Literature DB >> 30323792

Purification and Characterization of Plantaricin LPL-1, a Novel Class IIa Bacteriocin Produced by Lactobacillus plantarum LPL-1 Isolated From Fermented Fish.

Yao Wang1, Yuxuan Qin1, Qing Xie1, Ying Zhang1, Jinrong Hu1, Pinglan Li1.   

Abstract

Bacteriocins are ribosomally synthesized peptides or proteins possessing antibacterial activity against foodborne pathogens and spoilage bacteria. A novel bacteriocin, plantaricin LPL-1 was determined as a class IIa bacteriocin according to the YGNGV motif, and producer strain Lactobacillus plantarum LPL-1 was identified based on physio-biochemical characteristics and 16S rDNA sequence. The novel bacteriocin, plantaricin LPL-1 was purified by salt precipitation, cation exchange, gel filtration, and reverse phase high-performance liquid chromatography (RP-HPLC). The molecular mass of plantaricin LPL-1 was 4347.8467 Da by Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) analysis and entire amino acid sequence of plantaricin LPL-1 was VIADKYYGNGVSCGKHTCTVDWGEAFSCSVSHLANFGHGKC. Plantaricin LPL-1 possessed the merits of easy degradation by proteases, wide pH stability (2-10), high thermal stability (121°C, 20 min), surfactants stability and bactericidal activity against foodborne spoilage and pathogens bacteria. The mode action and membrane permeabilization of plantaricin was identified. The information of plantaricin LPL-1 indicated that it is not only a novel class IIa bacteriocin, but also a promising natural and safe biologic preservative for the food preservation industry.

Entities:  

Keywords:  Lactobacillus plantarum; antibacterial activity; characteristics; mode of action; plantaricin LPL-1

Year:  2018        PMID: 30323792      PMCID: PMC6172451          DOI: 10.3389/fmicb.2018.02276

Source DB:  PubMed          Journal:  Front Microbiol        ISSN: 1664-302X            Impact factor:   5.640


Introduction

Bacteriocins are ribosomally synthesized peptides or protein with antibacterial activity toward strains either within the same species or across different genera (De Vuyst and Leroy, 2007), although, an increasing number of novel bacteriocins against foodborne pathogens have been reported (Liu et al., 2015; Yi et al., 2016; Zhao et al., 2016). Recently, the bacteriocins produced by lactic acid bacteria (LAB) have gained great attention because of their potential as safe and effective bio-preservative agents. It is also well-known that the bacteriocins from LAB are not only harmless to the human body, but also capable of inhibiting the growth of foodborne pathogens, such as Listeria monocytogenes, Escherichia coli, and Staphylococcus aureus (Liu et al., 2016, 2017; Yi et al., 2016), so that bacteriocins have been widely applied in many countries for natural food preservation and safety (Cotter et al., 2013; Yang et al., 2014). For example, the bacteriocin nisin, which was found in 1933 in New Zealand, has been allowed to be used in 48 countries since its first marketed in England in 1953 (Tagg et al., 1995). Based on their primary structure, molecular mass, thermal stability, mode of action, and genetic properties, the bacteriocins produced by LAB have been divided into four classes (Klaenhammer, 1993): class I (<5 kDa), heat-stable and lanthionine-containing bacteriocins; class II (<10 kDa), heat-stable and non-lanthionine-containing bacteriocins; class III (>30 kDa), heat sensitive, protein-like bacteriocins; and class IV, complex bacteriocins containing lipid or carbohydrate moieties. Among these classes, class II has been divided into four subclasses. Class IIa bacteriocins have a conserved YGNGV motif and a disulfide bond linkage in the N-terminal region that is essential for strong inhibitory effect on L. monocytogenes as well as other food spoilage and pathogenic bacteria (Perez et al., 2014). Moreover, these class IIa bacteriocins could be degraded by gastrointestinal proteases (Abbasiliasi et al., 2017). Therefore, class IIa bacteriocins are promising candidates as bio-preservatives, and are considered as a good candidate to replace chemical preservatives (Gao et al., 2010). It is well known that bacteriocin producers exist widely in fermented food, and LAB are considered as the dominant microorganism in fermented fish products (Paludan-Muller et al., 2002a; Liu et al., 2011). A variety of bacteriocin producers isolated from fermented fish have been reported, including Enterococcus faecium CN-25 (Sonsa-Ard et al., 2015), Pediococcus pentosaceus CFF4 (Peng et al., 2017), E. faecium NKR-5-3 (Ishibashi et al., 2012), Lactobacillus plantarum PMU 33 (Paludan-Muller et al., 2002b). Although previous studies have identified the bacteriocin and producer cells as valuable to the food industry, the reports concerning practical application in the food industry are relatively rare (Hata et al., 2010). Therefore, more novel bacteriocins that have potential use as natural and safe food preservatives in the food industry remain to be explored. In the present paper, a novel class IIa bacteriocin, plantaricin LPL-1 produced by L. plantarum LPL-1 isolated from fermented fish in Beijing, China, was purified and characterized. Furthermore, we describe the production, physicochemical characterization, and mode of action of plantaricin LPL-1. This study provides insight into the potential use of bacteriocins as a food preservative in the food industry.

Materials and Methods

Samples, Bacterial and Growth Conditions

Samples of fermented fish products prepared from sturgeon fish was collected from Beijing innovation team of sturgeon and trout in Beijing, People’s Republic of China. Lactic acid bacteria were cultured in MRS broth (AoBoxing, Beijing, China) at 37°C. The indicator strain, L. monocytogenes 54002 stored in lab, was cultured in TSYEB broth at 37°C. The medium used for culture of other bacteria was showed in Table . All bacteria were stored at −80°C in proper culture medium with 20% (v/v) glycerol. Antibacterial spectrum of plantaricin LPL-1.

Screening for Bacteriocin-Producing LAB Strains

Lactic acid bacteria strains from samples were spread onto the surface of MRS-agar plates, and the plates were incubated at 37°C for 24–48 h. A total of 616 single colonies were inoculated anaerobically into 5 mL of MRS broth for 24 h at 37°C. The supernatant was obtained by centrifugation of culture at 8000 × g for 20 min at 4°C and readjusted to pH 6.8 ± 0.2 using 1 M NaOH. The cell-free supernatants (CFS) of all isolated LAB strains filtered through sterile 0.22 μm filters were used for detection of antibacterial activities by agar well diffusion assay. The L. monocytogenes 54002 was used as the indicator strain. The antibacterial activities of CFS against indicator strain were determined by measuring the diameters of inhibition zones with vernier caliper. The selected strains (31 strains) with relatively higher antibacterial activity were further tested using other food spoilage bacteria (L. monocytogenes, S. aureus, Bacillus amyloliquefaciens, and Bacillus pumilus) as indicator strains. After incubation for 12 h at 37°C, the diameter of inhibition zones was measured, and a strain with relatively larger inhibition zone was selected for subsequent studies.

Identification of the Bacteriocin-Producing Strain

In addition to the catalase reaction and carbohydrate fermentation patterns, the bacteriocin-producing strain was characterized and identified based on morphological, biochemical, and physiological characteristics (Vos et al., 2009). Morphological and physiological identification was examined by Gram staining, shape, and motility through light microscopy. Biochemical identification was based upon the ability to grow at different temperatures and salt concentrations. Finally, genotype identification was confirmed according to 16S rRNA sequence analysis. The PCR reaction primers were as follows: 16S rRNA–F: 5′–AGAGTTTGATCMTGGCTCAG–3′ and 16 rRNA–R: 5′–TACGGYTACCTTGTTACGACTT–3′. Briefly, the whole genome was extracted using a genome extraction kit (TianGen, Beijing, China) and was amplified with initial denaturation for 10 min at 95°C, followed by 30 cycles of 30 s at 94°C, 30 s at 50°C, and 1 min at 72°C, with final extension for 10 min at 72°C. The PCR products were purified by PCR purification kit (TianGen, Beijing, China) and were sequenced by Sangon Biotech (Shanghai, China). The results of DNA sequencing were blasted against the GenBank database[1]. Subsequently, software MEGA 7.0 was used for phylogenetic analysis.

Dynamics of Growth and Antibacterial Activity of Bacteriocin

Lactobacillus plantarum LPL-1 was cultured in 50 mL MRS broth until OD600 = 0.4, then inoculated into 1 L MRS broth (pH 6.5) at 0.5% level (v/v) inoculum for 64 h at 37°C without agitation. During this process, culture samples were taken every 4 h to determine the cell density measured at 600 nm, pH of the culture and antibacterial activity against an indicator strain (L. monocytogenes 54002). The antibacterial activity of crude plantaricin LPL-1 was assessed by agar-well diffusion method (Mayr-Harting et al., 1972). The activity was expressed as arbitrary units per milliliter of culture medium (AU/mL) and one AU was defined as the reciprocal of the highest two-fold dilution exhibiting a clear inhibition zone of the indicator strain (Deraz et al., 2005).

Purification Process of Plantaricin LPL-1

Lactobacillus plantarum LPL-1 was statically cultured in 50 mL MRS broth to OD600 = 0.4, at which point 0.5% (v/v) of the above culture was inoculated into 1000 mL MRS broth and then incubated for 32 h at 37°C without agitation. The fermentation culture was centrifuged at 8000 × g for 20 min at 4°C to remove bacterial cells. Then, ammonium sulfate was added to the collected supernatant to 70% saturation with stirring at 4°C. The mixture was centrifuged at 8000 × g for 20 min at 4°C to obtain supernatant containing crude bacteriocin. The crude bacteriocin was suspended in 20 mL distilled water and the activity against the indicator strain was assayed by agar-well diffusion method (Mayr-Harting et al., 1972). The sample was stored in 30% (v/v) glycerol at −20°C for further analyses. The SP-Sepharose Fast Flow cation exchange column (1.6 × 2.0 cm, GE, Uppsala, Sweden) incorporated with ÄKTATM chromatography system (GE, Sweden and United States) was equilibrated with 20 mM phosphate buffer (pH 5.5). After equilibration, the crude bacteriocin was filtered through a 0.22 μm filter membrane (Merck Millipore, United States) and was loaded onto column. The loaded column was washed with 20 mM phosphate buffer (pH 5.5) and active fractions were eluted with a linear gradient from 0 to 1 M NaCl for 90 min. The flow rate was 1 mL/min and absorbance was 280 nm. The collected absorption peaks were evaluated for antibacterial activity and the active fraction was stored for further purification and analyses. Similarly, the active fraction, which was collected by cation exchange chromatography and filtered through 0.22 μm filter membrane, was loaded onto a Sephadex G25 column (2.6 × 10.0 cm, GE, Uppsala, Sweden) equilibrated with 20 mM phosphate buffer (pH 5.5). The column was eluted with the same buffer and the different absorption peaks were collected. The flow rate was 0.5 mL/min and the absorbance was 280 nm. The collected fractions were evaluated for antibacterial activity and the active fraction was dialyzed in distilled water for further purification. The active fraction purified from gel filtration chromatography process was loaded onto a C18 reverse-phase column (5 μm, 4.6 × 250 mm, Agilent, CA, United States) and incorporated in reverse phase high-performance liquid chromatography (RP-HPLC) system (Agilent, CA, Untied States) by a liner gradient elution with 95% water-acetonitrile (5–95%) containing 0.1% trifluoroacetic acid (TFA) in 30 min. The flow rate was 0.5 mL/min and the absorbance was monitored at 280 nm. The purified active fraction was evaluated for antibacterial activity and identified molecular mass. The concentration of protein in every process of purification was determined by bicinchoninic acid (BCA) kit (Thermo Fisher Scientific, MA, United States) as described by instructions.

Determination of Molecular Mass

The molecular mass of plantaricin LPL-1 was determined by ABI 4700 matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry (Applied Biosystems, Foster city, United States). The sample was spotted on a target plate, left to dry, and α-cyano-4-hydroxycinnamic acid (Sigma, United States) matrix solution was spotted on the same target plate. Spectrum was then operated in positive ion mode for MALDI analysis.

Antibacterial Spectrum and Inhibitory Concentration of Plantaricin LPL-1

The partially purified plantaricin LPL-1 preparation from cation exchange chromatography was used to determine the antibacterial spectrum against indicator organisms including food spoilage bacteria, foodborne pathogens, and fungi (Table ). The diameter of inhibition zones was measured by Vernier caliper. The minimum inhibitory concentration (MIC) of plantaricin LPL-1 against indicator strains was specified by the serial two-fold method. Briefly, the stock solution of 512 μg/mL plantaricin LPL-1 was 2-fold serially diluted with 20 mM phosphate buffer (pH 6.5) and 100 μL of each dilution was added into the wells. The cultured different indicator strains were spread on the plate and the plate was incubated at 37°C for 16 h to determine MIC values. The MIC was defined as the lowest concentration of plantaricin LPL-1 that exhibited a clear inhibition zone of indicator strains.

Effects of Enzyme, pH, Temperature and Surfactant on Activity of Plantaricin LPL-1

The sensitivity of purified plantaricin LPL-1 toward various proteases were individually evaluated by incubating 360 μL of bacteriocin (256 μg/mL) with 40 μL of the following enzymes (Sigma) at a final concentration of 1 mg/mL: pepsin (pH 3.0), papain (pH 6.5), proteinase K (pH 7.5), trypsin (pH 7.6) and chymotrypsin (pH 7.8). After 3 h of incubation at appropriate the temperature (Table ), the activity against indicator strain (L. monocytogenes 54002) was determined. Non-enzymic treatment was used as control test. The pH stability of purified plantaricin LPL-1 (256 μg/mL) was determined by adjusting pH with HCl and NaOH in a range from 2.0 to 10.0. After 3 h of incubation at 37°C, the pH was readjusted to 6.0 and the activity of plantaricin LPL-1 was assayed. To determine thermal stability of plantaricin LPL-1 (256 μg/mL), the samples were exposed in a thermostatic water bath at temperatures of 60, 80 and 100°C for 20 and 30 min, and in an autoclave at 121°C for 20 min. The residual activity against indicator was measured and samples at 25°C were used as control. The effect of surfactants on plantaricin LPL-1 (256 μg/mL) was examined by adding 1% (v/v) concentration of EDTA, Tween 20, Tween 80, and urea, separately. After 3 h of incubation at 37°C, the remaining activity against indicator was determined and untreated samples were used as a control test.

Mode of Action

To determine the mode of action of plantaricin LPL-1, the indicator strain, L. monocytogenes 54002 was cultured in TSYEB broth for 16 h at 37°C. Cells were harvested and resuspended in sterile 20 mM sodium phosphate buffer to give 108 CFU/mL approximately. Bacteriocin was added for final concentration of 256 μg/mL, while a sample without added bacteriocin was used as control. All samples were incubated for 5 h at 37°C. The optical density (600 nm) and viable cells were monitored every 1 h (Deraz et al., 2007).

Membrane Permeabilization

The fluorescence was detected using RT-PCR instrument combined with 5 μM SYTOXTM Green Stain (Invitrogen, United States). Cells were resuspended in sterile 20 mM sodium phosphate buffer to give 106 CFU/mL approximately. Bacteriocin was added at final concentration of 256 and 128 μg/mL, respectively, while a sample with added sodium phosphate buffer was used as control. Meanwhile, the treated cells were examined using confocal laser scanning microscopy (CLSM; Leica, United States) combined with 5 μM SYTOXTM Green Dead Cell Stain.

Statistical Analysis

All experiments were performed in triplicate. The data were tested by ANOVA and Duncan’s test with SPSS 23.0. All results were presented as mean ± standard deviations (SD) and p-value < 0.05 was considered statistically significant.

Results

Screening of Bacteriocin-Producing LAB Strains

A total of 616 potential bacteriocin-producing LAB strains isolated from fermented fish products were incubated in MRS broth. The CFS of 31 strains showed antibacterial activity against indicator strain in primary screening process (Supplementary Table ). After secondary screening process, the CFS of three strains exhibited higher antibacterial activity against other food spoilage bacteria. Among three strains, strain LPL-1 possessed the highest antibacterial activity was selected as target strain.

Identification of Strain LPL-1

Strain LPL-1, isolated from fermented fish, was characterized as a Gram-positive, rod-shaped, catalase-negative, and facultative anaerobic strain without spore formation. It could grow at 15°C but not at 45°C and in 3.0% NaCl but not in 6.0% NaCl. In addition, it could produce acid from glucose, and was capable of metabolizing fructose, galactose, glucose, lactose, maltose, sucrose, mannose, and xylose. Furthermore, the complete genome and the 1488 bp 16S rRNA nucleotide sequence was identified (GenBank accession number CP021997.1). A neighbor-joining phylogenetic tree (Supplementary Figure ) was constructed by sequence alignment using MEGA 7.0 (Kumar et al., 2016) (Supplementary Table ), which showed extremely high similarity (identity ≥ 99%, E value = 0) to L. plantarum (Figure ). Dynamics of growth and production of plantaricin LPL-1 from L. plantarum LPL-1. Growth curve (); pH (); and Activity against indicator ().

Dynamics of Growth and Bacteriocin Production

Dynamics of growth, bacteriocin production, and pH of L. plantarum LPL-1 were examined in MRS broth at 37°C (Figure ). During growth, LPL-1 entered exponential growth phase at 4 h, remained in stationary phase from 20 to 52 h and reached decline phase after 52 h. The activity of bacteriocin against the indicator strain (L. monocytogenes 54002) was determined by the size of the diameter of inhibition zone. Accordingly, the bacteriocin was produced at 12 h during the late exponential growth phase and reached maximum at 32 h during stationary phase. The pH of the medium was decreased from 6.5 to 4.02.

Purification of Plantaricin LPL-1

The plantaricin LPL-1 was obtained by ammonium sulfate precipitation, cation exchange column, gel-filtration chromatography, and RP-HPLC. The results of different purification steps were shown in Table . Purification of plantaricin LPL-1. Crude plantaricin LPL-1 was concentrated from culture supernatant by ammonium sulfate precipitation. The purification fold was 2.56 and recovery was 79.68%. The crude bacteriocin was purified with an SP-Sepharose Fast Flow cation exchange column (Figure ). Peak 5 showed antibacterial activity by agar well diffusion method (Figure ) and a dominant band was about 4.0 kDa by Tricine-SDS-PAGE (Figure ). At this purification step, approximately 37.16-fold purification and 35.96% recovery were achieved. The active fraction was subjected to Sephadex G10 gel-filtration chromatography (Figure ). Peak 1 was also capable of inhibiting growth of indicator strain (Figure ) and the dominant band was further purified (Figure ). The antibacterial activity increased 61.66-fold, and 8.32% of the initial activity was recovered. Following the final purification by RP-HPLC, the process showed a single peak (Figure ) and the peak was active against indicator strain (Figure ), and the plantaricin LPL-1 was further purified (Figure ). This purification step increased 86.63-fold activity and the recovery was 2.08%. Purification of plantaricin LPL-1 produced by L. plantarum LPL-1 by chromatography column. (A) Cation exchange column; (B) gel filtration chromatography; and (C): RP-HPLC process. (a) Process of purification; (b): antibacterial activity of absorbance peaks against indicator strain compared with CK (control test) by agar well diffusion assay; and (c): Tricine-SDS-PAGE of purified activity fraction.

Molecular Mass and Sequence of Plantaricin LPL-1

MALDI-TOF-MS analysis of purified plantaricin LPL-1 from RP-HPLC procedure showed that its molecular mass was 4347.8467 Da (Figure ). Furthermore, the complete sequence of prebacteriocin was identified (GenBank accession number CP021998) (Wang et al., 2018). However, the cleavage site between leader peptide and mature peptide was uncertain. According to the information of genome sequence and molecular mass, the entire amino acid sequence was VIADKYYGNGVSCGKHTCTVDWGEAFSCSVSHLANFGHGKC. The observed molecular (4347.8467 Da) mass was about 2 Da smaller than the calculated (4349.84 Da) because of the formation of a disulfide bond. This bond is essential for the activity against the indicator strain (Drider et al., 2006). According to the N-terminal conserved YGNGV motif of mature class IIa bacteriocin, plantaricin LPL-1 belongs to class IIa bacteriocin. Hence, this study is the first to report the novel amino acid sequence and molecular mass of plantaricin to be 4347.8467 Da. The sequence of plantaricin LPL-1 did not show homology with the known bacteriocins by protein BLAST against the GenBank (see footnote 1) and the Antimicrobial Peptide Database[2]. Aligned with reported class IIa bacteriocin, plantaricin 423 (van Reenen et al., 2010), plantaricin C19 (Atrih et al., 2001) from L. plantarum, plantaricin LPL-1 possessed novel amino acid sequence (Figure ). Therefore, plantaricin LPL-1 is a novel class IIa bacteriocin from L. plantarum. Mass spectrum of plantaricin LPL-1 by MALDI-TOF-MS. Alignment of reported class IIa bacteriocin, plantaricin 423, plantaricin C19, and plantaricin LPL-1 from L. plantarum. Alignments were obtained using Vector NTI 11.5 with default settings.

Antibacterial Spectrum of Plantaricin LPL-1

The antibacterial spectrum of plantaricin LPL-1 is shown in Table . Plantaricin LPL-1 exhibited significant antibacterial activity against Gram-positive bacteria, such as S. aureus, L. monocytogenes, B. pumilus, B. amyloliquefaciens, E. faecalis, L. plantarum, Lactobacillus delbrueckii, Lb. bulgaricus, Lactobacillus Salivarius, and L. lactis. However, the purified plantaricin LPL-1 did not show antibacterial activity against E. coli, Pichia pastoris, or Saccharomyces cerevisiae.

Characteristics of Plantaricin LPL-1

After treatment with various enzymes, including pepsin, papain, proteinase K, trypsin, and chymotrypsin, the inhibitory activity of plantaricin LPL-1 was lost completely (Table ). These enzymes exist in the human body. Effect of enzymes on antibacterial activity. Additionally, the information of pH stability revealed that plantaricin LPL-1 kept 90% of activity at pH between 2.0 and 7.0 and maintained 25% of antibacterial activity at pH 10 (Figure ). Effects of pH, temperature and surfactant on stability of plantaricin LPL-1. (A) pH; (B) temperature; and (C) surfactants. Assessment of thermal stability demonstrated that plantaricin LPL-1 remained stable after treatment at 60, 80, and 100°C for 15 and 30 min. 58.82% inhibitory activity was observed after treatment at 120° for 20 min (Figure ). Surfactants do not affect protein activity and play an important role in the food industry (Kralova and Sjöblom, 2009). The activity of plantaricin LPL-1 remained stable after incubation with chemical surfactants 1% (V/V) Tween 20, Tween 80, urea, and EDTA at 37°C for 3 h (Figure ). To understand the mechanism of plantaricin LPL-1 against L. monocytogenes 54002, it is essential to analyze the mode of action. The number of viable cells (2.11 Log10 cfu) and optical density (0.69 units) decreased after 3 h (Figure ). This indicates that plantaricin LPL-1 induced cell lysis via bactericidal activity. Mode of action of plantaricin LPL-1 against the indicator cells of Listeria monocytogenes 54002. (): Viable cell count without bacteriocin; (Δ): viable cell count with bacteriocin; (): optical density at 600 nm without bacteriocin; and (□): optical density at 600 nm with bacteriocin. The fluorescence intensity of treatment with plantaricin LPL-1 was increased during the membrane damage of L. monocytogenes 54002. However, the fluorescence intensity of control test remained stable (Figure ). As showed in Figure , the amounts of dead cells were increased gradually during incubation with 256 μg/mL plantaricin LPL-1. The results suggested that the SYTOX Green stain bound nucleic acids and cell membrane was damaged. Analysis of membrane permeabilization Listeria monocytogenes 54002 using RT-PCR instrument combined with SYTOXTM Green Dead Cell Stain. (): Treatment with 128 μg/mL plantaricin; (•): treatment with 256 μg/mL plantaricin; and (): control test with sodium phosphate buffer. CLSM images of dead Listeria monocytogenes 54002. (A) Control test with sodium phosphate buffer and treatment with 256 μg/mL plantaricin for 10 min (B), 20 min (C) and 30 min (D).

Discussion

In the previous study (Wang et al., 2018), the complete genome sequence of L. plantarum LPL-1 and biosynthetic mechanism of plantaricin LPL-1 were analyzed. The plantaricin LPL-1 was just purified by absorption and desorption of pH, and cation exchange column, but it did not prove that plantaricin LPL-1 was a novel class IIa bacteriocin. The precursor of class IIa bacteriocin contains leader peptide and mature peptide, and the N-terminal leader peptide is cleaved to form a mature antibacterial bacteriocin. The previous study predicated the amino acid sequence of precursor and cleavage site between leader peptide and mature peptide by bioinformatic analyses. However, cleavage site and molecular mass of mature bacteriocin remained to be determined precisely by Matrix-Assisted Laser Desorption/Ionization Time of Flight Mass Spectrometry (MALDI-TOF-MS). Based on the previous bioinformatic prediction, the present study confirmed precisely the amino acid sequence of mature plantaricin LPL-1 by MALDI-TOF-MS and proved that plantaricin LPL-1 was a novel class IIa bacteriocin. Moreover, the plantaricin LPL-1 was purified by ammonium sulfate precipitation, cation exchange chromatography, gel filtration chromatography and RP-HPLC, different from the previous study (Wang et al., 2018). Also, the production, physicochemical characterization, mode of action, antibacterial spectrum, membrane permeabilization, and MIC values of plantaricin LPL-1 determined. A wide range of new plantaricins was identified from L. plantarum, including plantaricin C19 (3.8 kDa) (Atrih et al., 2001), plantaricin ASM1 (5045.7 Da) (Hata et al., 2010), plantaricin Y (4.2 kDa) (Chen et al., 2014), and plantaricin 163 (3.5 kDa) (Hu et al., 2013). The molecular mass of plantaricin LPL-1 was 4347.8467 Da, which is different from those of previously studied plantaricins. Many strains of L. plantarum, and their bacteriocins have been identified, for example, L. plantarum B391 (bacteriocin B391) (Fernandes et al., 2017), L. plantarum JLA-9 (bacteriocin JLA-9) (Zhao et al., 2016), and L. plantarum ZJ2008 (plantaricin ZJ2008) (Zhu et al., 2014). Similar to the previous studies of L. plantarum, the strain LPL-1 was determined as L. plantarum, which has potential value as a starter culture due to its functional properties (Mathara et al., 2008). In the present study, L. plantarum LPL-1 is capable of producing bacteriocin, which highlights that it is an ideal candidate for bio-preservative in food industries. To determine the amino acid sequence, the plantaricin LPL-1 was purified. According to previous studies, several classical strategies including salt precipitation, cation exchange, gel filtration, and RP-HPLC were used as methods of purification. A series of bacteriocin, bifidocin A (Liu et al., 2015), lactocin XN8-A (Yi et al., 2016), and plantaricin JLA-9 (Zhao et al., 2016) have been purified by the mentioned procedure. Also, these techniques were used for purification of plantaricin LPL-1. The parameters of purification efficiencies are shown in Table . Specifically, the purification process of RP-HPLC provided a basis for determination of molecular mass. According to the information of complete genome sequence and mass spectrum, the amino acid sequence was determined. The sequence of plantaricin LPL-1 did not show homology with the known bacteriocins by protein BLAST against the GenBank (see footnote 2) and the Antimicrobial Peptide Database (see footnote 3); therefore, plantaricin LPL-1 is a novel member of class IIa bacteriocins as some amino acids (YGNGV motif) in the sequences shown in Figure are conserved. The common consensus of N-terminal region was KYYGNGxxCxKxxCxVxWGxAFSC. Plantaricin LPL-1 exhibited significant antibacterial activity against Gram-positive bacteria. Similar to other class IIa bacteriocins produced by L. plantarum, such as plantaricin 423 (van Reenen et al., 2010), plantaricin C19 (Atrih et al., 2001) and plantaricin WHE92 (Ennahar et al., 1996), the purified plantaricin LPL-1 did not show antibacterial activity against E. coli, P. pastoris, or S. cerevisiae. Also, Gram-negative bacteria, such as E. coli, Shiga toxin-producing E. coli (STEC), and Salmonella are most frequently detected in food industry. To control food spoilage induced by Gram-negative bacteria, many authors have used bacteriocins as a part of hurdle technology (Leistner, 2000). Concretely, these Gram-negative bacteria could be controlled when bacteriocins combined with mental chelators (EDTA, sodium tripolyphosphate) or physical methods such as temperature, pH, pulsed electric field and high hydrostatic pressure (HHP) (Martínez et al., 2008; Ananou et al., 2010; Zhao et al., 2013; Khan et al., 2015; Prudêncio et al., 2015). Based on previous reports, we recommend the use of plantaricin LPL-1 combined with mental chelators or physical methods to establish a series of hurdles to control Gram-negative bacteria and fungi in different food systems. Even, the producer strain could be directly used as bio-preservative for the production of plantaricin LPL-1 and organic acid in fermented and acid products. Many bacteriocins have been shown to inhibit growth of homologous species (Tagg et al., 1995). Plantaricin LPL-1 not only possessed inhibitory activity against LAB belonging to beer spoilage microorganisms (Vaughan et al., 2012), but also against other foodborne pathogenic and spoilage bacteria. Thus, as a novel preservative candidate, plantaricin LPL-1 has the potential value as a bio-preservative in the food industry. Recombinant DNA techniques can be used to produce sufficient protein for large-scale production. Many class IIa bacteriocins have been expressed in model strains, such as bactofencin A expressed in E. coli (Mesa-Pereira et al., 2017), piscicolin 126 expressed in E. coli (Gibbs et al., 2004), pediocin PA-1 expressed in E. coli (Beaulieu et al., 2007), and pediocin PA-1 expressed in P. pastoris (Beaulieu et al., 2005). Specifically, the activity of mesentericin Y105 expressed in L. mesenteroides Y 105 was improved by PCR random mutagenesis (Morisset et al., 2004). Therefore, we will improve the activity and production of plantaricin LPL-1 in E. coli, P. Pastoris, or L. lactis by molecular techniques. The bacteriocin was a secondary metabolite (Bibb, 2005). To meet the demand for fermentation, the results of dynamics of growth and bacteriocin production provide a basis for large-scale production of bacteriocin LPL-1 by fermentation process. Plantaricin LPL-1 was stable in all chemical treatments. After treatment with various enzymes exist in the human body, the inhibitory activity of plantaricin LPL-1 was lost completely. Further, many plantaricins, such as plantaricin JLA-9 (Zhao et al., 2016) and plantaricin K25 (Wen et al., 2016), have similar properties in enzyme treatments. The results indicate that plantaricin LPL-1 can be digested and safely used in the food industry. However, safety for the human body remains to be determined by toxicology tests. Additionally, the information of pH stability suggested that plantaricin LPL-1 possesses potential value in acidic, neutral, and alkaline food. Assessment of thermal stability demonstrated that plantaricin LPL-1 allows for it be used in pasteurized dairy products and heat-processed food. Similar to other reported plantaricins, plantaricin JLA-9 (Zhao et al., 2016) and plantaricin J23 (Rojo-Bezares et al., 2007), plantaricin LPL-1 possessed thermal stability. The stability of plantaricin LPL-1 against surfactants makes it suitable for emulsified food. Therefore, plantaricin LPL-1 is a promising natural and safe biological preservative for the food industry. SYTOXTM Green Stain could penetrate cell membranes of dead cells, and bind nuclear acid and chromosome, but it has no effect on live cells. The membrane permeabilization of indicator strains was detected using RT-PCR instrument and CLSM. Furthermore, our team is currently investigating the mechanism of action against L. monocytogenes 54002. It is possible that the bactericidal activity disrupts membrane integrity and induces increased permeability. The mechanism of action for pore-forming compounds can be described by five models: barrel-stave, wedge, toroidal pore, carpet, and aggregate channel (Snyder and Worobo, 2014). To determine the mechanisms of action of plantaricin LPL-1, further investigation based on atomic force microscopy (AFM), scanning tunneling microscopy (STM), and transmission electron microscopy (TEM) will be needed. Additionally, the proton motive force (PMF), the intracellular ATP levels, and the electric conductivity should be also measured to asses membrane damage and imbalance between inside and outside cell environment (Ennahar et al., 2000).

Conclusion

The novel class IIa bacteriocin, plantaricin LPL-1 produced by L. plantarum LPL-1 is first reported in this study. The entire amino acid sequence of plantaricin LPL-1 was VIADKYYGNGVSCGKHTCTVDWGEAFSCSVSHLANFGHGKC. Plantaricin LPL-1, which has a molecular mass of 4347.8467 Da, possessed bactericidal activity against foodborne spoilage and pathogenic bacteria, wide pH stability, high thermal stability, and surfactants stability, and was easily degraded by proteases. The mode action and membrane permeabilization of plantaricin was identified. Therefore, plantaricin LPL-1 is a promising natural and safe biological preservative for the food industry. Future study will investigate the bactericidal mechanism of plantaricin LPL-1.

Author Contributions

YW and PL designed the experiments. YW, YQ, QX, YZ, and JH performed the experiments. YW and YQ analyzed the results and wrote the manuscript.

Conflict of Interest Statement

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Table 1

Antibacterial spectrum of plantaricin LPL-1.

Indicator strainSourceMediaActivity (mm)MIC (μg/mL)
Gram-positive bacteria
Listeria monocytogenes 54002NICPBPTSYEB16.4 ± 0.2316
L. monocytogenes 19113(3a)ATCCTSYEB16.32 ± 0.4316
L. monocytogenes 19114(4a)ATCCTSYEB16.21 ± 0.3516
Staphylococcus aureus 13565ATCCTSB9.12 ± 0.4232
S. aureus 6538CGNCCTSB8.21 ± 0.2132
S. aureus 26112CVCCTSB8.31 ± 0.4232
Enterococcus faecalis M2LabMRS6.32 ± 0.5232
E. faecalisLabMRS7.98 ± 0.1132
Lactobacillus delbrueckii subsp.lactisLabMRS18.81 ± 0.1216
Lactobacillus plantarum S-35LabMRS17.32 ± 0.3316
L. plantarum γ-35LabMRS16.98 ± 0.2116
Lactobacillus bulgaricusLabMRS14.32 ± 0.2916
Lactobacillus salivariusLabMRS15.11 ± 0.3216
Lactococcus lactis NZ9000LabMRS14.43 ± 0.2116
L. lactis MG1363LabMRS14.12 ± 0.3916
Bacillus amyloliquefaciensLabLB7.43 ± 0.3232
B. pumilusLabLB7.67 ± 0.2132
Gram-negative bacteria
Escherichia coli DH5αLabLB0
E. coli BL21LabLB0
E. coli BW25113LabLB0
E. coli JM109LabLB0
Fungi
Saccharomyces cerevisiaeLabYPD0
Pichia pastoris GS115LabYPD0
Table 2

Purification of plantaricin LPL-1.

Purification StageVolume (mL)Total protein (mg)Total activity (AU)Specific activity (AU/mg)Purification foldRecovery (%)
Culture supernatant10004,002256,00063.961100
Ammonium sulfate precipitation201,245204,000163.852.5679.68
SP-Sepharose Fast Flow1038.792,0002,377.2637.1635.93
Sephadex G1045.421,3003,944.4461.668.32
RP-HPLC0.30.965,3205,541.6686.632.08
Table 3

Effect of enzymes on antibacterial activity.

EnzymepHDiameter (mm)Residual activity (%)Temperature (°C)
Pepsin30037
Papain6.50037
Proteinase K7.50037
Trypsin7.60025
Chymotrypsin7.80025
CK (control test)616.32 ± 0.1210037
  35 in total

Review 1.  Basic aspects of food preservation by hurdle technology.

Authors:  L Leistner
Journal:  Int J Food Microbiol       Date:  2000-04-10       Impact factor: 5.277

Review 2.  Regulation of secondary metabolism in streptomycetes.

Authors:  Mervyn J Bibb
Journal:  Curr Opin Microbiol       Date:  2005-04       Impact factor: 7.934

3.  Functional properties of Lactobacillus plantarum strains isolated from Maasai traditional fermented milk products in Kenya.

Authors:  Julius Maina Mathara; Ulrich Schillinger; Phillip M Kutima; Samuel K Mbugua; Claudia Guigas; Charles Franz; Wilhelm H Holzapfel
Journal:  Curr Microbiol       Date:  2008-01-03       Impact factor: 2.188

4.  The complete genome sequence of Lactobacillus plantarum LPL-1, a novel antibacterial probiotic producing class IIa bacteriocin.

Authors:  Yao Wang; Nan Shang; Yuxuan Qin; Ying Zhang; Jinlan Zhang; Pinglan Li
Journal:  J Biotechnol       Date:  2017-12-09       Impact factor: 3.307

5.  Purification and Characterization of Plantaricin JLA-9: A Novel Bacteriocin against Bacillus spp. Produced by Lactobacillus plantarum JLA-9 from Suan-Tsai, a Traditional Chinese Fermented Cabbage.

Authors:  Shengming Zhao; Jinzhi Han; Xiaomei Bie; Zhaoxin Lu; Chong Zhang; Fengxia Lv
Journal:  J Agric Food Chem       Date:  2016-03-24       Impact factor: 5.279

6.  Production of pediocin PA-1 in the methylotrophic yeast Pichia pastoris reveals unexpected inhibition of its biological activity due to the presence of collagen-like material.

Authors:  Lucie Beaulieu; Denis Groleau; Carlos B Miguez; Jean-François Jetté; Hafida Aomari; Muriel Subirade
Journal:  Protein Expr Purif       Date:  2005-10       Impact factor: 1.650

7.  Mutational analysis of mesentericin y105, an anti-Listeria bacteriocin, for determination of impact on bactericidal activity, in vitro secondary structure, and membrane interaction.

Authors:  Dany Morisset; Jean-Marc Berjeaud; Didier Marion; Christian Lacombe; Jacques Frère
Journal:  Appl Environ Microbiol       Date:  2004-08       Impact factor: 4.792

8.  Mode of action of acidocin D20079, a bacteriocin produced by the potential probiotic strain, Lactobacillus acidophilus DSM 20079.

Authors:  Sahar F Deraz; Eva Nordberg Karlsson; Ashraf A Khalil; Bo Mattiasson
Journal:  J Ind Microbiol Biotechnol       Date:  2007-01-26       Impact factor: 4.258

Review 9.  Novel bacteriocins from lactic acid bacteria (LAB): various structures and applications.

Authors:  Rodney H Perez; Takeshi Zendo; Kenji Sonomoto
Journal:  Microb Cell Fact       Date:  2014-08-29       Impact factor: 5.328

10.  Controlled functional expression of the bacteriocins pediocin PA-1 and bactofencin A in Escherichia coli.

Authors:  Beatriz Mesa-Pereira; Paula M O'Connor; Mary C Rea; Paul D Cotter; Colin Hill; R Paul Ross
Journal:  Sci Rep       Date:  2017-06-08       Impact factor: 4.379

View more
  11 in total

Review 1.  Bacteriocins from lactic acid bacteria and their potential clinical applications.

Authors:  Abigail Fernandes; Renitta Jobby
Journal:  Appl Biochem Biotechnol       Date:  2022-03-15       Impact factor: 3.094

2.  Partial purification and characterization of a broad-spectrum bacteriocin produced by a Lactobacillus plantarum zrx03 isolated from infant's feces.

Authors:  Shuang Lei; Ruixiang Zhao; Junliang Sun; Junjian Ran; Xiaoli Ruan; Yang Zhu
Journal:  Food Sci Nutr       Date:  2020-03-18       Impact factor: 2.863

3.  Bacteriostatic activity and partial characterization of the bacteriocin produced by L. plantarum sp. isolated from traditional sourdough.

Authors:  Mina Zangeneh; Sadegh Khorrami; Moj Khaleghi
Journal:  Food Sci Nutr       Date:  2020-09-13       Impact factor: 2.863

4.  Enhancement of the antibacterial potential of plantaricin by incorporation into silver nanoparticles.

Authors:  Sara Adel Amer; Hala Mohamed Abushady; Rasha Mohamed Refay; Mahmoud Ahmed Mailam
Journal:  J Genet Eng Biotechnol       Date:  2021-01-20

Review 5.  Health-Promoting Role of Lactiplantibacillus plantarum Isolated from Fermented Foods.

Authors:  Natalia Garcia-Gonzalez; Natalia Battista; Roberta Prete; Aldo Corsetti
Journal:  Microorganisms       Date:  2021-02-10

Review 6.  Bacteriocins: Properties and potential use as antimicrobials.

Authors:  Atieh Darbandi; Arezoo Asadi; Marzieh Mahdizade Ari; Elnaz Ohadi; Malihe Talebi; Masoume Halaj Zadeh; Amir Darb Emamie; Roya Ghanavati; Maryam Kakanj
Journal:  J Clin Lab Anal       Date:  2021-12-01       Impact factor: 2.352

7.  Characterization of a Lactiplantibacillus plantarum R23 Isolated from Arugula by Whole-Genome Sequencing and Its Bacteriocin Production Ability.

Authors:  Joana Barbosa; Helena Albano; Beatriz Silva; Maria Helena Almeida; Teresa Nogueira; Paula Teixeira
Journal:  Int J Environ Res Public Health       Date:  2021-05-21       Impact factor: 3.390

8.  Genome Analysis of Lactobacillus plantarum Isolated From Some Indian Fermented Foods for Bacteriocin Production and Probiotic Marker Genes.

Authors:  Aditi Goel; Prakash M Halami; Jyoti Prakash Tamang
Journal:  Front Microbiol       Date:  2020-01-29       Impact factor: 5.640

9.  A New Approach to Harness Probiotics Against Common Bacterial Skin Pathogens: Towards Living Antimicrobials.

Authors:  Ghazi Khalfallah; Rita Gartzen; Martin Möller; Elisabeth Heine; Rudolf Lütticken
Journal:  Probiotics Antimicrob Proteins       Date:  2021-04-15       Impact factor: 4.609

10.  Anti-Proliferative and Anti-Biofilm Potentials of Bacteriocins Produced by Non-Pathogenic Enterococcus sp.

Authors:  Fatma Molham; Ahmed S Khairalla; Ahmed F Azmy; Eman El-Gebaly; Ahmed O El-Gendy; Sameh AbdelGhani
Journal:  Probiotics Antimicrob Proteins       Date:  2020-10-03       Impact factor: 4.609

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.