01       Impact factor: 4.436

7.  Photoaffinity labeling identifies an intersubunit steroid-binding site in heteromeric GABA type A (GABAA) receptors.

Authors:  Selwyn S Jayakar; David C Chiara; Xiaojuan Zhou; Bo Wu; Karol S Bruzik; Keith W Miller; Jonathan B Cohen
Journal:  J Biol Chem       Date:  2020-06-15       Impact factor: 5.157

8.  Direct binding of phosphatidylglycerol at specific sites modulates desensitization of a ligand-gated ion channel.

Authors:  Ailing Tong; John T Petroff; Fong-Fu Hsu; Philipp Am Schmidpeter; Crina M Nimigean; Liam Sharp; Grace Brannigan; Wayland Wl Cheng
Journal:  Elife       Date:  2019-11-14       Impact factor: 8.140

9.  Brexanolone for the treatment of patients with postpartum depression.

Authors:  K E Morrison; A B Cole; S M Thompson; T L Bale
Journal:  Drugs Today (Barc)       Date:  2019-09       Impact factor: 2.245

10.  Validation of Trifluoromethylphenyl Diazirine Cholesterol Analogues As Cholesterol Mimetics and Photolabeling Reagents.

Authors:  Kathiresan Krishnan; Mingxing Qian; McKenna Feltes; Zi-Wei Chen; Sarah Gale; Lei Wang; Yusuke Sugasawa; David E Reichert; Jean E Schaffer; Daniel S Ory; Alex S Evers; Douglas F Covey
Journal:  ACS Chem Biol       Date:  2021-08-06       Impact factor: 5.100

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.