Literature DB >> 28817804

Structural Mechanism for Modulation of Synaptic Neuroligin-Neurexin Signaling by MDGA Proteins.

Jonathan Elegheert1, Vedrana Cvetkovska2, Amber J Clayton3, Christina Heroven4, Kristel M Vennekens5, Samuel N Smukowski6, Michael C Regan7, Wanyi Jia3, Alexandra C Smith8, Hiro Furukawa7, Jeffrey N Savas6, Joris de Wit5, Jo Begbie8, Ann Marie Craig9, A Radu Aricescu10.   

Abstract

Neuroligin-neurexin (NL-NRX) complexes are fundamental synaptic organizers in the central nervous system. An accurate spatial and temporal control of NL-NRX signaling is crucial to balance excitatory and inhibitory neurotransmission, and perturbations are linked with neurodevelopmental and psychiatric disorders. MDGA proteins bind NLs and control their function and interaction with NRXs via unknown mechanisms. Here, we report crystal structures of MDGA1, the NL1-MDGA1 complex, and a spliced NL1 isoform. Two large, multi-domain MDGA molecules fold into rigid triangular structures, cradling a dimeric NL to prevent NRX binding. Structural analyses guided the discovery of a broad, splicing-modulated interaction network between MDGA and NL family members and helped rationalize the impact of autism-linked mutations. We demonstrate that expression levels largely determine whether MDGAs act selectively or suppress the synapse organizing function of multiple NLs. These results illustrate a potentially brain-wide regulatory mechanism for NL-NRX signaling modulation.
Copyright © 2017 MRC Laboratory of Molecular Biology. Published by Elsevier Inc. All rights reserved.

Entities:  

Keywords:  ASD; MDGA; autism spectrum disorder; neurexin; neuroligin; synaptic organizer protein; synaptic transmission

Mesh:

Substances:

Year:  2017        PMID: 28817804      PMCID: PMC5563082          DOI: 10.1016/j.neuron.2017.07.040

Source DB:  PubMed          Journal:  Neuron        ISSN: 0896-6273            Impact factor:   17.173


Introduction

Cell-surface synaptic organizing proteins play a central role in the assembly, maturation, stabilization, and plasticity of neuronal synapses (Siddiqui and Craig, 2011). Members of the presynaptic neurexin (NRX) and postsynaptic neuroligin (NL) transmembrane protein families form the axis of a signaling pathway that is crucial for the formation and function of excitatory and inhibitory synapses throughout the brain (Südhof, 2008). The NL-NRX complexes promote synaptic cell adhesion via direct extracellular interactions and recruit the molecular machinery for neurotransmitter release and reception. NLs recruit ionotropic glutamate and GABAA receptors through direct interactions or using DLG (Discs large) family or gephyrin and collybistin accessory proteins, respectively (Bemben et al., 2015). NRXs interact intracellularly with CASK and Mint PDZ domain proteins and the synaptic vesicle protein synaptotagmin; α-NRXs also functionally link to presynaptic voltage-gated Ca2+ channels (Reissner et al., 2013). NLs are generated from five genes in humans or four genes in mice, and further diversified by two sites of alternative splicing: spliced sequences A (SSA) and B (SSB). Mammalian NRXs show even greater diversity: over a thousand variants are generated from three genes, two promoters (α and β), and six sites of alternative splicing (SS1–6) (Schreiner et al., 2014, Ullrich et al., 1995). The extracellular region of the NLs contains a cholinesterase-like domain that forms a stable interaction with the α/β-NRX1-3 LNS6 (laminin, NRX, sex-hormone-binding globulin) domain (Araç et al., 2007, Chen et al., 2008, Fabrichny et al., 2007). NL1(+B) binds only β-NRXs (Boucard et al., 2005) and functions at glutamatergic synapses (Song et al., 1999), while NL2 binds all NRXs and functions at GABAergic synapses (Graf et al., 2004, Varoqueaux et al., 2004). Besides NLs, the various NRXs bind a multitude of postsynaptic protein families to organize synapses: leucine-rich repeat transmembrane proteins (LRRTMs), calsyntenin 3, dystroglycan, latrophilin 1, cerebellins (reviewed in de Wit and Ghosh, 2016), and recently, C1q-like proteins (Matsuda et al., 2016). Molecular interactions are controlled by NRX promoter usage and splicing. For example, introduction of the 30-residue SS4 into β-NRX1 substantially weakens the NL-NRX1 interaction (Koehnke et al., 2010), abolishes the LRRTM1-2-NRX1 interaction (Siddiqui et al., 2010), and directs β-NRX1 into the cerebellin pathway (Elegheert et al., 2016, Uemura et al., 2010). Likewise, alternative binding partners for NL have been recognized. Thrombospondin 1 (TSP1) (Xu et al., 2010) and the NMDA receptor (NMDAR) (Budreck et al., 2013) both bind NL1, and the astrocyte-secreted protein hevin bridges NL1 and α-NRX (Singh et al., 2016) to promote glutamatergic synaptogenesis. In contrast to all these positive effectors and modulators, the discovery of the Ig superfamily (IgSF) MDGA (meprin, A-5 protein, and receptor protein-tyrosine phosphatase mu [MAM] domain-containing glycosylphosphatidylinositol anchor) proteins as negative modulators of NL is remarkable. MDGA1 was found to block the interaction of NL2 with NRX and suppress inhibitory synapse development in cultured neurons (Pettem et al., 2013), while MDGA2 blocks the interaction of NL1 and NL2 with NRX and can suppress excitatory and inhibitory synapse development (Connor et al., 2016). MDGA proteins are attached to the postsynaptic membrane via a C-terminal GPI anchor, and their large (∼900 amino acids) extracellular domain consists of six immunoglobulin-like domains (Ig1-6), a fibronectin type III-like (FnIII7) domain, and a memprin, A5, mu (MAM8) domain. Aberrant signaling in the NL-NRX pathway is strongly linked to autism spectrum disorders (ASDs) and schizophrenia (Südhof, 2008). Similarly, intronic SNPs in MDGA1 are linked to schizophrenia (Kähler et al., 2008, Li et al., 2011), and MDGA2 loss-of-function truncations were found in unrelated cases of ASD (Bucan et al., 2009). Single-allele knockout of the Mdga2 gene in mice elevated both excitatory neurotransmission and functional connectivity and produced behavioral phenotypes related to ASD (Connor et al., 2016). Mdga2 haploinsufficiency phenotypes were associated with elevated levels of NL1 and DLG family proteins and proposed to be due to diminished block of NL1-NRX signaling (Connor et al., 2016). However, based on a novel synaptic cleft tagging strategy in cell culture, another recent study proposed a role for MDGA2 selectively at inhibitory synapses and MDGA1 at excitatory synapses (Loh et al., 2016), raising controversy about the precise functions of MDGAs and revealing a need for more in-depth comprehensive analyses. Despite the recent focus on mapping the complex molecular landscape of NL-NRX signaling modulators, a structural and mechanistic understanding of these processes is still lacking. In this study, we present the crystal structure of the near-complete MDGA1 extracellular domain and that of its prototypical complex with NL1, providing detailed insight into the structural basis of the modulation of NL-NRX signaling by MDGA proteins. We show that human MDGA1 and MDGA2 have the ability to interact with human NL1–5, thereby extending the previously proposed restricted, binary NL-MDGA interaction code (Connor et al., 2016, Lee et al., 2013, Pettem et al., 2013). Furthermore, we demonstrate that MDGA1 and MDGA2 are able to broadly block NL synaptogenic activity in a concentration- and splice insert-dependent fashion. Given the broad distribution of MDGA and NL-NRX complexes, our work provides a framework for understanding potential brain-wide modulation of NL-NRX signaling by MDGA proteins.

Results

Crystal and Solution Structure of MDGA1

As a first step toward solving the structure of an NL-MDGA complex, we targeted the full-length apo MDGA1 extracellular domain for crystallization. Following an extensive screen of constructs from various species, we obtained diffraction-quality crystals and solved the structure of the complete chicken MDGA1 extracellular region (cMDGA1ECTO; Ig1-Mam8; Gln19-Lys919; 79.5% sequence identity and 88.4% sequence similarity with human MDGA1ECTO; Figure S1) using selenomethionine single-wavelength anomalous diffraction (Se-SAD) at 3.20 Å (Figures 1A and 1B; Table S1). cMDGA1ECTO was treated with endoglycosidase F1 (Endo F1) prior to crystallization, leaving a single N-linked N-acetylglucosamine monosaccharide on glycosylated Asn residues after enzymatic cleavage. Seven domains (Ig1-6 to FnIII7) could be unequivocally resolved in the electron density maps; however, the C-terminal MAM8 domain was not visible and most likely highly mobile and accommodated in the solvent channels of the crystal. The cMDGA1ECTO Ig1-6-FnIII7 domains form a surprisingly compact, folded structure that is ∼120 Å wide, ∼110 Å high, and ∼50 Å deep, fitting comfortably within the typical height of the synaptic cleft (∼20–25 nm). Its approximately triangular shape, unique among the cell-surface receptors crystallized to date, is a consequence of sharp-angled Ig2-Ig3, Ig4-Ig5, and Ig6-FnIII7 inter-domain linkers that are stabilized by numerous inter-domain contacts.
Figure 1

Crystal Structure of MDGA1

(A) Schematic representation of the chicken MDGA1 (cMDGA1) domain structure. Gln19-Lys919, spanning Ig1-Mam8, was used for structure determination. Black diamonds indicate Asn residues with crystallographically confirmed N-linked glycosylation (nine positions). Open diamonds indicate Asn residues with predicted but crystallographically unconfirmed N-linked glycosylation (four positions). Orange lines connect cysteine residues engaged in disulfide bonds.

(B) Crystal structure of cMDGA1ECTO. Disulfide bridges are shown as yellow spheres. Glycan moieties visible in the electron density maps are shown in ball and stick representation. N and C termini, β strands, and selected Ig1-2 loop structures are annotated to the structure. The MAM8 domain was not visible in the electron density maps, probably due to a flexible FnIII7-MAM8 linker.

(C) Details of the cMDGA1ECTO Ig1-FnIII7, Ig2-Ig3, Ig4-Ig5, and Ig6-FnIII7 domain contacts. Putative hydrogen bonds and hydrophilic interactions are indicated with black dashed lines.

See also Figures S1 and S2.

Crystal Structure of MDGA1 (A) Schematic representation of the chicken MDGA1 (cMDGA1) domain structure. Gln19-Lys919, spanning Ig1-Mam8, was used for structure determination. Black diamonds indicate Asn residues with crystallographically confirmed N-linked glycosylation (nine positions). Open diamonds indicate Asn residues with predicted but crystallographically unconfirmed N-linked glycosylation (four positions). Orange lines connect cysteine residues engaged in disulfide bonds. (B) Crystal structure of cMDGA1ECTO. Disulfide bridges are shown as yellow spheres. Glycan moieties visible in the electron density maps are shown in ball and stick representation. N and C termini, β strands, and selected Ig1-2 loop structures are annotated to the structure. The MAM8 domain was not visible in the electron density maps, probably due to a flexible FnIII7-MAM8 linker. (C) Details of the cMDGA1ECTO Ig1-FnIII7, Ig2-Ig3, Ig4-Ig5, and Ig6-FnIII7 domain contacts. Putative hydrogen bonds and hydrophilic interactions are indicated with black dashed lines. See also Figures S1 and S2. The Ig2-Ig3 domain contacts (341 Å2 buried surface area [BSA]) are formed between (1) the Ig2 β strands βA and βG and (2) the loop structure connecting Ig2 and Ig3, and also Ig3 loops BC and FG. The Ig4-Ig5 domain contacts (598 Å2 BSA) are formed between (1) the Ig4 β strand βA and loop AB and (2) Ig5 loops BC and FG. The Ig6-FnIII7 domain contacts (396 Å2 BSA) are formed between (1) the Ig6 β strand βA′ and loops A′B and EF and (2) the loop connecting Ig6 and FnIII7 and FnIII7 loops BC and FG. Finally, the Ig1-FnIII7 domain contacts (395 Å2 BSA) close the cMDGA1ECTO triangle and are formed between (1) the Ig1 N-terminal stretch (Gln19-Tyr22) and loop BC and (2) FnIII7 loops AA′ and C′E, and β strands βA and βB (Figure 1C). The linear orientation of Ig1 and Ig2 is stabilized by a disulfide bond, distinct from the core Ig domain disulfide bonds, between Cys36 located on Ig1 loop AA′ and Cys222 located on Ig2 loop FG (Figures 1A and 1B). In the crystal, two MDGA molecules form an unexpected intertwined dimeric arrangement with individual C-terminal ends pointing in opposite directions (Figure S2A). Homophilic interfaces are formed between domain pairs Ig1-Ig5∗, Ig2-Ig2∗, and Ig6-FnIII7∗ (where ∗ denotes contributions from the second MDGA monomer); their combined BSA is 2,666 Å2, suggesting a stable association. Interestingly, this arrangement is compatible with both a potential cis- or trans-homophilic interaction and might indicate formation of an adhesive or self-inhibitory complex (Figure S2B). Recombinantly expressed MDGA1 targets to axons and dendrites and partially co-localizes with inhibitory and excitatory postsynaptic markers in cultured hippocampal rodent neurons (Loh et al., 2016, Pettem et al., 2013). Native MDGA1 and MDGA2 were observed in axon tracts in chicken (Fujimura et al., 2006) and zebrafish (Ingold et al., 2015), and a putative trans-homophilic interaction of MDGA2 was proposed to function in directed axonal growth (Joset et al., 2011). To investigate the dimerization potential of the MDGA1 extracellular region in solution, we pursued multiple experimental avenues. First, we determined the cMDGA1ECTO solution structure using small-angle X-ray scattering (SAXS) at a concentration of 30 μM. The scattering data were unambiguously incompatible with a dimeric MDGA1 molecule but were instead accurately (χ2 = 1.17) modeled as a limited ensemble of monomeric conformers with pronounced flexibility at the FnIII7-Mam8 domain linkage (Figure S2C). In accordance with our SAXS data, we determined using analytical ultracentrifugation (AUC) that human MDGA1ECTO is monomeric at a concentration of 60 μM (Figures S2D and S2E). Finally, to probe whether potential MDGA1 self-association might instead be transient, we performed surface plasmon resonance (SPR) experiments in which wild-type cMDGA1ECTO was compared with a negative control mutant that contained three N-linked glycans inserted at distinct homophilic interfaces (Arg156Asn in Ig2, Ser502Asn in Ig5, and Arg680Asn in FnIII7) for binding to wild-type cMDGA1ECTO. Both cMDGA1ECTO variants failed to interact with wild-type cMDGA1ECTO up to a concentration of 100 μM (Figure S2F), indicating that no homophilic cMDGA1ECTO interactions occurred. Together, our results provide no biochemical evidence for an MDGA1 cis- or trans-homophilic dimer, and we propose that opening of the triangular cMDGA1ECTO structure by transient disruption of the limited Ig1-FnIII7 interface allowed formation of the dimeric arrangement in the crystal lattice.

Crystal Structure of an NL-MDGA Complex

We performed an extensive crystallization screening of the NL-MDGA complexes formed between MDGA1-2ECTO and NL1-2ECTO constructs from various species, and succeeded in generating diffraction-quality crystals and determining the structure of the Endo F1-treated complex formed between cMDGA1ECTO and the human NL1 cholinesterase domain lacking splice inserts (hNL1ECTO; Gln46-Asp635; Figure S3) at 3.30 Å (Figures 2A and 2B; Table S1). The hNL1ECTO-cMDGA1ECTO complex has a 2:2 stoichiometry and overall dimensions of ∼180 Å wide, ∼110 Å high, and ∼120 Å deep. Two MDGA1 monomers flank the NL1 dimer to form a 2-fold symmetric complex. Remarkably, the overall root-mean-square deviation (RMSD) between apo and NL1-bound cMDGA1ECTO structures is only 1.5 Å over 647 Cα atoms, underlining the stability and importance of this unusual multi-domain architecture. The NL1 and MDGA1 C termini point in the same direction and thus confirm an interaction in cis, situated on the postsynaptic membrane (Figures 2B and 2C). Each MDGA1 molecule spans the NL1 dimer using two large, separate interaction sites located on both NL1 monomers (Sites I and II) (Figure 3A). The Ig1-3 domains mediate all MDGA1 contacts, consistent with previous domain-deletion experiments (Pettem et al., 2013). In contrast with the NL-NRX complex (Araç et al., 2007, Chen et al., 2008, Fabrichny et al., 2007), there was no evidence for the presence of coordinated calcium atoms at either Site I or II interfaces.
Figure 2

Crystal Structure of an NL-MDGA Complex

(A) Schematic representation of the constructs used for co-crystallization of the hNL1(–A–B)ECTO-cMDGA1ECTO complex. Orange lines connect cysteine residues engaged in disulfide bonds. SSA and SSB depict the position of spliced sequences A and B on NL1, respectively. The MDGA1 Mam8 domain was included in the crystallization construct but was not observed in the electron density, similar to the free cMDGA1ECTO structure.

(B) Front, 120° rotated side, and 90° rotated bottom views of the hNL1(–A–B)ECTO-cMDGA1ECTO complex, shown in surface (NL1) and cartoon (MDGA1) representation. Disulfide bridges are shown as yellow spheres. Glycan moieties visible in the electron density maps are shown in ball and stick representation. The C termini of MDGA1 and NL1 point in the same direction, suggesting a complex formed in cis, located on the postsynaptic membrane.

(C) Schematic representation of the postsynaptic NL1-MDGA1 cis complex.

See also Figure S3.

Figure 3

Details and Conservation of the NL-MDGA Site I and II Interfaces

(A) 180° rotated open book view of the NL1-MDGA1 Site I and Site II interaction interfaces. Site I (859 Å2 buried surface area [BSA]) and Site II (859 Å2 BSA) group interactions contributed by MDGA1 Ig1 and Ig2-Ig3, respectively.

(B) Overview of the NL1 secondary structure elements contacted by MDGAIg1 to form Site I, and MDGAIg2-3 to form Site II.

(C) View of the NL1 and MDGA1 interaction interfaces, color-coded by sequence conservation in vertebrate NL1, NL2, NL3, NL4, and NL5 (1,046 total sequences), and vertebrate MDGA1 and MDGA2 (420 total sequences).

(D) View of the MDGA1 interaction interface. Site I and Site II interfaces are outlined by yellow and green lines, respectively. Per residue position, equivalent residues in human MDGA1 and MDGA2 are annotated to highlight overall sequence conservation of the interaction interfaces. Star symbols (∗) indicate residues for which side chain electron density was not clearly discernable.

See also Figure S4.

Crystal Structure of an NL-MDGA Complex (A) Schematic representation of the constructs used for co-crystallization of the hNL1(–A–B)ECTO-cMDGA1ECTO complex. Orange lines connect cysteine residues engaged in disulfide bonds. SSA and SSB depict the position of spliced sequences A and B on NL1, respectively. The MDGA1 Mam8 domain was included in the crystallization construct but was not observed in the electron density, similar to the free cMDGA1ECTO structure. (B) Front, 120° rotated side, and 90° rotated bottom views of the hNL1(–A–B)ECTO-cMDGA1ECTO complex, shown in surface (NL1) and cartoon (MDGA1) representation. Disulfide bridges are shown as yellow spheres. Glycan moieties visible in the electron density maps are shown in ball and stick representation. The C termini of MDGA1 and NL1 point in the same direction, suggesting a complex formed in cis, located on the postsynaptic membrane. (C) Schematic representation of the postsynaptic NL1-MDGA1 cis complex. See also Figure S3. Details and Conservation of the NL-MDGA Site I and II Interfaces (A) 180° rotated open book view of the NL1-MDGA1 Site I and Site II interaction interfaces. Site I (859 Å2 buried surface area [BSA]) and Site II (859 Å2 BSA) group interactions contributed by MDGA1 Ig1 and Ig2-Ig3, respectively. (B) Overview of the NL1 secondary structure elements contacted by MDGAIg1 to form Site I, and MDGAIg2-3 to form Site II. (C) View of the NL1 and MDGA1 interaction interfaces, color-coded by sequence conservation in vertebrate NL1, NL2, NL3, NL4, and NL5 (1,046 total sequences), and vertebrate MDGA1 and MDGA2 (420 total sequences). (D) View of the MDGA1 interaction interface. Site I and Site II interfaces are outlined by yellow and green lines, respectively. Per residue position, equivalent residues in human MDGA1 and MDGA2 are annotated to highlight overall sequence conservation of the interaction interfaces. Star symbols (∗) indicate residues for which side chain electron density was not clearly discernable. See also Figure S4. The numbering scheme employed in all following structural analyses is based on UniProt: P58400 (human β-NRX1), Q0WYX8 (chicken MDGA1), and Q8N2Q7 (human NL1). Annotation of secondary structural elements follows the acetylcholinesterase (AChE) nomenclature (Fabrichny et al., 2007). The smaller Site I (859 Å2 BSA) is formed between residues from (1) MDGA1Ig1 β strands C, F, and G and loop CE and (2) NL1 loops Leu289-Gln307, Ile377-Asp385 (part of “loop L1”), Gln392-Tyr398, and Phe496-Pro499 and helices α2(4,5) and α4(6,7) (Figure 3B). HisNL1291, TyrNL1292, AspNL1384, and GluNL1394 are at the core of Site I. HisNL1291 and TyrNL1292 make Van der Waals (VdW) contacts and form putative hydrogen bonds with multiple MDGA1Ig1 residues. AspNL1384 and GluNL1394 form putative salt bridges with ArgMDGA1105 and ArgMDGA1123 (Figure S4A). The larger Site II (1,000 Å2 BSA) is formed between residues from (2) MDGA1Ig2 β strands A, B, D, and E and NL1 α helices α2(7,8) and α3(7,8); (2) MDGA1Ig2 loop AB and NL1 loops Ala110-Pro132 (“Cys loop”) and Asp361-Asp385 (“loop L1”); and (3) peripheral interactions contributed by MDGA1Ig3 to NL1 α helix α2(7,8) and loop Val417-Ser424 (Figure 3B). Notably, MDGA1 loops AB and DE form long protrusions that give Ig2 a concave shape to accommodate the NL1 α helix α2(7,8) (Figure 3B). The PheNL1430-PheMDGA1154 π-π sandwich stacking interaction is central to this interface and is lined by multiple hydrogen-bonding and charged interactions. The tip of MDGA1 loop AB extends into a pocket lined predominantly by hydrophobic NL1 residues. Part of loop AB (Ile140-Ser146 stretch) could not be resolved in the complex electron density map (Figure S4A). The NL1 “Cys loop” (part of loop Ala110-Pro132) and “loop L1” (part of loop Asp361-Asp385) occlude the “gorge” that, in AChE, leads to the enzyme active site. Interestingly, these loop structures form an integral part of the NL-MDGA interface. In this sense, MDGA resembles the snake toxin fasciculin (Fas) for binding to AChE (Bourne et al., 1995, Harel et al., 1995). There are, however, no indications that Fas might bind NL and interfere with MDGA binding. The function of the NL Leu449-Arg450-Glu451 (LRE) adhesion motif, conserved in all NLs and located in the α3(7,8) helix (Figures 7B and S3C), is not clear. The LRE motif was first identified in the extracellular matrix protein laminin β2, where it is involved in binding the CaV2.2 voltage-gated calcium channel. Furthermore, the LRE motif is present in the majority of mammalian AChEs, and besides in NL, it is also observed in the cholinesterase-like adhesion molecules neurotactin and glutactin (Johnson and Moore, 2013). Both Arg450 and Glu451 form an integral part of the NL-MDGA interface and interact with Tyr187 and Leu190, respectively, on MDGA1 loop DE (Figures 7A and S4A), offering a first functional role for this LRE-tripeptide in NLs.
Figure 7

The ASD-Linked NL3 Mutation Arg451Cys Prevents Suppression of Synapse Formation by MDGA1

(A) NL1 Arg450, equivalent to NL3 Arg451, is engaged in π-stacking interactions with TyrMDGA1187 and its side chain is oriented by charged interactions with AspNL1447 and GluNL1451.

(B) Sequence alignment of human, mouse, and rat NL1–5. Helices α2(7,8) and α3(7,8) of Hs_NL1 are annotated above the alignment. NL residues unique to the “core” and “rim” of the NL-MDGA interface are highlighted in black and gray, respectively. The Leu-Arg-Glu (LRE) motif, conserved in all NLs and located in the α3(7,8) helix, is boxed in yellow. The equivalent NL1 Arg450 and NL3 Arg451 residues are part of the Site II interface and central to the LRE motif. Hs; Homo sapiens, Mm; Mus musculus, Rn; Rattus norvegicus.

(C) Schematic representation of the SPR setup, summary of KD values, and binding isotherms for the interaction of NL1, NL1 Arg450Cys, NL3, and NL3 Arg451Cys with MDGA1-2ECTO and β-NRX1LNS6(±4).

(D) COS-7 cells expressing myc-NL3 wild-type or myc-NL3 Arg451Cys were co-transfected with HA-CD4 control, HA-MDGA1, or HA-MDGA2 and co-cultured with hippocampal neurons. The ability of the co-transfected cells to induce synapsin clustering was measured and normalized to the area of tau-positive axon contact. The bar graphs represent the mean of three independent experiments for the low plasmid ratio (Figure S6A) of human HA-MDGA1-2:myc-NL3 (n > 21 total cells for each condition). Significance is shown for CD4 control versus MDGAs (one-way ANOVA with Bonferroni post hoc comparison). Error bars represent the SEM. ∗∗∗p < 0.001; n.s., not significant. A detailed statistical quantification can be found in Table S5.

(E) Representative images of co-cultures immunostained for surface myc-NL3 (blue), surface HA-MDGA or CD4 control (data not shown), synapsin (red), and tau axonal marker (green). The isolated synapsin signal (white) is shown next to each color image. Scale bar, 30 μm.

See also Figure S8.

Sequence conservation analysis indicated that both Site I and Site II interfaces are highly conserved in vertebrate MDGAs and NLs (Figures 3C, 3D, and S4B); this observation strongly points toward a common binding mode between all MDGA and NL family members. We mapped all predicted N-glycosylation sites for human MDGA1-2 and NL1-5 (NLs lacking splice inserts) on the cMDGA1ECTO and hNL1ECTO structures (Figures S4C and S4D). The MDGA1-specific N-glycan at Asn307, experimentally confirmed by identifying the corresponding N-acetylglucosamine monosaccharide in the hNL1ECTO-cMDGA1ECTO electron density map, is the only glycan that is proximal to the binding interface and is situated in Ig3 at the edge of Site II. Analysis of the complex structure, however, indicated that all putative N-linked glycans can project into the solvent, thereby avoiding interference with complex formation. Proteins for subsequent biophysical and cellular experiments were expressed in HEK293T and COS-7 cells, respectively, and were not deglycosylated.

MDGA and NRX Share Binding Interfaces on NL

We compared our NL1-MDGA1 structure with previously reported NL1-β-NRX1 complexes (Araç et al., 2007, Chen et al., 2008, Fabrichny et al., 2007). Using the highest resolution NL1-β-NRX1 structure available (PDB: 3B3Q; 2.4 Å; Chen et al., 2008), both complexes align with an RMSD of 0.292 Å over 453 NL1 Cα positions. Strikingly, Site I overlaps nearly completely with the NL1-β-NRX1 interface, suggesting that MDGA prevents the NL-NRX interaction via steric hindrance (Figure 4A). Core NL1 residues shared between NL1-MDGA1 and NL1-β-NRX1 interfaces are His291, Asp294, Asp384, Gly393-Asn397, Phe496, and Gly497. ArgMDGA1123 mimics Argβ-NRX1232 for binding to AspNL1384. ArgMDGA1123 and ArgMDGA1105 engage GluNL1394 in ionic interactions, whereas in NL1-β-NRX1, the latter residue contacts Thrβ-NRX1235 and is part of the hexadentate coordination shell of the obligate interface calcium atom. AspNL1294 forms a hydrogen bond with TyrMDGA1107, whereas it forms a bifurcated ionic interaction with Argβ-NRX1109 in NL1-β-NRX1. Finally, NL1 residues Gly393, Phe395, Phe496, and Asn397 are contacted by MDGA1Ig1 loop CE, preventing their network of hydrogen-bonded interactions with β-NRX1 residues (Figure 4B).
Figure 4

MDGA and NRX Compete for Binding to the NL Site I Interface

(A) Comparison of the NL1-MDGA1 and NL1-β-NRX1 complex binding modes. The NL1-MDGA1 and NL1-β-NRX1 (based on PDB: 3B3Q; Chen et al., 2008) interfaces are oriented similarly, based on structural alignment of one NL1 monomer (0.292 Å RMSD over 453 NL1 Cα positions). The respective molecular footprints of MDGA1 and β-NRX1 are outlined with a red stroke. The NL1-MDGA1 Site I and Site II interfaces, and the NL1-β-NRX1 Site I interface, are shown in surface representation.

(B) Detailed comparison of the core NL1 residues shared between NL1-MDGA1 and NL1-β-NRX1 Site I interfaces. Putative hydrogen bonds and hydrophilic interactions are indicated with black dashed lines. The hexadentate coordination shell of the NL1-β-NRX1 interface calcium (Ca) atom is indicated with solid orange lines.

(C) Summary of the calorimetric competition assay binding isotherms, indicating that MDGA1ECTO can compete with β-NRX1LNS6(–4) for binding to NL1ECTO in a concentration-dependent fashion. In each case, the experimental geometry is “[cell contents] + syringe contents.” For calculation of the stoichiometry, NL1, MDGA1, and β-NRX1(–4) were considered in their monomeric state. Thermodynamic binding parameters are annotated. ND, not determined. An ∼2.5-fold molar excess of MDGA1 was required to fully block binding of β-NRX1LNS6(–4) to NL1ECTO.

MDGA and NRX Compete for Binding to the NL Site I Interface (A) Comparison of the NL1-MDGA1 and NL1-β-NRX1 complex binding modes. The NL1-MDGA1 and NL1-β-NRX1 (based on PDB: 3B3Q; Chen et al., 2008) interfaces are oriented similarly, based on structural alignment of one NL1 monomer (0.292 Å RMSD over 453 NL1 Cα positions). The respective molecular footprints of MDGA1 and β-NRX1 are outlined with a red stroke. The NL1-MDGA1 Site I and Site II interfaces, and the NL1-β-NRX1 Site I interface, are shown in surface representation. (B) Detailed comparison of the core NL1 residues shared between NL1-MDGA1 and NL1-β-NRX1 Site I interfaces. Putative hydrogen bonds and hydrophilic interactions are indicated with black dashed lines. The hexadentate coordination shell of the NL1-β-NRX1 interface calcium (Ca) atom is indicated with solid orange lines. (C) Summary of the calorimetric competition assay binding isotherms, indicating that MDGA1ECTO can compete with β-NRX1LNS6(–4) for binding to NL1ECTO in a concentration-dependent fashion. In each case, the experimental geometry is “[cell contents] + syringe contents.” For calculation of the stoichiometry, NL1, MDGA1, and β-NRX1(–4) were considered in their monomeric state. Thermodynamic binding parameters are annotated. ND, not determined. An ∼2.5-fold molar excess of MDGA1 was required to fully block binding of β-NRX1LNS6(–4) to NL1ECTO. We set up an isothermal titration calorimetry (ITC) assay to investigate whether MDGA1ECTO competes with β-NRX1LNS6 lacking SS4 (β-NRX1LNS6(–4)) for binding to NL1ECTO. Titration of β-NRX1LNS6(–4) into NL1ECTO alone revealed a strong exothermic interaction and a KD of ∼390 nM. Application of an equimolar amount of MDGA1ECTO to NL1ECTO in the titration cell did not fully block the NL1ECTO-β-NRX1LNS6(–4) interaction, but decreased its apparent KD (KD,app) ∼12-fold to 4.76 μM. Application of a 2.5-fold molar excess of MDGA1ECTO over NL1ECTO was required to fully block binding of β-NRX1LNS6(–4) to NL1ECTO (Figure 4C). These results are consistent with the notion that MDGA is not an ultra-high-affinity decoy receptor, and that by varying the levels of MDGA, the level of NL-NRX complex formation can be tuned.

MDGA1 and MDGA2 Bind All NL Isoforms

We hypothesized that the interactions between human NLs and MDGAs are not limited to certain pairs of isoforms, given the high level of conservation of the Site I and Site II interface residues among human NL1–5 and MDGA1-2 (Figures 3C and S4B). To test this, we determined the binding strengths of all pairwise NL-MDGA ectodomain interactions using SPR. We initially focused on the unspliced NL variants for these interaction studies. As a control, we measured the pairwise interactions between NL1–5ECTO and β-NRX1LNS6 with and without SS4 (β-NRX1LNS6(±4)). The reference interaction of NL1ECTO with β-NRX1LNS6(–4) showed an approximately 2-fold higher equilibrium dissociation constant (KD) than the one derived from ITC (KD of 718 ± 14 nM versus 388 ± 23 nM, respectively; Figures 4C and 5A).
Figure 5

MDGA1 and MDGA2 Bind All NL Isoforms and Suppress NL-Induced Recruitment of Synaptic Terminals in Co-culture

(A) Schematic representation of the SPR setup, summary of KD values, and binding isotherms for the interaction of NL1–5ECTO with MDGA1-2ECTO and β-NRX1LNS6(±4).

(B) COS-7 cells expressing myc-NL1–4 were co-transfected with HA-CD4 control, HA-MDGA1, or HA-MDGA2 and co-cultured with hippocampal neurons. The ability of the co-transfected cells to induce synapsin clustering was measured and normalized to the area of tau-positive axon contact. The bar graphs represent the mean of three independent experiments for low, medium, and high plasmid ratios (Figure S6A) of human HA-MDGA1-2:myc-NL1–4 (n > 24 total cells for each condition) with the CD4:myc-NL1–4 co-transfected controls normalized to 100% to show the relative change of synapsin integrated intensity at each ratio. Significance is shown for CD4 control versus MDGAs for each NL (one-way ANOVA with Bonferroni post hoc comparison). Error bars represent the SEM. ∗p < 0.05, ∗∗p < 0.01, ∗∗∗p < 0.001; n.s., not significant. A detailed statistical quantification can be found in Table S3.

(C) Representative images of co-cultures immunostained for surface myc-NL (blue), surface HA-MDGA or CD4 control (data not shown), synapsin (red), and tau axonal marker (green). The isolated synapsin signal (white) is shown next to each color image. Scale bar, 30 μm.

See also Figures S5 and S6.

MDGA1 and MDGA2 Bind All NL Isoforms and Suppress NL-Induced Recruitment of Synaptic Terminals in Co-culture (A) Schematic representation of the SPR setup, summary of KD values, and binding isotherms for the interaction of NL1–5ECTO with MDGA1-2ECTO and β-NRX1LNS6(±4). (B) COS-7 cells expressing myc-NL1–4 were co-transfected with HA-CD4 control, HA-MDGA1, or HA-MDGA2 and co-cultured with hippocampal neurons. The ability of the co-transfected cells to induce synapsin clustering was measured and normalized to the area of tau-positive axon contact. The bar graphs represent the mean of three independent experiments for low, medium, and high plasmid ratios (Figure S6A) of human HA-MDGA1-2:myc-NL1–4 (n > 24 total cells for each condition) with the CD4:myc-NL1–4 co-transfected controls normalized to 100% to show the relative change of synapsin integrated intensity at each ratio. Significance is shown for CD4 control versus MDGAs for each NL (one-way ANOVA with Bonferroni post hoc comparison). Error bars represent the SEM. ∗p < 0.05, ∗∗p < 0.01, ∗∗∗p < 0.001; n.s., not significant. A detailed statistical quantification can be found in Table S3. (C) Representative images of co-cultures immunostained for surface myc-NL (blue), surface HA-MDGA or CD4 control (data not shown), synapsin (red), and tau axonal marker (green). The isolated synapsin signal (white) is shown next to each color image. Scale bar, 30 μm. See also Figures S5 and S6. Overall, our measurements revealed KDs for NL-MDGA in the high nanomolar (nM) to low micromolar (μM) range, similar to NL-β-NRX1(±4) (Figure 5A). Accordingly, MDGA does not appear to be an ultra-high-affinity decoy receptor for NL. MDGA1 and MDGA2 interacted most strongly with NL1 and NL2, and MDGA2 binds NL1 and NL2 2-fold stronger than MDGA1 (KD of ∼1 and ∼2 μM, respectively). Interaction affinities of MDGA2ECTO and β-NRX1LNS6(–4) for NL1–2ECTO are nearly identical. Interestingly, both MDGA1 and MDGA2 interacted ∼10- to ∼20-fold weaker with NL3, NL4, and NL5 (KD of ∼15–25 μM). Whereas NL3ECTO also binds β-NRX1LNS6(–4) with low affinity (KD of ∼8.5 μM), NL4ECTO and NL5ECTO still bind β-NRX1LNS6(–4) relatively strongly (KD of ∼2.5–3 μM), meaning that for NL4 and NL5, a larger discrepancy between binding strengths of β-NRX1(–4) and MDGA1-2 exists (Figure 5A). Taken together, these experiments show (1) that MDGA1 and MDGA2 have the ability to interact with NLs that localize to excitatory glutamatergic (NL1 and NL3) (Budreck and Scheiffele, 2007, Song et al., 1999), inhibitory GABAergic (NL2 and NL3) (Budreck and Scheiffele, 2007, Graf et al., 2004, Varoqueaux et al., 2004), and inhibitory glycinergic (NL2 and NL4) (Hoon et al., 2011, Varoqueaux et al., 2004) synapses, and (2) that the subtle divergences in NL and MDGA amino acid composition (Figures 3D and S4B) may contribute to subtype preferences. Thus, our results extend the restricted, binary NL-MDGA code that was previously proposed (Connor et al., 2016, Lee et al., 2013, Pettem et al., 2013). We sought to validate the interaction of MDGA1 and MDGA2 with multiple NLs. To this end, we fused the rat MDGA1 and MDGA2 ectodomains to the Fc region of human IgG. MDGA1- and MDGA2-Fc proteins were then used as bait to identify NLs in postnatal day 21 (P21) rat brain synaptosome extracts, using affinity chromatography coupled with mass spectrometry and bioinformatics analysis (Savas et al., 2014). For extraction, we used the detergent Triton X-100 at 1% w/v concentration. In two independent MDGA1-Fc pull-down experiments, we identified NL3, NL2, and NL1, ranked by spectral count (Figure S5B; Table S2). No peptides for NLs were detected in control experiments using Fc alone or using MDGA lacking Ig1-3 (MDGA1ΔIg1–3) (Table S2), demonstrating specificity in the assay. In two independent MDGA2-Fc pull-down experiments, we identified NL2 and, to a lesser extent, NL3 (Figure S5B). In the pull-downs, no NL4 or NL5 was detected; NL4 is of very low abundance (e.g., only ∼3% of the total NL in mouse brain; Varoqueaux et al., 2006) and NL5 is restricted to humans. The pull-down results are consistent with our SPR data that indicated a stronger binding of NL3 to MDGA1 than to MDGA2 (Figure 5A).

MDGA1 and MDGA2 Modulate NL-Induced Recruitment of Hippocampal Synaptic Terminals

To assess whether MDGA1 and MDGA2 are able to broadly modulate NL-NRX-induced synapse formation, we set up a cellular hemi-synapse formation assay in which COS-7 cells co-expressing full-length (FL) N-terminally myc-tagged NL1–4 (myc-NL1–4FL) and full-length N-terminally HA-tagged MDGA1-2 (HA-MDGA1-2FL) variants were co-cultured with rat hippocampal neurons (Figures 5B, 5C, S6C, and S6D). These neurons express the –SS4 and +SS4 forms of all three α- and β-NRXs (α/β-NRX1-2-3) (Aoto et al., 2013). Accordingly, this assay integrates signals from multiple NRX isoforms, in contrast with our SPR or ITC assays, which only used β-NRX1(±4) as reference interactions (Figures 4C and 5A). To test our hypothesis that by varying the expression levels of MDGA1-2, the extent of NL-NRX complex formation and hence recruitment of synaptic terminals can be influenced, we tested three different plasmid ratios of MDGA1 and MDGA2. For MDGA1, low, medium, and high plasmid ratios designate a 2.2-, 3.5-, and 5.0-fold excess of plasmid DNA over NL, respectively. For MDGA2, these ratios were chosen to be 1.5-fold higher to achieve similar surface protein levels as MDGA1 (Figure S6A). The low ratios used here were similar to the ratios used in our previous co-culture assays of rodent MDGA1-2 with NL1 and NL2 (Connor et al., 2016, Pettem et al., 2013). Similar results were found here for human MDGA1-2 with NL1-2 (see Figures 5B and 8D, low ratio results). However, these earlier studies did not assess the effects of NL alternative splicing, varying ratios of MDGA to NL, or MDGA on NL3-4.
Figure 8

NL1 SSB Differentially Modulates NL1-NRX and NL1-MDGA Complex Formation

(A) Crystal structure of human NL1(+B). The inset shows 2mFo-DFc electron density contoured at 1.0σ (cyan mesh) for spliced sequence B (SSB). The star symbol indicates the position of the N-linked glycan at Asn300. The glycan tree itself was not visible in the electron density due to structural flexibility.

(B) Structural mapping of spliced sequences A (SSA) and B (SSB) onto NL1. The NL1-MDGA1 and NL1-β-NRX1 interfaces are oriented similarly, based on structural alignment of one NL1 monomer (0.292 Å RMSD over 453 NL1 Cα positions). The position of SSB is derived from the crystal structure of NL1(+B), and the position of SSA is derived from a published crystal structure of rat NL1(+A1) (PDB: 3VKF; Tanaka et al., 2012).

(C) Schematic representation of the SPR setup, summary of KD values, and binding isotherms for the interaction of human NL1(–A–B)ECTO, NL1(–A+B)ECTO, and NL1(–A+B_N300Q)ECTO with MDGA1-2ECTO and β-NRX1LNS6(±4).

(D) COS-7 cells expressing myc-NLs were co-transfected with HA-CD4 control, HA-MDGA1, or HA-MDGA2 and co-cultured with hippocampal neurons. The ability of the co-transfected cells to induce synapsin clustering was measured and normalized to the area of tau-positive axon contact. The bar graphs represent the mean of three independent experiments for low, medium, and high plasmid ratios (Figure S6A) of human HA-MDGA1-2:myc-NL1(–A ± B) (n > 24 total cells for each ratio) with the CD4:myc-NL1(–A ± B) co-transfected controls normalized to 100% to show the relative change of synapsin integrated intensity at each ratio. Significance is shown for CD4 control versus MDGAs for each NL1 (one-way ANOVA with Bonferroni post hoc comparison). Error bars represent the SEM. ∗p < 0.05, ∗∗p < 0.01, ∗∗∗p < 0.001; n.s., not significant. A detailed statistical quantification can be found in Table S3.

(E) Representative images of co-cultures immunostained for surface myc-NL (blue), surface HA-MDGA or CD4 control (data not shown), synapsin (red), and tau axonal marker (green). The isolated synapsin signal (white) is shown next to each color image. Scale bar, 30 μm.

See also Figures S9–S11.

We observed here that MDGA1 and MDGA2 appeared to reduce the ability of all NLs to recruit presynaptic terminals, but with different potency. MDGA1 and MDGA2 both blocked NL1-induced recruitment of synaptic terminals, although a higher ratio was needed to obtain this effect for MDGA1 than for MDGA2 (Figure 5B; Table S3). Both MDGA1 and MDGA2 potently blocked NL2-induced recruitment of synaptic terminals. Thus, there was a weaker effect of MDGA1 on NL1 relative to NL2 activity in this neuron culture-based assay in comparison with similar binding seen with purified proteins in our equilibrium SPR experiments (Figure 5A). Differential effects in the co-culture were not due to any differences in surface levels of MDGAs or NLs (Figure S6B). We observed a stronger differential effect when evaluating NL3-induced synapse formation. Whereas MDGA1 was able to block recruitment of synaptic terminals at all ratios, MDGA2 was not. This is consistent with our SPR analysis, which derived lower responses and corresponding lower interaction affinities for the NL3-MDGA2 interaction (Figures 5A and S5A). Finally, both MDGA1 and MDGA2 were unable to significantly block NL4-induced synapse formation, although there was a trend toward suppression; this agrees with our SPR analysis that indicated that β-NRX1(–4) binds NL4 ∼6-fold stronger than MDGA1-2. We suggest that even higher MDGA:NL plasmid ratios would be needed to fully block NRX binding. However, these conditions were not experimentally accessible in the assay format used, which imposed limits on the total amount of plasmid DNA that can be reliably transfected. Overall, our results confirm that MDGA1 and MDGA2 can interfere with a broad range of NL-NRX interactions to modulate presynaptic differentiation. The functional outcome will ultimately be influenced by the relative abundances of all molecular players.

Assessment of Binding of NL1 with Hevin, Thrombospondin-1, and the NMDAR

Given that the interactions of thrombospondin 1 (TSP1) (Xu et al., 2010), hevin (Singh et al., 2016), and the NMDAR (Budreck et al., 2013) with NL1 are all dependent on the coupling of their respective extracellular domains, we hypothesized that MDGA might have the potential to also block binding of these proteins to NL, thereby assigning a more general inhibitory function to MDGA. To test this, we first set out to reproduce the interactions of NL1 with recombinant hevin, TSP1, and NMDAR using SPR. In our setup, secreted human hevin and TSP1 and detergent-solubilized rat NMDAR (GluN1a-GluN2B heterotetramer) (Karakas and Furukawa, 2014) were immobilized on the chip surface (Figure S7A). We found that, in contrast to the reference interaction of NL1(–A–B)ECTO with mouse α-NRX1ECTO(–4), all three proteins failed to interact with NL1(–A–B)ECTO up to a concentration of 25 μM (Figures S7B and S7C).

Uncoupling of MDGA and NRX Binding to NL

Given that the NL-MDGA crystal structure revealed a composite Site I-II interface, whereas NL-NRX uses only Site I (Figure 4A), we hypothesized that NRX and MDGA binding can be uncoupled, i.e., NL can be rendered insensitive for modulation by MDGA by mutating the Site II interface. We introduced four core interface mutations into the NL1 Site I interface (NL1ΔSite I: His291Ala, Tyr292Ala, Asp384Ala, and Glu394Ala) and five into the Site II interface (NL1ΔSite II: Asp429Ala, Phe430Ala, Ser433Ala, Asn434Ala, and Arg450Ala) (Figure 6A). We opted to combine multiple mutations of key interface residues instead of using single-position alanine mutants to maximize our chances of obtaining a clear binding differential and cellular phenotype.
Figure 6

Uncoupling of MDGA and NRX Binding to NL

(A) Annotation of the NL1 Site I (ΔSite I: H291A, Y292A, D384A, and E394A) and Site II (ΔSite II: D429A, F430A, S433A, N434A, and R450A) mutations.

(B) Schematic representation of the SPR setup, summary of KD values, and binding isotherms for the interaction of wild-type and mutant human NL1(–A–B)ECTO with MDGA1-2ECTO and β-NRX1LNS6(±4).

(C) COS-7 cells expressing myc-NLs were co-transfected with HA-CD4 control, HA-MDGA1, or HA-MDGA2 and co-cultured with hippocampal neurons. The ability of the co-transfected cells to induce synapsin clustering was measured and normalized to the area of tau-positive axon contact. The bar graphs represent the mean of three independent experiments for high plasmid ratios (Figure S6A) of human HA-MDGA1-2:myc-NL1 (n > 22 total cells for each ratio). Significance is shown for CD4 control versus MDGA1-2 for each NL1 variant (one-way ANOVA with Bonferroni post hoc comparison). Error bars represent the SEM. ∗∗∗p < 0.001; n.s., not significant. Mutation of Site II renders NL1(–A–B) insensitive to suppression of synapse formation by MDGA1 and MDGA2. A detailed statistical quantification can be found in Table S4.

(D) Representative images of co-cultures immunostained for surface myc-NL (blue), surface HA-MDGA or CD4 control (data not shown), synapsin (red), and tau axonal marker (green). The isolated synapsin signal (white) is shown next to each color image. Scale bar, 30 μm.

See also Figure S8.

Uncoupling of MDGA and NRX Binding to NL (A) Annotation of the NL1 Site I (ΔSite I: H291A, Y292A, D384A, and E394A) and Site II (ΔSite II: D429A, F430A, S433A, N434A, and R450A) mutations. (B) Schematic representation of the SPR setup, summary of KD values, and binding isotherms for the interaction of wild-type and mutant human NL1(–A–B)ECTO with MDGA1-2ECTO and β-NRX1LNS6(±4). (C) COS-7 cells expressing myc-NLs were co-transfected with HA-CD4 control, HA-MDGA1, or HA-MDGA2 and co-cultured with hippocampal neurons. The ability of the co-transfected cells to induce synapsin clustering was measured and normalized to the area of tau-positive axon contact. The bar graphs represent the mean of three independent experiments for high plasmid ratios (Figure S6A) of human HA-MDGA1-2:myc-NL1 (n > 22 total cells for each ratio). Significance is shown for CD4 control versus MDGA1-2 for each NL1 variant (one-way ANOVA with Bonferroni post hoc comparison). Error bars represent the SEM. ∗∗∗p < 0.001; n.s., not significant. Mutation of Site II renders NL1(–A–B) insensitive to suppression of synapse formation by MDGA1 and MDGA2. A detailed statistical quantification can be found in Table S4. (D) Representative images of co-cultures immunostained for surface myc-NL (blue), surface HA-MDGA or CD4 control (data not shown), synapsin (red), and tau axonal marker (green). The isolated synapsin signal (white) is shown next to each color image. Scale bar, 30 μm. See also Figure S8. Consistent with both NL-MDGA and NL-β-NRX1 complex structures, we found using SPR that the ΔSite II mutant blocked MDGA1 binding but maintained binding of β-NRX1, whereas the ΔSite I and combined ΔSite I+II mutants fully abolished both β-NRX1 and MDGA1 interactions (Figures 6B and S8A). Using the co-culture assay, we tested the impact of the ΔSite I and ΔSite II mutations on the recruitment of synaptic terminals by full-length NL1. Consistent with our SPR analysis, introduction of the NL1ΔSite I and NL1ΔSite I+II mutations, but not the NL1ΔSite II mutations, prevented NL-NRX-induced synapse formation (Figures 6C and 6D; Table S4). Simultaneously, co-expression at high plasmid ratio of MDGA1 or MDGA2 with NL1 carrying the ΔSite II mutations did not lead to diminished recruitment of synaptic terminals (Figures 6C and 6D; Table S4). We concluded that the NL ΔSite II mutant selectively uncoupled NL-NRX binding and recruitment of synaptic terminals from inhibition by MDGA.

The ASD-Linked NL3 Mutation Arg451Cys Prevents Suppression of Synapse Formation by MDGA1

The well-characterized NL3 mutation Arg451Cys (R451C) leads to a number of ASD-linked phenotypes in mice (Tabuchi et al., 2007). In this knockin mouse model, R451C acts as a gain-of-function mutation by actually increasing inhibitory synaptic transmission, a result that is seemingly at odds with the severe reduction of NL3 in these mutant mice (Tabuchi et al., 2007). Indeed, complete knockout of NL3 has no such effect (Tabuchi et al., 2007). Our hNL1ECTO-cMDGA1ECTO complex crystal structure shows that NL1 Arg450, which is equivalent to NL3 Arg451 and part of the NL1 Leu449-Arg450-Glu451 (LRE) motif (Figures 7B and S3C), is an integral part of the Site II interface (Figure 7A). We introduced the Arg450Cys (R450C) and Arg451Cys (R451C) mutations into NL1(–A–B)ECTO and NL3(–A)ECTO, respectively. We observed diminished secretion for the mutants as compared to wild-type proteins (Figure S8B), consistent with reported trafficking defects and protein destabilization (Chih et al., 2004, Comoletti et al., 2004, Tabuchi et al., 2007). Using SPR, we then measured the interaction of β-NRX1(±4) and MDGA1-2 with these mutant proteins and compared them to the wild-type interactions. Our measurements revealed that for both NL1 and NL3, introduction of the R450/451C mutation nearly completely abolished binding of both MDGA1 and MDGA2, while leaving the binding of β-NRX1(±4) unaffected (Figures 7C and S8B). This is consistent with the fact that the R450/451C mutation is situated in the MDGA-specific Site II interface. In this sense, the mutation thus phenocopies our NL1 ΔSite II mutant (Figure 6B). The ASD-Linked NL3 Mutation Arg451Cys Prevents Suppression of Synapse Formation by MDGA1 (A) NL1 Arg450, equivalent to NL3 Arg451, is engaged in π-stacking interactions with TyrMDGA1187 and its side chain is oriented by charged interactions with AspNL1447 and GluNL1451. (B) Sequence alignment of human, mouse, and rat NL1–5. Helices α2(7,8) and α3(7,8) of Hs_NL1 are annotated above the alignment. NL residues unique to the “core” and “rim” of the NL-MDGA interface are highlighted in black and gray, respectively. The Leu-Arg-Glu (LRE) motif, conserved in all NLs and located in the α3(7,8) helix, is boxed in yellow. The equivalent NL1 Arg450 and NL3 Arg451 residues are part of the Site II interface and central to the LRE motif. Hs; Homo sapiens, Mm; Mus musculus, Rn; Rattus norvegicus. (C) Schematic representation of the SPR setup, summary of KD values, and binding isotherms for the interaction of NL1, NL1 Arg450Cys, NL3, and NL3 Arg451Cys with MDGA1-2ECTO and β-NRX1LNS6(±4). (D) COS-7 cells expressing myc-NL3 wild-type or myc-NL3 Arg451Cys were co-transfected with HA-CD4 control, HA-MDGA1, or HA-MDGA2 and co-cultured with hippocampal neurons. The ability of the co-transfected cells to induce synapsin clustering was measured and normalized to the area of tau-positive axon contact. The bar graphs represent the mean of three independent experiments for the low plasmid ratio (Figure S6A) of human HA-MDGA1-2:myc-NL3 (n > 21 total cells for each condition). Significance is shown for CD4 control versus MDGAs (one-way ANOVA with Bonferroni post hoc comparison). Error bars represent the SEM. ∗∗∗p < 0.001; n.s., not significant. A detailed statistical quantification can be found in Table S5. (E) Representative images of co-cultures immunostained for surface myc-NL3 (blue), surface HA-MDGA or CD4 control (data not shown), synapsin (red), and tau axonal marker (green). The isolated synapsin signal (white) is shown next to each color image. Scale bar, 30 μm. See also Figure S8. Using the co-culture assay, we tested the impact of the R451C mutation on the recruitment of synaptic terminals by full-length NL3. Importantly, although impaired relative to wild-type NL3, the R451C mutant can traffic to the surface of transfected COS-7 cells (Figure S8C) and rat hippocampal neurons (Figure S8D; consistent with Chih et al., 2004). Thus, for the co-culture analysis, we again selected COS-7 cells that displayed equal amounts of surface NL to ensure meaningful readout of synapse formation (Figure S8C). Consistent with our SPR analysis, introduction of the R451C mutation had no impact on NL-NRX-induced synapse formation when compared to wild-type NL3 (Figure 7D). Then, co-expression at low plasmid ratio of MDGA1, but not MDGA2, with NL3 wild-type led to diminished recruitment of synaptic terminals. This result closely reproduces our earlier observation (Figure 5B). Introduction of R451C, however, prevented the diminished recruitment of synaptic terminals mediated by MDGA1 (Figures 7D and 7E; Table S5). We concluded that R451C selectively uncoupled NL3-NRX binding and recruitment of synaptic terminals from inhibition by MDGA1.

Tuning of the NL-MDGA Interaction by NL SSA and SSB

Alternative splicing leads to insertion of SSA and SSB onto the NL cholinesterase scaffold. SSB is restricted to NL1, whereas distinct SSA sequences are present in NL1, NL2, and NL3. In NL1 and NL3, the two possible SSA sequences (A1 and A2) can also occur in tandem (denoted as A1A2) (Figure S3B). Whereas NL1 mRNAs containing and lacking splice insert A are detected at similar levels at hippocampal, cortical, and cerebellar excitatory synapses, mRNA coding for NL1(+B) is more abundant than for NL1(–B) (Chih et al., 2006). Simultaneously, the insertion point for SSB in NL1 is in close proximity to the Site I interface (Koehnke et al., 2010), suggesting that presence of SSB might affect MDGA binding. These observations prompted us to investigate the effect of insertion of SSA and SSB on the NL-MDGA complex formation. First, we mapped SSA, derived from a published NL1(+A1) crystal structure (PDB: 3VKF; Tanaka et al., 2012), onto the NL1-MDGA1 (0.399 Å RMSD over 477 NL1 Cα positions) and NL1-NRX1 (0.375 Å RMSD over 453 NL1 Cα positions) structures (Figure 8B). NL1 SSB Differentially Modulates NL1-NRX and NL1-MDGA Complex Formation (A) Crystal structure of human NL1(+B). The inset shows 2mFo-DFc electron density contoured at 1.0σ (cyan mesh) for spliced sequence B (SSB). The star symbol indicates the position of the N-linked glycan at Asn300. The glycan tree itself was not visible in the electron density due to structural flexibility. (B) Structural mapping of spliced sequences A (SSA) and B (SSB) onto NL1. The NL1-MDGA1 and NL1-β-NRX1 interfaces are oriented similarly, based on structural alignment of one NL1 monomer (0.292 Å RMSD over 453 NL1 Cα positions). The position of SSB is derived from the crystal structure of NL1(+B), and the position of SSA is derived from a published crystal structure of rat NL1(+A1) (PDB: 3VKF; Tanaka et al., 2012). (C) Schematic representation of the SPR setup, summary of KD values, and binding isotherms for the interaction of human NL1(–A–B)ECTO, NL1(–A+B)ECTO, and NL1(–A+B_N300Q)ECTO with MDGA1-2ECTO and β-NRX1LNS6(±4). (D) COS-7 cells expressing myc-NLs were co-transfected with HA-CD4 control, HA-MDGA1, or HA-MDGA2 and co-cultured with hippocampal neurons. The ability of the co-transfected cells to induce synapsin clustering was measured and normalized to the area of tau-positive axon contact. The bar graphs represent the mean of three independent experiments for low, medium, and high plasmid ratios (Figure S6A) of human HA-MDGA1-2:myc-NL1(–A ± B) (n > 24 total cells for each ratio) with the CD4:myc-NL1(–A ± B) co-transfected controls normalized to 100% to show the relative change of synapsin integrated intensity at each ratio. Significance is shown for CD4 control versus MDGAs for each NL1 (one-way ANOVA with Bonferroni post hoc comparison). Error bars represent the SEM. ∗p < 0.05, ∗∗p < 0.01, ∗∗∗p < 0.001; n.s., not significant. A detailed statistical quantification can be found in Table S3. (E) Representative images of co-cultures immunostained for surface myc-NL (blue), surface HA-MDGA or CD4 control (data not shown), synapsin (red), and tau axonal marker (green). The isolated synapsin signal (white) is shown next to each color image. Scale bar, 30 μm. See also Figures S9–S11. Interestingly, although SSA is spatially distant from both Site I and Site II binding interfaces, it is in close proximity to the MDGA Ig5 and Ig6 domains (Figure 8B). As such, SSA might have the potential to either clash with Ig5-Ig6 or, conversely, provide an additional binding site for MDGA. We tested using SPR whether insertion of the distinct SSA sequences into NL1, NL2, or NL3 had an effect on the NL-MDGA or NL-NRX interactions. We were unable to detect a robust or meaningful impact of the SSA sequences on the binding strength of any NL1-3ECTO-MDGA1-2ECTO or NL1-3ECTO-β-NRX1LNS6(±4) pair (Figures S9A, S9B, S10A, and S10B), suggesting that SSA possesses sufficient conformational freedom to not perturb the core NL-MDGA interaction. Accordingly, we suggest that SSA is not involved in modulating the NL-MDGA interaction. Next, we determined the crystal structure of human NL1 containing SSB (hNL1(+B)) at 2.55 Å (Figure 8A; Table S1). The nine-residue SSB (NRWSNSTKG), inserted between Gly295 and Leu305, was clearly visible in the electron density; the N-linked glycan at Asn300, a modulator of the NL-NRX interaction (Chih et al., 2006, Comoletti et al., 2003), was, however, not fully resolved due to conformational flexibility (Figure 8A). Superposition of NL1(+B) and NL1-MDGA1 (0.308 Å RMSD over 434 NL1 Cα positions) or NL1-NRX1 (0.306 Å RMSD over 428 NL1 Cα positions) structures revealed that SSB is spatially immediately adjacent to both Site I interfaces (Figure 8B). We found, using SPR, that insertion of SSB weakened the NL1-MDGA1-2 interaction ∼7-fold, while reducing the NL1-β-NRX1(±4) interaction less than 2-fold (Figure 8C). We propose that this differential effect is due to the much larger molecular footprint of MDGA and the resulting close proximity of the MDGA Ig5 and Ig6 domains to the N-linked glycan at Asn300, suggesting that SSB reduces the NL-MDGA interaction due to steric hindrance (Figure 8B). Indeed, removal of the N-linked glycan (Asn300Gln mutant) partially recovered the NL1-MDGA1-2 interaction affinity, whereas it had almost no effect on the NL1-β-NRX1(±4) interaction (Figure 8C). Using the co-culture assay, we tested the effect of the presence of SSB on the ability of MDGA1-2 to block recruitment of synaptic terminals by full-length NL1(–B) and NL1(+B). Co-expression of MDGA1-2 at low, medium, and high plasmid ratios (as previously defined; Figure S6A) led to a decreased recruitment of terminals by both NL1(–B) and NL1(+B) (Figures 8D and 8E; Table S3); however, we found a concentration-dependent decrease for MDGA1. At the medium ratio, MDGA1 significantly blocked recruitment of terminals by NL1(–B), but not NL1(+B), consistent with the difference in binding observed in the SPR assay (Figure 8C). Taken together, our results suggest that, despite the proximity of SSB to the Site I interface, its presence does not eliminate the ability of MDGA to block NL-NRX signaling. Rather, SSB provides a way to fine-tune the NL1-MDGA1-2 interaction at excitatory synapses.

Discussion

In this work, we present the structure of the near-complete MDGA1 extracellular domain and its complex with NL1, establishing the general recognition paradigm between these synaptic organizing molecules. Simultaneously, our structural analyses guided the discovery of a broad splicing-modulated interaction network between all MDGA and NL isoforms that is able to block NL-NRX complex formation and modulate NL-induced recruitment of synaptic terminals. Two large, triangular MDGA1 molecules cradle dimeric NL to shield it from interacting with NRX. We tested whether this arrangement also has the potential to negatively influence the interaction of NL with the astrocyte-secreted proteins TSP1 (Xu et al., 2010) and hevin (Singh et al., 2016) and with the NMDAR (Budreck et al., 2013). However, we failed to reproduce these interactions using SPR. Our results suggest that, at least using isolated recombinantly produced proteins and in an SPR setup with defined components and buffer conditions, these interactions are very weak, require the membrane environment, or are mediated through as-yet-unidentified auxiliary proteins or small-molecule ligands. Future studies will have to identify the exact molecular components required for these interactions. The structure of the NL1-MDGA1 complex uncovers Site II, a hitherto unrecognized interaction site on NL that is distinct from the canonical NL-NRX Site I interface, highlighting the ability of the NL cholinesterase fold to accommodate a diverse array of ligand interaction modes. Furthermore, the NL ΔSite II mutant is a useful molecular tool to selectively uncouple NL-NRX complex formation from inhibition by MDGA, or from other proteins that would utilize Site II. MDGA Ig domains 1–3 mediate all contacts with NL (Figure 3A). We speculate that MDGA might have more binding partners besides NL. Indeed, the MDGA1 MAM domain binds a receptor on axons (Fujimura et al., 2006) and enhances cell motility and adhesion to non-MDGA1-expressing cells (Díaz-López et al., 2010). The Ig domains 4–6 are reported to play a role in determining synaptic localization of MDGA1 and MDGA2 (Loh et al., 2016). Adhesive interactions of MDGA with as-yet-unidentified partners may be responsible for the MDGA-dependent aggregation of basal progenitor cells in the subventricular zone (Perez-Garcia and O’Leary, 2016), radial migration of cortical neurons (Takeuchi and O’Leary, 2006), and directed axon outgrowth (Ingold et al., 2015, Joset et al., 2011). The widespread expression of NLs (Varoqueaux et al., 2006) and NRXs (Brown et al., 2011, Górecki et al., 1999) from early postnatal ages also raises the interesting possibility that MDGAs may function to shield NLs at the stage of process outgrowth to prevent premature axon-dendrite adhesion and synaptogenesis. Given the similar interaction affinities of MDGA1-2 and NRX with NL, the balance between NL-NRX and NL-MDGA complex formation will be determined by their relative abundances and binding availability at each synapse in vivo. The net effect of MDGA on synaptic NL-NRX signaling may be influenced by the presence of other protein partners of MDGA, NRX (LRRTMs, calsyntenin 3, dystroglycan, latrophilin 1, cerebellins, and C1q-like proteins), and NL (hevin, thrombospondin, and NMDARs). The complexity of NL-NRX signaling is compounded even further by the existence of postsynaptic cis NL-NRX silencing complexes (Taniguchi et al., 2007) and by the recent report of MDGA-like functions for γ-protocadherins (Molumby et al., 2017). The capacity of NLs to form heterodimers (Poulopoulos et al., 2012) will differentially affect MDGA and NRX binding since the MDGA interface spans both NL monomers, whereas the NRX interface does not. For example, NL1/3, the most prevalent NL heterodimer located at excitatory synapses (Budreck and Scheiffele, 2007, Poulopoulos et al., 2012), would harbor an asymmetric set of Site I-II interfaces: Site II on one side of the dimer will come from NL3, while Site I will be donated by NL1. At the other side of the dimer, this will be inverted. Since NL3 interacts ∼10-fold more weakly with MDGA than NL1(–B) (Figure 5A), a composite interface will likely lead to an intermediate strength binding event. Insertion of SSB into NL1 near Site I, however, brings the affinity of NL1 for MDGA in the range of that of NL3 (Figure 8C). The direct interaction affinities with NL1 and NL2 do not seem to account for selectivity of MDGAs to suppress excitatory or inhibitory synapses. Consistent with the role of MDGA2 to suppress excitatory synapses in vivo (Connor et al., 2016), MDGA2, but not MDGA1, suppressed the synaptogenic activity of the major NL at excitatory synapses, NL1(+B), in co-culture experiments at low-medium ratios (Figure 8D). Yet MDGA2 showed ∼12-fold and MDGA1 ∼6-fold greater affinity for the major NL at inhibitory synapses, NL2, than for NL1(+B) (Figures 5A and 8C). Factors other than direct MDGA-NL1-2 binding affinities that may contribute include differential glycosylation, although we could find no indication for such (Figures S4C and S4D); additional interacting proteins; or differential cell-type expression and subcellular targeting in the brain. As summarized in the introduction, there are conflicting reports on the roles of MDGAs at excitatory versus inhibitory synapses, perhaps related to the use of different model systems, reinforcing the need to consider the native abundance of each molecular player. The newly discovered interaction of MDGAs with NL3 and NL4, particularly the strong association of MDGA1 with NL3 in the pull-down assay and functional modulation of NL3 by MDGA1 in co-culture, may help in better understanding the roles of MDGAs in specific circuits in vivo. In the rat and mouse brain, MDGA1 and MDGA2 are widely expressed by neuronal populations in both the central and peripheral nervous systems. These include neurons of the basilar pons, inferior olivary nucleus, cerebellum, cerebral cortex, olfactory bulb, spinal cord, dorsal root and trigeminal ganglia, and hippocampus (Connor et al., 2016, Lee et al., 2013, Litwack et al., 2004, Takeuchi et al., 2007). There are regional differences: for example, MDGA1 is more abundant in superficial cortical layers and MDGA2 in deep layers. NL and NRX are also very widely expressed in the mouse brain, such that most neurons likely express NL1–4 and NRX1–3 at varying levels (Hoon et al., 2011, Ullrich et al., 1995, Varoqueaux et al., 2006). We propose that the structural mechanism we described here will be representative for the full range of CNS synapses at which NL, NRX, and MDGA family members are present. Through NL2 and NL4, the range of synapses modulated by MDGA is likely to include glycinergic synapses, not just GABAergic and glutamatergic synapses as shown previously. The differential affinities of specific MDGA and NL isoforms as well as isoform selective interactions of NL with NRX, interactions with other partners regulating bioavailability, and cell-type expression patterns of all molecular players will serve to fine-tune MDGA modulation of synapse development and function. An important finding of this study is the discovery that both MDGAs interact with and regulate NL3 and NL4. This is of particular interest since rare mutations in NLs, particularly NL3 and NL4, have been associated with ASD and schizophrenia in human genetic studies (Südhof, 2008; Simons Foundation Autism Research Initiative database, https://gene.sfari.org). Interestingly, two mutations in the MDGA interaction-selective Site II of NL3 have been reported in patients with ASD: Arg451Cys (R451C; corresponding to NL1 residue Arg450 and part of the Leu449-Arg450-Glu451 LRE motif) and Gly426Ser (G426S; corresponding to NL1 residue Ala425) (Jamain et al., 2003, Xu et al., 2014) (Figures 7A and 7B). This raises the possibility that selective modulation of MDGA binding to NLs in patients carrying mutations in Site II could contribute to the development of ASD. R451C was characterized as an NL3 gain-of-function mutation in mice, leading to both increased inhibitory synaptic transmission in the somatosensory cortex (Tabuchi et al., 2007) and increased excitatory synaptic transmission in the hippocampus (Etherton et al., 2011), despite resulting in trafficking defects and protein destabilization (Chih et al., 2004, Comoletti et al., 2004). Nonetheless, we observed surface expression of the mutant in both transfected COS-7 cells (Figure S8C) and rat hippocampal neurons (Figure S8D). The latter observation agrees with a report showing cell-surface expression of NL3 R451C in a subset of transfected hippocampal neurons with high expression level (Chih et al., 2004). This also led to an increase in the number of contacting presynaptic terminals, suggesting that the NL3 R451C that trafficked to the surface is functional (Chih et al., 2004). Importantly, we found that, similarly to the NL ΔSite II mutant, the NL3 R451C mutation selectively uncoupled NL3-NRX binding and recruitment of synaptic terminals from inhibition by MDGA1 (Figure 7D), suggesting that the R451C gain-of-function phenotype is achieved by preventing the inhibition of NL3 by MDGA1, thereby leading to disruption of the overall balance of excitatory/inhibitory (E/I) synaptic transmission. An E/I imbalance surpassing the capacity of neuronal populations and circuits to regulate synaptic homeostasis is a proposed hallmark of ASD (Nelson and Valakh, 2015, Rubenstein and Merzenich, 2003). Disruptions in the regulatory NL-MDGA network we report here contribute to ASD based on human genetics (Bucan et al., 2009, Kähler et al., 2008, Li et al., 2011, Südhof, 2008) and can generate such an E/I imbalance in animal models (e.g., Connor et al., 2016, Tabuchi et al., 2007). Our findings considerably broadened this interaction network beyond that previously envisioned. Moreover, our structural studies constitute an essential guide toward the generation of directed therapies targeting these gene products to restore E/I balance.

STAR★Methods

Key Resources Table

Contact for Reagent and Resource Sharing

Further information and requests for reagents may be directed to and will be fulfilled by the Lead Contact, A. Radu Aricescu (radu@mrc-lmb.cam.ac.uk).

Method Details

Expression and purification of recombinant proteins

List of cDNAs and construct boundaries for secreted protein production: chicken MAM domain-containing glycosylphosphatidylinositol anchor protein (MDGA) 1 (MDGA1; GenBank: AB241390.1; Gln19-Lys919), human MDGA1 (GenBank: NM_153487.3; Gln19-Lys925), human MDGA2 (GenBank: AY369208.1; Gln21-Lys927), human neuroligin-1 (NL1; GenBank: NM_014932.3; Gln46-Asp635), human neuroligin-2 (NL2; GenBank: NM_020795.3; Glu38-His612), human neuroligin-3 (NL3; GenBank: NM_181303; Gln38-Asp636), human neuroligin-4 (NL4 or NL4(X); GenBank: NM_020742.3; Gln42-Glu602), human neuroligin-5 (NL5 or NL4(Y); GenBank: NM_014893.4; Gln42-Glu602), human β-neurexin-1 (GenBank: NM_138735; β-NRX1: His85-Val265), human thrombospondin-1 (TSP1; GenBank: X04665.1; Asn19-Pro1170), human hevin (or SPARC-like protein 1; GenBank: BC033721.1; Ile17-Phe664), mouse α-Neurexin-1 (GenBank: XM_006523816.3; Leu31-Val1337). These cDNAs were fused C-terminally with a hexa-histidine (His6) tag or Avitag3, and were cloned into the pHLsec vector (Aricescu et al., 2006b). For large-scale protein production, His6-tagged proteins were expressed by transient transfection in HEK293T (for biophysical studies) or HEK293S-GnTI−/− (Reeves et al., 2002) (for crystallographic studies) cells. Five (HEK293T) to ten (HEK293S-GnTI−/−) days post-transfection, the conditioned Dulbecco’s Modified Eagle Medium (DMEM) medium was collected and buffer-exchanged using a QuixStand benchtop diafiltration system (GE Healthcare) and proteins were purified by immobilized metal-affinity chromatography (IMAC) using pre-packed Nickel Sepharose columns (GE Healthcare). Proteins were concentrated and further purified by size-exclusion chromatography (SEC; Superdex 200 16/60 PG HiLoad column, GE Healthcare) in 10 mM HEPES (4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid) pH 7.50, 150 mM sodium chloride and 3 mM calcium chloride (HBS-C).

Expression and purification of recombinant NMDA receptor

The rat GluN1a-GluN2B heterotetrameric NMDA receptor (NMDAR) was expressed and purified as previously described (Karakas and Furukawa, 2014), with the exception that the OneStrep tag was not cleaved. The final purification buffer was 200 mM NaCl, 20 mM HEPES pH 7.4, 10 mM Glycine, 10 mM Glutamate, 0.0025% LMNG.

Gene splicing and site-directed mutagenesis

A multiple-step overlap-extension PCR (Pyrobest Polymerase, Takara Bio) was used for site-directed mutagenesis, construction of chimeric protein constructs and introduction or deletion of splice inserts (Heckman and Pease, 2007); the resulting PCR products were cloned into the pHLsec-His6, pHLsec-Avitag3, or derived vectors (Aricescu et al., 2006b).

NL1

The following internal primer pair was used for the introduction of human NL1 spliced sequence “A1” (VKRISKECARKPGKKICRKG) into human NL1(–A ± B) (UniProt: Q8N2Q7; between Asp164 and Asp182); FP: 5′-CCAAGGAATGTGCCAGAAAGCCCGGCAAGAAAATATGTAGAAAAGGAGATATTCGGGACAGTGGGGGTCCCAAACCAG-3′ RP: 5′-CTTGCCGGGCTTTCTGGCACATTCCTTGGATATTCTTTTTACATCCTCAGTCGGGACATATATATTTAAATATAG-3′ The following internal primer pair was used for the introduction of human NL1 spliced sequence “A2” (GPLTKKQTDDLGDNDGAEDE) into human NL1(–A ± B) (between Asp164 and Asp182); FP: 5′-GAAACAGACAGATGATTTAGGTGATAATGACGGTGCTGAAGATGAAGATATTCGGGACAGTGGGGGTCCCAAACCAG-3′ RP: 5′-CTTGCCGGGCTTTCTGGCACATTCCTTGGATATTCTTTTTACATCCTCAGTCGGGACATATATATTTAAATATAG-3′ The following internal primer pair was used for the introduction of human NL1 spliced sequence “A2” (GPLTKKQTDDLGDNDGAEDE) into human NL1(+A1 ± B) (after spliced sequence A1); FP: 5′-GAAACAGACAGATGATTTAGGTGATAATGACGGTGCTGAAGATGAAGATATTCGGGACAGTGGGGGTCCCAAACCAG-3′ RP: 5′-CATTATCACCTAAATCATCTGTCTGTTTCTTTGTAAGGGGACCTCCTTTTCTACATATTTTCTTGCCGGGCTTTC-3′ The following internal primer pair was used for the introduction of human NL1 spliced sequence “B” (NRWSNSTKG) into human NL1(±A–B) (between Gly295 and Leu305); FP: 5′-GTAACCGTTGGAGCAATTCAACCAAAGGACTTTTTCAACGAGCAATAGCTCAAAG-3′ RP: 5′-GTCCTTTGGTTGAATTGCTCCAACGGTTACCTTCAGAATAATGGGATAAAGTC-3′ The following internal primer pairs were used for constructing the human NL1 ΔSite I mutant (H291A-Y292A-D384A-E394A); H291A Y292A (LTLSHYSEGL to LTLSAASEGL); FP: 5′-GTCAACCTGCTGACTTTATCCGCTGCTTCTGAAGGTCTTTTTCAACGAG-3′ RP: 5′-CTCGTTGAAAAAGACCTTCAGAAGCAGCGGATAAAGTCAGCAGGTTGAC-3′ D384A (VIPDDPQI to VIPADPQI); FP: 5′-GGTGATGTAATACCAGCCGACCCCCAGATATTG-3′ RP: 5′-CAATATCTGGGGGTCGGCTGGTATTACATCACC-3′ E394A (MEQGEFLNY to MEQGAFLNY); FP: 5′-GATGGAGCAAGGAGCGTTTCTCAACTATG-3′ RP: 5′-CATAGTTGAGAAACGCTCCTTGCTCCATC-3′ The following internal primer pairs were used for constructing the human NL1 ΔSite II mutant (D429A-F430A-S433A-N434A-R450A); D429A F430A S433A N434A (ASDFDFAVSNFVDN to ASDFAAAVAAFVDN); FP: 5′-GCCGCTGCTGTTGCAGCTTTTGTTGATAATTTATATGGATATCCTGAAGGCAAAGATG-3′ RP: 5′-AGCTGCAACAGCAGCGGCAAAATCACTAGCTGATATACCATCATCGCTATCTAC-3′ R450A (KDVLRETIK to KDVLAETIK); FP: 5′-GAAGGCAAAGATGTTTTGGCAGAAACCATTAAGTTCATG-3′ RP: 5′-CATGAACTTAATGGTTTCTGCCAAAACATCTTTGCCTTC-3′ The following internal primer pair was used for introducing the R450C mutation into human NL1(–A–B) (DVLRETI to DVLCETI); FP: 5′-GGCAAAGATGTTTTGTGCGAAACCATTAAGTTC-3′ RP: 5′-GAACTTAATGGTTTCGCACAAAACATCTTTGCC-3′ The following internal primer pair was used for introducing the Asn300Gln (N300Q) mutation into human NL1 spliced sequence “B” (NRWSNSTKG to NRWSQSTKG); FP: 5′-GGTAACCGTTGGAGCCAGTCAACCAAAGGAC-3′ RP: 5′-GTCCTTTGGTTGACTGGCTCCAACGGTTACC-3′

NL2

The following internal primer pair was used for the introduction of human NL2 spliced sequence “A” (GPLTKKRDEATLNPPDT) into human NL2(–A) (UniProt: Q8NFZ4; between Asp152 and Asp170); FP: 5′-CACAAAAAAACGTGACGAGGCGACGCTCAATCCGCCAGACACAGATATCCGGGACCCTGGGAAGAAACCTGTC-3′ RP: 5′-GATTGAGCGTCGCCTCGTCACGTTTTTTTGTGAGCGGACCGTCCTCAGTGGGCACGTAGAGGTTGAGGTAC-3′

NL3

The following internal primer pair was used for the introduction of human NL3 spliced sequence “A1” (VKRISKECARKPNKKICRKG) into human NL3(–A) (UniProt: Q9NZ94; between Asp152 and Asp193); FP: 5′-CCAAGGAATGCGCCCGAAAGCCCAACAAGAAAATTTGTAGGAAAGGAGACATCCGGGACAGTGGTGCTAAACCCGTC-3′ RP: 5′-GTTGGGCTTTCGGGCGCATTCCTTGGAAATCCGCTTTACATCCTCCGTCGGCACATAGACGTTCAGGTAG-3′ The following internal primer pair was used for the introduction of human NL3 spliced sequence “A2” (GSGAKKQGEDLADNDGDEDE) into human NL3(–A) (between Asp152 and Asp193); FP: 5′-GAAACAGGGCGAGGACTTAGCGGATAATGACGGGGATGAAGATGAAGACATCCGGGACAGTGGTGCTAAACCCGTC −3′ RP: 5′-CCGCTAAGTCCTCGCCCTGTTTCTTAGCGCCGGATCCATCCTCCGTCGGCACATAGACGTTC-3′ The following internal primer pair was used for the introduction of human NL3 spliced sequence “A2” (GSGAKKQGEDLADNDGDEDE) into human NL3(+A1) (after spliced sequence A1); FP: 5′-GAAACAGGGCGAGGACTTAGCGGATAATGACGGGGATGAAGATGAAGACATCCGGGACAGTGGTGCTAAACCCGTC-3′ RP: 5′-CATTATCCGCTAAGTCCTCGCCCTGTTTCTTAGCGCCGGATCCTCCTTTCCTACAAATTTTCTTGTTGGGCTTTC-3′ The following internal primer pair was used for introducing the R451C mutation into human NL3(–A) (DTLRETI to DTLCETI); FP: 5′-GGTAAGGACACCCTGTGCGAGACCATCAAGTTC-3′ RP: 5′-GAACTTGATGGTCTCGCACAGGGTGTCCTTACC-3′

MDGA1

The following internal primer pair was used for introducing the R120K mutation into chicken MDGA1 (UniProt: Q0WYX8; VPAIRSIRV to VPAIKSIRV); FP: 5′-GTTGGGGTCCCTGCCATCAAGTCCATTCGAGTAGATGTGCAG-3′ RP: 5′-CTGCACATCTACTCGAATGGACTTGATGGCAGGGACCCCAAC-3′ The following internal primer pairs were used for constructing the chicken MDGA1 R156N-S502N-R680N glycan wedge mutant; R156N (TVFLRCTVN to TVFLNCTVN); FP: 5′-GAGAAGACTGTCTTCCTCAATTGTACCGTCAACTCCAAC-3′ RP: 5′-GTTGGAGTTGACGGTACAATTGAGGAAGACAGTCTTCTC-3′ S502N (LRLESVSRD to LRLENVSRD); FP: 5′-GGAAGCTGCGCCTGGAGAATGTCAGCCGAGACATGAG-3′ RP: 5′-CTCATGTCTCGGCTGACATTCTCCAGGCGCAGCTTCC-3′ R680N (LAQRNTIQ to LAQNNTIQ); FP: 5′-GTCAGGCAGCTGGCTCAGAACAACACCATCCAAACCTTC-3′ RP: 5′-GAAGGTTTGGATGGTGTTGTTCTGAGCCAGCTGCCTGAC-3′

β-NRX1

The following internal primer pair was used for the introduction of human β-NRX1 spliced sequence #4 (SS4; GNNDNERLAIARQRIPYRLGRVVDEWLLDK) into human β-NRX1(–4) (UniProt: P58400; between Ala204 and Gly205); FP: 5′-CGCATTCCCTATCGGCTAGGGAGAGTGGTGGACGAATGGCTGCTCGATAAAGGGAGGCAACTGACCATCTTCAACTCAC-3′ RP: 5′-CCCTAGCCGATAGGGAATGCGTTGCCGTGCTATGGCTAACCTCTCATTGTCGTTGTTTCCAGCTGGGTATCTCTCAATGAC-3′

TSP1

The following internal primer pair was used for introducing the C992S mutation (Kvansakul et al., 2004) into human TSP1 (UniProt: P07996; QTVNCDPGL to QTVNSDPGL); FP: 5′-CAGACTGTCAACAGTGATCCTGGACTC-3′ RP: 5′-GAGTCCAGGATCACTGTTGACAGTCTG-3′

Protein crystallization

Crystallization trials, using 100 nL protein solution plus 100 nL reservoir solution in sitting drop vapor diffusion format, were set up in 96-well Greiner plates using a Cartesian Technologies robot (Walter et al., 2005). Purified chicken MDGA1ECTO (cMDGA1ECTO; Gln19-Lys919), containing the Arg120Lys mutation, concentrated to 5.0 g/L and treated with endoglycosidase F1 (Endo F1; 1:100 w/w) for 30 min at 294K immediately prior to dispensing the crystallization drops, crystallized in 0.1M HEPES pH7.5, 4% w/v polyethylene glycol 8000. The Arg120Lys mutation was introduced into cMDGA1ECTO to bring the sequence in line with rat, mouse and human isoforms (Figure S1B). Crystals of cMDGA1ECTO grown in this condition were fragmented, and the obtained seed stock (Walter et al., 2008) was used as an additive during crystallization trials of selenomethionine- (SeMet) labeled cMDGA1ECTO. Matrix screens were performed using precipitant concentration and seed stock dilution as variables. SeMet-labeled cMDGA1ECTO, concentrated to 5.0 g/L, crystallized in 0.1M HEPES pH7.5, 3% w/v polyethylene glycol 8000, using a 32-fold diluted native cMDGA1ECTO seed stock dispensed in 20 nL drops. Crystals were cryoprotected using reservoir solution containing 20% (v/v) PEG200. Purified glycosylated human NL1(–A+B)ECTO (hNL1(–A+B)ECTO; Gln46-Asp635), concentrated to 10.0 g/L, crystallized in 0.2M KSCN, 0.1M Bis-tris propane pH 8.5, 20% w/v PEG3350. Crystals were cryoprotected using reservoir solution containing 20% (v/v) PEG200. To crystallize the hNL1(–A–B)ECTO–cMDGA1ECTO complex, purified hNL1(–A–B)ECTO (Gln46-Asp635; concentrated to 2.92 g/L = 45.30 μM) and cMDGA1ECTO (Gln19-Lys919 with Arg120Lys mutation; concentrated to 4.41 g/L = 42.94 μM) were mixed as follows; 80 μL hNL1(–A–B)ECTO was combined with 102 μL cMDGA1ECTO (resulting in a 1:1.25 NL1:MDGA1 monomer-to-monomer molar stoichiometric ratio), 18 μL purification buffer (10 mM HEPES pH7.5, 150 mM NaCl), and 50 μL dilution buffer (10 mM HEPES pH7.5, 150 mM NaCl, 1M NDSB-256). The final concentration of hNL1(–A–B)ECTO thus was 0.93 g/L; that of cMDGA1ECTO was 1.76 g/L; and that of NDSB-256 was 250 mM. This preparation was treated with endoglycosidase F1 (Endo F1; 1:100 w/w) for 30 min at 294K immediately prior to dispensing the crystallization drops. The hNL1(–A–B)ECTO–cMDGA1ECTO complex crystallized in 0.1M Na.HEPES pH 7.0, 7.5% w/v PEG8000. Crystals were cryoprotected using reservoir solution containing 33% (v/v) PEG200.

Crystallographic data collection and structure determination

Diffraction data for cMDGA1ECTO were collected at Diamond Light Source (DLS) beamline I03 to a nominal resolution of 3.20 Å in space group (SG) P212121. X-ray fluorescence wavelength scans were performed to experimentally determine the Selenium absorption K-edge peak. The cMDGA1ECTO structure was determined using Single Anomalous Diffraction (SAD); the heavy-atom Selenium substructure was solved using SHELXD (Schneider and Sheldrick, 2002) at 3.70 Å, and phase determination, phase extension and density modification was performed using PHENIX Autosol (Terwilliger et al., 2009). Automated model building programs failed to reliably place stretches of β strand, necessitating manual model building of the complete structure. Diffraction data for hNL1(–A+B)ECTO were collected at Diamond Light Source (DLS) beamline I24 to a nominal resolution of 2.55 Å in SG P22121. The structure was determined by molecular replacement using the program Phaser (McCoy et al., 2007), and using the mouse NL1 (PDB: 3BIX) crystal structure as search model. Diffraction data for the hNL1(–A–B)ECTO–cMDGA1ECTO complex were collected at Diamond Light Source (DLS) beamline I04-1 to a nominal resolution of 3.30 Å in SG P21212. The structure was determined by molecular replacement using the program Phaser (McCoy et al., 2007), employing the refined hNL1(–A+B)ECTO (in which the spliced sequence B was excised from the molecular model) and cMDGA1ECTO crystal structures we determined here as search models. All data were indexed, integrated, and scaled using the automated XIA2 expert system (Winter et al., 2013), using the Labelit (Sauter et al., 2004), POINTLESS and AIMLESS (Evans, 2006, Evans, 2011), and XDS (Kabsch, 2010) programs. Crystallographic data collection and refinement statistics are presented in Table S1.

Crystallographic refinement and model analysis

Maximum-likelihood refinement of cMDGA1ECTO, hNL1(–A+B)ECTO and the hNL1(–A–B)ECTO–cMDGA1ECTO complex was initially performed with Refmac using “jelly body” restraints (Murshudov et al., 2011), and finally with the PHENIX suite (Adams et al., 2010), with automated X-ray and atomic displacement parameter (ADP) weight optimization applied throughout, and torsion angle non-crystallographic symmetry (NCS) and high-resolution reference structure restraints applied where suitable. All manual model building was performed using Coot (Emsley et al., 2010). Structure validation was performed with the PHENIX program suite using MolProbity routines (Adams et al., 2010, Chen et al., 2010). Interface analysis was performed using PISA (Krissinel and Henrick, 2007) as implemented in Coot (Emsley et al., 2010), and using the program Intervor (Loriot and Cazals, 2010). Calculation of pairwise root-mean-square deviations (rmsd) between structural model coordinates was performed using the program PyMol (Schrodinger, 2010). Molecular representations were made using the program PyMol (Schrodinger, 2010).

Sequence alignments and conservation analysis

Mining of protein sequence databases was performed using the Delta-Blast program (Altschul et al., 1990). Sequence lists were manually curated and sequences were aligned using the program MUSCLE (Edgar, 2004). Sequence conservation scores for individual residue positions of NL1, −2, −3, −4, and −5 (1046 total unique sequences) and MDGA1 and −2 (420 total unique sequences) homologs were assigned to NL1 and MDGA1 structural templates extracted from the hNL1(–A–B)ECTO–cMDGA1ECTO complex, respectively, using the ConSurf web server (Ashkenazy et al., 2010). Sequence alignments were visualized using the program ALINE (Bond and Schüttelkopf, 2009).

Small-angle X-ray scattering (SAXS)

Purified cMDGA1ECTO (Gln19-Lys919; with Arg120Lys mutation) was treated with endoglycosidase F1 (Endo F1; 1:100 w/w) for 12 hr at 294K and re-purified using SEC in 10 mM HEPES pH 7.50, 150 mM NaCl. SAXS data were collected at beamline BM29 of the European Synchrotron Radiation Facility (ESRF, Grenoble, France) (Pernot et al., 2013) at 293 K within a momentum transfer (q) range of 0.01 Å−1 < q < 0.45 Å−1, where q = 4πsin(θ)/λ, and 2θ is the scattering angle. The X-ray wavelength was 0.9950 Å, and data were collected on a Pilatus 1M detector. cMDGA1ECTO was measured at concentrations of 1.50 and 3.36 g/L in 10 mM HEPES pH 7.50, 150mM NaCl. Data reduction and calculation of invariants was carried out using standard procedures implemented in the ATSAS (Petoukhov et al., 2012) and ScÅtter (Rambo and Tainer, 2013) suites. A merged dataset was obtained by merging the low-angle part of the low-concentration dataset with the high-angle part of the high-concentration dataset. A molecular model for the C-terminal Mam8 domain was generated by homology modeling starting from the crystal structure of the N-terminal RPTPmu MAM domain (PDB: 2C9A, UniProt: P28827) (Aricescu et al., 2006a) using the SWISS-MODEL server (Biasini et al., 2014). This model was concatenated with the cMDGA1ECTO crystal structure, and manually placed near the C terminus of the FnIII7 domain. Missing side chains, loops, and C-terminal His6-tag were added to the resulting assembled model using the MODELER (Webb and Sali, 2014) “Model/Refine Loops” routine as implemented in Chimera (Pettersen et al., 2004). Coarse-grained molecular dynamics (MD) simulations were performed using the program Allosmod (Weinkam et al., 2012). Five independent runs were performed, each consisting of 30 independent trajectories generating 100 models. From this total pool of 15,000 models, automated selection of the minimal set of models that best described the scattering data was performed with the program MES (Hammel, 2012), and calculation and fitting of scattering patterns were performed with the program FoXS (Schneidman-Duhovny et al., 2013). This whole procedure was automated with the AllosMod-FoXS web server (Guttman et al., 2013). The MDGA1 solution structure was accurately (χ2 = 1.17) modeled as a five-membered ensemble of monomeric conformers with pronounced flexibility at the FnIII7-Mam8 domain linkage.

Surface plasmon resonance (SPR) with soluble proteins

cDNA for the immobilized proteins was cloned into the pHLsec-Avitag3 vector (Aricescu et al., 2006b), resulting in proteins carrying a C-terminal biotin ligase (BirA) recognition sequence (Avitag). Constructs were co-transfected with pDisplay-BirA-ER (Addgene plasmid 20856; coding for an ER-resident biotin ligase) (Howarth et al., 2008) for in vivo biotinylation in HEK293T cells in small-scale 6- or 12-well plates in a 3:1 pHLsec:pDisplay stoichiometric ratio. A final concentration of 100 μM D-biotin was maintained in the expression medium to ensure near-complete biotinylation of the recognition sequence. After 48 hr of expression, conditioned medium was collected and dialysed against 10 mM Tris pH 7.4, 150 mM sodium chloride, 3 mM calcium chloride and 0.005% (v/v) Tween-20 (TBS-CT). SPR experiments were performed on a Biacore T200 machine (GE Healthcare) operated at a data collection frequency of 10 Hz; i.e. a temporal resolution of 0.1 s. Streptavidin (Sigma-Aldrich) was chemically coupled via amine coupling chemistry onto CM5 chips to a response unit (RU) level of 5000 RU. Then, biotinylated proteins were captured to the desired RU level. In each instance, for every two analyte binding cycles, a buffer injection was performed, allowing for double referencing of the binding responses (Myszka, 1999). Due to (i) sample consumption associated with equilibrium affinity experiments of high-nanomolar to low-micromolar interactions and (ii) the limited production yield of MDGA1 and −2 proteins, we prioritized testing the full matrix of NL–MDGA isoform interactions over performing replicate experiments of only a selected number of interactions.

Interaction of chicken MDGA1ECTO with chicken MDGA1ECTO and MDGA1ECTOGLYCAN WEDGE

cMDGA1ECTO and cMDGA1ECTOGLYCAN WEDGE (triple glycan wedge (GW) mutant; Arg680Asn-Ser502Asn-Arg156Asn) variants were immobilized at a level of 2000 RU to maximize the likelihood of detecting a potentially weak binding event. SPR running buffer composition was TBS-CT supplemented with 1.0 g/L bovine serum albumin (BSA; yielding TBS-CTB buffer) as passivating agent to prevent binding to the carboxymethyldextran-based SPR chips. MDGA1ECTO was prepared by SEC in TBS-CT. BSA was added to the concentrated stock solutions to a final concentration of 1.0 g/L. Injection of 18 concentrations of cMDGA1ECTO prepared in a two-fold dilution series from a 100 μM stock concentration was performed in order of increasing concentration. Each sample was injected for 150 s at a flow rate of 25 μL/min, followed by a 180 s dissociation phase. No self-association binding event could be detected.

Interaction of human β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO with human NL1(–A–B)ECTO, NL2(–A)ECTO, NL3(–A)ECTO, NL4ECTO and NL5ECTO

NL1(–A–B)ECTO, NL2(–A)ECTO, NL3(–A)ECTO, NL4ECTO and NL5ECTO were immobilized at a level of 500 RU. SPR running buffer composition was TBS-CTB. β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO were prepared by SEC in TBS-CT. BSA was added to the concentrated stock solutions to a final concentration of 1.0 g/L. Injection of 15 concentrations of β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO, prepared in a two-fold dilution series from a 50 μM stock concentration, was performed in order of increasing concentration. Each sample was injected for 150 s at a flow rate of 25 μL/min, followed by a 180 s dissociation phase. In the case of MDGA1ECTO and MDGA2ECTO, the surfaces were regenerated using consecutive 30 s injections of 10 mM Tris pH 7.4, 100 mM L-Arginine/L-Glutamate, 1M NaCl. Equilibrium binding analysis was performed using Scrubber 2.0 (BioLogic Software) and data was fitted to a 1:1 Langmuir binding model in Prism 6 (Graphpad).

Interaction of human NL1(–A–B)ECTO with human hevin, human TSP1, and mouse α-NRX1ECTO(–4)

Human hevin, human TSP1 and mouse α-NRX1ECTO(–4) were immobilized at a level of 2000 RU. SPR running buffer composition was TBS-CTB. Human NL1(–A–B)ECTO was prepared by SEC in TBS-CT. BSA was added to the concentrated stock solutions to a final concentration of 1.0 g/L. Injection of 14 concentrations of NL1(–A–B)ECTO, prepared in a two-fold dilution series from a 25 μM stock concentration, was performed in order of increasing concentration. Each sample was injected for 150 s at a flow rate of 25 μL/min, followed by a 180 s dissociation phase. In the case of the interaction with α-NRX1ECTO(–4), the surfaces were regenerated using a 30 s injection of 10 mM Tris pH 8.0, 350 mM EDTA, 100 mM NaCl. Equilibrium binding analysis was performed using Scrubber 2.0 (BioLogic Software) and the α-NRX1ECTO(–4) data was fitted to a two-state Langmuir binding model in Prism 6 (Graphpad).

Interaction of human β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO with human NL1(–A–B)ECTO, NL1(–A–B)ECTO ΔSite I, NL1(–A–B)ECTO ΔSite II and NL1(–A–B)ECTO ΔSite I+II

NL1(–A–B)ECTO, NL1(–A–B)ECTO ΔSite I, NL1(–A–B)ECTO ΔSite II and NL1(–A–B)ECTO ΔSite I+II were immobilized at a level of 550 RU. SPR running buffer composition was TBS-CTB. β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO were prepared by SEC in TBS-CT. BSA was added to the concentrated stock solutions to a final concentration of 1.0 g/L. Injection of 15 concentrations of β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO, prepared in a two-fold dilution series from a 50 μM stock concentration, was performed in order of increasing concentration. Each sample was injected for 150 s at a flow rate of 25 μL/min, followed by a 180 s dissociation phase. In the case of MDGA1ECTO and MDGA2ECTO, the surfaces were regenerated using consecutive 30 s injections of 10 mM Tris pH 7.4, 100 mM L-Arginine/L-Glutamate, 1M NaCl. Equilibrium binding analysis was performed using Scrubber 2.0 (BioLogic Software) and data was fitted to a 1:1 Langmuir binding model in Prism 6 (Graphpad).

Interaction of human β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO with human NL1(–A–B)ECTO, NL1(–A–B)ECTO Arg450Cys, NL3(–A)ECTO, and NL3(–A)ECTO Arg451Cys

NL1(–A–B)ECTO and NL1(–A–B)ECTO Arg450Cys were immobilized at a level of 500 RU. NL3(–A)ECTO and NL3(–A)ECTO Arg451Cys were immobilized at a level of 1000 RU. SPR running buffer composition was TBS-CTB. β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO were prepared by SEC in TBS-CT. BSA was added to the concentrated stock solutions to a final concentration of 1.0 g/L. Injection of 15 concentrations of β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO, prepared in a two-fold dilution series from a 50 μM stock concentration, was performed in order of increasing concentration. Each sample was injected for 150 s at a flow rate of 25 μL/min, followed by a 180 s dissociation phase. In the case of MDGA1ECTO and MDGA2ECTO, the surfaces were regenerated using consecutive 30 s injections of 10 mM Tris pH 7.4, 100 mM L-Arginine/L-Glutamate, 1M NaCl. Equilibrium binding analysis was performed using Scrubber 2.0 (BioLogic Software) and data was fitted to a 1:1 Langmuir binding model in Prism 6 (Graphpad).

Interaction of human β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO with human NL1ECTO SSA variants

NL1(–A–B)ECTO, NL1(+A1–B)ECTO, NL1(+A2–B)ECTO and NL1(+A1+A2–B)ECTO were immobilized at a level of 500 RU. SPR running buffer composition was TBS-CTB. β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO were prepared by SEC in TBS-CT. BSA was added to the concentrated stock solutions to a final concentration of 1.0 g/L. Injection of 15 concentrations of β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO, prepared in a two-fold dilution series from a 50 μM stock concentration, was performed in order of increasing concentration. Each sample was injected for 150 s at a flow rate of 25 μL/min, followed by a 180 s dissociation phase. In the case of MDGA1ECTO and MDGA2ECTO, the surfaces were regenerated using consecutive 30 s injections of 10 mM Tris pH 7.4, 100 mM L-Arginine/L-Glutamate, 1M NaCl. Equilibrium binding analysis was performed using Scrubber 2.0 (BioLogic Software) and data was fitted to a 1:1 Langmuir binding model in Prism 6 (Graphpad).

Interaction of human β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO with human NL2ECTO and NL3ECTO SSA variants

NL2(–A)ECTO, NL2(+A)ECTO, NL3(–A)ECTO, NL3(+A1)ECTO, NL3(+A2)ECTO and NL3(+A1+A2)ECTO were immobilized at a level of 500 RU. SPR running buffer composition was TBS-CTB. β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO were prepared by SEC in TBS-CT. BSA was added to the concentrated stock solutions to a final concentration of 1.0 g/L. Injection of 15 concentrations of β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO, prepared in a two-fold dilution series from a 50 μM stock concentration, was performed in order of increasing concentration. Each sample was injected for 150 s at a flow rate of 25 μL/min, followed by a 180 s dissociation phase. In the case of MDGA1ECTO and MDGA2ECTO, the surfaces were regenerated using consecutive 30 s injections of 10 mM Tris pH 7.4, 100 mM L-Arginine/L-Glutamate, 1M NaCl. Equilibrium binding analysis was performed using Scrubber 2.0 (BioLogic Software) and data was fitted to a 1:1 Langmuir binding model in Prism 6 (Graphpad).

Interaction of human β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO with human NL1(–A–B)ECTO, NL1(–A+B)ECTO, and NL1(–A+B Asn300Gln)ECTO

NL1(–A–B)ECTO, NL1(–A+B)ECTO, and NL1(–A+B Asn300Gln)ECTO were immobilized at a level of 500 RU. SPR running buffer composition was TBS-CTB. β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO were prepared by SEC in TBS-CT. BSA was added to the concentrated stock solutions to a final concentration of 1.0 g/L. Injection of 15 concentrations of β-NRX1LNS6(–4), β-NRX1LNS6(+4), MDGA1ECTO and MDGA2ECTO, prepared in a two-fold dilution series from a 50 μM stock concentration, was performed in order of increasing concentration. Each sample was injected for 150 s at a flow rate of 25 μL/min, followed by a 180 s dissociation phase. In the case of MDGA1ECTO and MDGA2ECTO, the surfaces were regenerated using consecutive 30 s injections of 10 mM Tris pH 7.4, 100 mM L-Arginine/L-Glutamate, 1M NaCl. Equilibrium binding analysis was performed using Scrubber 2.0 (BioLogic Software) and data was fitted to a 1:1 Langmuir binding model in Prism 6 (Graphpad).

Surface plasmon resonance (SPR) with the NMDA receptor

SPR experiments were performed on a Biacore T200 machine (GE Healthcare) operated at a data collection frequency of 10 Hz; i.e. a temporal resolution of 0.1 s. Streptactin XT (IBA Lifesciences) was chemically coupled via amine coupling chemistry onto CM5 chips to a response unit (RU) level of 5000 RU. Then, OneStrep-tagged rat GluN1a-GluN2B heterotetrameric NMDA receptor (NMDAR) was captured to a level of 5000 RU. SPR running buffer composition was 200 mM NaCl, 20 mM HEPES pH 7.4, 10 mM Glycine, 10 mM Glutamate, 3mM CaCl2, 0.010% LMNG. For the interaction with NL1(–A–B)ECTO, a single-cycle kinetics (SCK) approach was adopted. Injection of 5 concentrations of NL1(–A–B)ECTO, prepared in a two-fold dilution series from a 25 μM stock concentration, was performed in order of increasing concentration. Each sample was injected for 120 s at a flow rate of 25 μL/min, followed by a 60 s intermittent dissociation phase or a final 600 s dissociation phase.

Isothermal titration calorimetry (ITC)

Calorimetric measurements were carried out using samples purified by SEC in HBS-C buffer (10 mM HEPES pH 7.50, 150 mM sodium chloride and 3 mM calcium chloride). Experiments were carried out using a VP-ITC MicroCalorimeter (GE Healthcare) at 295 K, and data were analyzed using the Origin ITC analysis software package. Titrations were always preceded by an initial injection of 3 μL and were carried out using sequential 10 μL injections with continuous stirring. The data were fitted to the “one binding site model” and apparent molar reaction enthalpy (ΔH°), apparent entropy (ΔS°), association constant (KA), and binding stoichiometry (N) was determined.

Analytical ultracentrifugation (AUC)

Sedimentation velocity (SV) experiments were performed using a Beckman Optima XL-I analytical centrifuge operated at a run temperature of 293K. Human MDGA1ECTO was concentrated to 60 μM (6.31 g/L) in TBS-CT buffer. Samples were held in Epon sector-shaped 2-channel centerpieces (6 mm path length) and were spun at 40,000 rpm. 200 sample distribution scans were taken incrementally, spaced 4 min apart. Data were collected using 280 nm absorbance optics. Data were analyzed using the program Sedfit (Brown and Schuck, 2006). Scans 7-200 were used in the continuous c(s) distribution analysis. Analysis was performed with a floating frictional ratio and baseline, SMIN = 0.0, SMAX = 20, and a resolution value of 100. A value of 0.73 mL/g was used for the partial specific volumes. A buffer density value of 1.00527 g/cm3 and buffer viscosity value of 0.01022 Poise was calculated using the Sednterp online application. Figures were prepared using the program GUSSI (Brautigam, 2015).

Co-culture and immunocytochemistry

Constructs of the native, full-length (FL) human MDGA1 (Gln19-Arg955), and human MDGA2 (Gln21-Arg956), fused N-terminally with a HA epitope tag, and without C-terminal tags (yielding HA-MDGA1-2FL), were cloned into the pHLsec vector (Aricescu et al., 2006b). Constructs of the full-length human NL1 (–A ± B, –A ± B_Asn300Gln, ΔSite I, ΔSite II, ΔSite I+II, –A–B_Arg450Cys; Gln46-Val840), human NL2 (–A; Glu38-Val835), human NL3 (–A, –A_Arg451Cys; Gln38-Val848), and human NL4 (NL4(X); Gln42-Val816), fused N-terminally with a Myc epitope tag and fused C-terminally with ECFP (enhanced cyan fluorescent protein; yielding myc-NL1-4FL), were cloned into the pHLsec vector (Aricescu et al., 2006b). NL1(–A–B)FL_Arg450Cys and NL3(–A)FL_Arg451Cys used native signal sequences and were not C-terminally fused to ECFP, to avoid the potential impact of these modifications on surface trafficking of the mutants. Low density primary hippocampal cultures were prepared from E18 rat embryos as previously described (Kaech and Banker, 2006) and as approved by the University of British Columbia Animal Care Committee. Neuron cultures were maintained in Neurobasal (NB) medium (Thermo Fisher Scientific) supplemented with GlutaMAX-I (Thermo Fisher Scientific), B-27 supplement (Thermo Fisher Scientific) and 100 μM APV (Abcam). COS-7 cells were cultured in DMEM supplemented with 10% bovine growth serum and 100 I.U./mL penicillin-streptomycin. Cells were transfected using TransIT-LT1 transfection reagent (Mirus Bio) with (i) 0.5 μg myc-NL1-4FL and 1.1 μg HA-CD4, 1.1 μg HA-MDGA1FL, or 1.6 μg HA-MDGA2FL for low ratio experiments; (ii) 0.5 μg myc-NL1-4FL and 1.75 μg HA-CD4, 1.75 μg HA-MDGA1FL, or 2.5 μg HA-MDGA2FL for medium ratio experiments; and (iii) 0.5 μg myc-NL1-4FL and 2.5 μg HA-CD4, 2.5 μg HA-MDGA1FL, or 3.6 μg HA-MDGA2FL for high ratio experiments. HA-MDGA1FL and HA-MDGA2FL plasmid DNA amounts were adjusted to achieve similar surface protein levels. One day post-transfection, COS-7 cells were seeded onto 14 day in vitro (DIV) hippocampal cultures. After 20-24 hr the co-cultures were fixed in 4% paraformaldehyde (PFA) and 4% sucrose in PBS (pH 7.4) for 12 min at room temperature and incubated with blocking solution (3% bovine serum albumin, 5% normal goat serum in PBS) for 30 min at 310K. Surface NLs and MDGAs were labeled by incubating with anti-myc and anti-HA antibodies, respectively, for 1 hr at 310K. The cells were permeabilized with 0.2% Triton X-100 in PBS, blocked for 30 min at 310K and incubated with anti-synapsin1 and anti-tau antibodies overnight at 277K. Secondary antibodies were applied for 30 min at 310K and the coverslips were mounted onto glass slides with elvanol (Tris-HCl, glycerol, and polyvinyl alcohol with 2% 1,4-diazabi-cyclo[2,2,2]octane). The following primary antibodies were used: rabbit polyclonal anti-c-myc (1:1000, Sigma), mouse monoclonal anti-HA (1:1000, IgG2b, clone 12CA5, Roche), mouse monoclonal anti-synapsin1 (1:8000, IgG1, clone 46.1, Synaptic Systems), mouse monoclonal anti-tau1 (1:4000, IgG2a, clone PC1C6, Millipore). The following secondary antibodies were used: goat AMCA-conjugated anti-rabbit (1:400, Jackson ImmunoResearch), goat Alexa Fluor 488-conjugated anti-mouse IgG2b (1:1000, Thermo Fisher Scientific), goat Alexa Fluor 568-conjugated anti-mouse IgG1 (1:1000, Thermo Fisher Scientific), goat Alexa Fluor 647-conjugated anti-mouse IgG2a (1:1000, Thermo Fisher Scientific).

Image acquisition and analysis

Fluorescence microscopy was performed using a Zeiss Axioplan2 microscope. All images were acquired with a 63x oil immersion objective (NA 1.4) using MetaMorph imaging software (Molecular Devices). COS-7 cells with similar levels of both surface myc and HA were chosen for imaging and analysis for each co-culture experiment (Figure S6B). Image acquisition and analysis was performed with the experimenter blind to the experimental condition. Analysis was performed using NIH ImageJ software (Schneider et al., 2012). The total integrated intensity of punctate synapsin staining signal on a COS-7 cell was measured and normalized to the tau-positive axon contacting area. Cell surface levels of NLs and MDGAs were quantified by measuring mean intensity of myc and HA staining, respectively, on cells. Post-analysis images were adjusted for brightness and contrast across the entire image for presentation. Statistical analysis was performed using GraphPad Prism software. One-way ANOVA with post hoc Bonferroni multiple comparison test was used and statistical significance was set at p < 0.05. All data are presented as mean ± SEM from three independent experiments. Statistics are presented in Tables S3–S5.

Surface expression of the NL3(–A) Arg451Cys mutant

Constructs of full-length (Gln38-Val848) wild-type human NL3(–A) and mutant NL3(–A) Arg451Cys, fused N-terminally to a Myc and V5 epitope tag, were cloned into the pCAGGS vector, generating pCAGGS-myc-V5-NL3(WT) and pCAGGS-myc-V5-NL3(R451C). Both constructs used native signal sequences and were not C-terminally fused to ECFP. Low density primary hippocampal cultures were prepared from E18 rat embryos as previously described (Kaech and Banker, 2006). Neuron cultures were maintained in Neurobasal (NB) medium (Thermo Fisher Scientific) supplemented with GlutaMAX-I (Thermo Fisher Scientific), B-27 supplement (Thermo Fisher Scientific) and 100 μM APV (Abcam). Cells were transfected by nucleofection using 2 μg of plasmid DNA and were then plated on coverglasses. After 3 days in vitro (DIV) the neurons were fixed in 4% paraformaldehyde (PFA) and 4% sucrose in PBS (pH 7.4) for 12 min at room temperature and incubated with blocking solution (3% bovine serum albumin, 5% normal goat serum in PBS) for 30 min at 310K. Surface NL3 was labeled by incubating with anti-V5 antibody overnight at 277K. The cells were permeabilized with 0.2% Triton X-100 in PBS, blocked for 30 min at 310K and incubated with anti-myc antibody overnight at 277K. The following primary antibodies were used: rabbit polyclonal anti-c-myc (1:1000, Sigma) and mouse monoclonal anti-V5 (1:1000, IgG2a, Thermo Fisher). The following secondary antibodies were used: goat Alexa Fluor 488-conjugated anti-rabbit (1:1000, Thermo Fisher Scientific) and goat Alexa Fluor 647-conjugated anti-mouse IgG2a (1:1000, Thermo Fisher Scientific). Fluorescence microscopy was performed using a Zeiss Axioplan2 microscope. All images were acquired using MetaMorph imaging software (Molecular Devices) and with a 10x air objective to capture the entire neuron in one field of view. The neurons were visualized using the 488 channel for myc and 647 channel for V5.

Pulldown and mass spectrometry

Affinity chromatography was performed as previously described (Savas et al., 2014). Briefly, for each MDGA-Fc bait protein, five P21 rat brains were homogenized in homogenization buffer (4 mM HEPES, 0.32 M sucrose) with protease inhibitors using a glass Dounce homogenizer. Homogenates were centrifuged at 1,000 g for 15 min at 277 K. Supernatants were centrifuged again at 1000 g for 15 min. The resulting supernatants were then centrifuged at 10,000 g for 20 min. The pellet P2, containing crude synaptosomes, was resuspended in homogenization buffer and centrifuged at 10,000 g for 20 min, yielding pellet P2′ that contained washed crude synaptosomes. Pellet P2′ was extracted in 20 mM Tris pH 8.0, 0.1 mM CaCl2 and 1% (w/v) Triton X-100 for 2 hr at 277 K. Extracts were centrifuged at 10,000 g for 30 min and the supernatants were diluted 1:1 with extraction buffer. Protein A beads (Pierce, 250 μL slurry) bound to 100 μg human Fc control protein or MDGA1-, MDGA1ΔIg1-3, or MDGA2-Fc proteins were added and rotated O/N at 277 K. Beads were packed into Poly-Prep chromatography columns (BioRad) and washed with 50 mL of high-salt wash buffer (50 mM HEPES pH 7.4, 300 mM NaCl, 0.1 mM CaCl2, 5% glycerol and protease inhibitors), followed by a wash with 10 mL low-salt wash buffer (50 mM HEPES pH 7.4, 150 mM NaCl, 0.1 mM CaCl2, 5% glycerol and protease inhibitors). Bound proteins were eluted from the beads by incubation with Pierce elution buffer and TCA precipitated overnight. For the MS analysis, we required each protein to have two peptide matches and each peptide to have at least 1 tryptic terminus and an overall protein false discovery rate (FDR) < 1.2% for each dataset. Proteins shown in Figure S5B and Table S2 are the complete set of proteins found in both MDGA1- or MDGA2-Fc purifications after removing background proteins identified in Fc negative control purifications. Only proteins identified with two or more spectral counts were included in the analysis.

Data and Software Availability

The accession number for the crystal structure of human NL1(–A+B)ECTO reported in this paper is PDB: 5OJK. The accession number for the crystal structure of chicken MDGA1ECTO reported in this paper is PDB: 5OJ2. The accession number for the crystal structure of the complex between human NL1(–A–B)ECTO and chicken MDGA1ECTO reported in this paper is PDB: 5OJ6.

Author Contributions

All authors contributed to experimental design. J.E., A.J.C., C.H., W.J., and A.C.S. produced constructs and recombinant proteins. A.J.C. and J.E. performed crystallization experiments. J.E., A.J.C., and A.R.A. collected X-ray data and solved the crystal structures. J.E. performed the biophysical experiments. V.C. performed the co-culture and immunocytochemistry experiments. K.M.V., S.N.S., J.N.S., and J.d.W. performed mass spectrometry and pull-down experiments. M.C.R. and H.F. produced the NMDAR samples. J.B., A.M.C., and A.R.A. directed research. J.E. wrote the manuscript, with input from V.C., A.M.C., and A.R.A. All authors provided feedback on the final manuscript version.
REAGENT or RESOURCESOURCEIDENTIFIER
Antibodies

Anti-c-myc, rabbit polyclonalSigma-AldrichCat# C3956; RRID: AB_439680
Anti-HA, mouse monoclonal IgG2bRocheCat# 11583816001; RRID: AB_514505
Anti-synapsin1, mouse monoclonal IgG1Synaptic SystemsCat # 106011
Anti-tau, mouse monoclonal IgG2aMilliporeCat# MAB3420; RRID: AB_94855
Anti-V5, mouse monoclonal IgG2aThermo FisherCat# R960-25; RRID: AB_2556564
AMCA goat anti-rabbit IgG (H+L)Jackson ImmunoResearchCat# 111-155-144; RRID: AB_2337994
Alexa Fluor 488 goat anti-rabbit IgG (H+L)Thermo FisherCat# R37116; RRID: AB_2556544
Alexa Fluor 488 goat anti-mouse IgG2bThermo FisherCat# A-21141; RRID: AB_2535778
Alexa Fluor 568 goat anti-mouse IgG1Thermo FisherCat# A-21124; RRID: AB_2535766
Alexa Fluor 647 goat anti-mouse IgG2aThermo FisherCat# A-21241; RRID: AB_2535810
Streptavidin-HRP conjugateSigma-AldrichCat# GERPN1231

Chemicals, Peptides, and Recombinant Proteins

Neurobasal MediumThermo FisherCat# 21103049
GlutaMAXThermo FisherCat# 35050061
B27 serum-free supplementThermo FisherCat# 17504044
APVAbcamCat# ab120271
Dulbecco’s Modified Eagle Medium, high glucoseSigma-AldrichCat# D5796
Dulbecco’s Modified Eagle Medium, high glucose, no L-MethionineSigma-AldrichCat# D0422
Bovine growth serumGE HealthcareCat# SH30541.03
Penicillin/streptomycinThermo FisherCat# 15070063
TransIT-LT1 transfection reagentMirus BioCat# MIR2305
Pyrobest DNA PolymeraseTakaraCat# R005A
Seleno-L-MethionineSigma-AldrichCat# S3132
D-biotinSigma-AldrichCat# B4639
StreptavidinSigma-AldrichCat# S4762
Bovine serum albuminSigma-AldrichCat# A7638
Polyethylenimine, branchedSigma-AldrichCat# 408727
Ammonium bicarbonateSigma-AldrichCat# 09830
UreaThermo ScientificCat# 29700
Tris(2-carboxyethyl)phosphine hydrochloride (TCEP)Sigma-AldrichCat# C4706
IodoacetamideSigma-AldrichCat# I1149
Pierce Trypsin Protease, MS GradeThermo ScientificCat# 90057
ProteaseMAX Surfactant, Trypsin EnhancerPromegaCat# V2072
Formic Acid Optima LC/MSThermo FisherCat# A117
Trifluoroacetic Acid (TFA)Thermo FisherCat# O4902
Acetonitrile Optima LC/MSThermo FisherCat# A955

Deposited Data

hNL1(–A+B)ECTOThis paperPDB: 5OJK
cMDGA1ECTOThis paperPDB: 5OJ2
hNL1ECTO–cMDGA1ECTOThis paperPDB: 5OJ6

Experimental Models: Cell Lines

COS-7ATCCCat# CRL-1651; RRID: CVCL_0224
HEK293TATCCCat# CRL-3216; RRID: CVCL_0063
HEK293S GnTI−/−ATCCCat# CRL-3022; RRID: CVCL_A785

Experimental Models: Organisms/Strains

Sprague Dawley rat, female timed pregnant d18Charles River CanadaStrain code 400

Software and Algorithms

MetaMorphMolecular Deviceshttps://www.moleculardevices.com/systems/metamorph-research-imaging/metamorph-microscopy-automation-and-image-analysis-software
ImageJSchneider et al., 2012https://imagej.nih.gov/ij/download.html
GraphPad PrismGraphPad Softwarehttp://www.graphpad.com/scientific-software/prism/
SHELXDSchneider and Sheldrick, 2002http://shelx.uni-ac.gwdg.de/SHELX/
PhenixAdams et al., 2010https://www.phenix-online.org/
XIA2Winter et al., 2013http://xds.mpimf-heidelberg.mpg.de/
PISAKrissinel and Henrick, 2007http://www.ebi.ac.uk/pdbe/pisa/
IntervorLoriot and Cazals, 2010N/A
CootEmsley et al., 2010http://www2.mrc-lmb.cam.ac.uk/personal/pemsley/coot/
PyMOLSchrodinger, 2010https://www.pymol.org/
BLASTAltschul et al., 1990https://blast.ncbi.nlm.nih.gov/
MUSCLEEdgar, 2004http://www.ebi.ac.uk/Tools/msa/muscle/
ALINEBond and Schüttelkopf, 2009http://bondxray.org/software/aline.html
ConsurfAshkenazy et al., 2010http://consurf.tau.ac.il/2016/
ATSASPetoukhov et al., 2012https://www.embl-hamburg.de/biosaxs/software.html
ScÅtterRambo and Tainer, 2013http://www.bioisis.net/
SWISS-MODELBiasini et al., 2014https://swissmodel.expasy.org/
MODELERWebb and Sali, 2014https://salilab.org/modeller/
UCSF CHIMERAPettersen et al., 2004https://www.cgl.ucsf.edu/chimera/
AllosMod-FoXSGuttman et al., 2013http://modbase.compbio.ucsf.edu/allosmod-foxs/
Scrubber2BioLogic Softwarehttp://www.biologic.com.au/
BIAevaluationGE Healthcarehttps://www.biacore.com/
Origin ITCMalvernhttps://www.malvern.com/en/
SedfitBrown and Schuck, 2006http://www.analyticalultracentrifugation.com/default.htm
GUSSIBrautigam, 2015http://biophysics.swmed.edu/MBR/software.html
Integrated Proteomics PipelineSavas et al., 2014http://www.integratedproteomics.com/

Other

HisTrap FFGE HealthcareCat# 17-5255-01
Superdex 16/60 200 PG HiLoadGE HealthcareCat# 28989335
QuixStandGE HealthcareCat# 56-4107-78
Biacore T200GE HealthcareCat# 28975001
Sensor Chip CM5GE HealthcareCat# BR100012
EASY-nLC 1000 Liquid ChromatographThermo ScientificCat# LC120
Orbitrap Fusion Tribrid Mass SpectrometerThermo ScientificCat# IQLAAEGAAPFADBMBCX
Acclaim PepMap 100 75 um x 2 cm nanoViperThermo ScientificCat# 164946
Acclaim PepMap RSLC 75 um x 50 cm nanoViperThermo ScientificCat# 164942
  103 in total

1.  Substructure solution with SHELXD.

Authors:  Thomas R Schneider; George M Sheldrick
Journal:  Acta Crystallogr D Biol Crystallogr       Date:  2002-09-28

2.  Semi-automated microseeding of nanolitre crystallization experiments.

Authors:  Thomas S Walter; Erika J Mancini; Jan Kadlec; Stephen C Graham; René Assenberg; Jingshan Ren; Sarah Sainsbury; Raymond J Owens; David I Stuart; Jonathan M Grimes; Karl Harlos
Journal:  Acta Crystallogr Sect F Struct Biol Cryst Commun       Date:  2007-12-20

3.  Neuroligin-4 is localized to glycinergic postsynapses and regulates inhibition in the retina.

Authors:  Mrinalini Hoon; Tolga Soykan; Björn Falkenburger; Matthieu Hammer; Annarita Patrizi; Karl-Friedrich Schmidt; Marco Sassoè-Pognetto; Siegrid Löwel; Tobias Moser; Holger Taschenberger; Nils Brose; Frédérique Varoqueaux
Journal:  Proc Natl Acad Sci U S A       Date:  2011-01-31       Impact factor: 11.205

4.  MDGAs interact selectively with neuroligin-2 but not other neuroligins to regulate inhibitory synapse development.

Authors:  Kangduk Lee; Yoonji Kim; Sung-Jin Lee; Yuan Qiang; Dongmin Lee; Hyun Woo Lee; Hyun Kim; H Shawn Je; Thomas C Südhof; Jaewon Ko
Journal:  Proc Natl Acad Sci U S A       Date:  2012-12-17       Impact factor: 11.205

5.  γ-Protocadherins Interact with Neuroligin-1 and Negatively Regulate Dendritic Spine Morphogenesis.

Authors:  Michael J Molumby; Rachel M Anderson; Dillan J Newbold; Norah K Koblesky; Andrew M Garrett; Dietmar Schreiner; Jason J Radley; Joshua A Weiner
Journal:  Cell Rep       Date:  2017-03-14       Impact factor: 9.423

6.  Features and development of Coot.

Authors:  P Emsley; B Lohkamp; W G Scott; K Cowtan
Journal:  Acta Crystallogr D Biol Crystallogr       Date:  2010-03-24

7.  Crystal structure of a heterotetrameric NMDA receptor ion channel.

Authors:  Erkan Karakas; Hiro Furukawa
Journal:  Science       Date:  2014-05-30       Impact factor: 47.728

8.  Characterization of the interaction of a recombinant soluble neuroligin-1 with neurexin-1beta.

Authors:  Davide Comoletti; Robyn Flynn; Lori L Jennings; Alexander Chubykin; Takehito Matsumura; Hana Hasegawa; Thomas C Südhof; Palmer Taylor
Journal:  J Biol Chem       Date:  2003-09-30       Impact factor: 5.157

9.  Molecular analysis of receptor protein tyrosine phosphatase mu-mediated cell adhesion.

Authors:  Alexandru Radu Aricescu; Wai-Ching Hon; Christian Siebold; Weixian Lu; Philip Anton van der Merwe; Edith Yvonne Jones
Journal:  EMBO J       Date:  2006-02-02       Impact factor: 11.598

Review 10.  Validation of macromolecular flexibility in solution by small-angle X-ray scattering (SAXS).

Authors:  Michal Hammel
Journal:  Eur Biophys J       Date:  2012-05-26       Impact factor: 1.733

View more
  21 in total

Review 1.  A negative regulator of synaptic development: MDGA and its links to neurodevelopmental disorders.

Authors:  Rui Wang; Jia-Xian Dong; Lu Wang; Xin-Yan Dong; Eitan Anenberg; Pei-Fang Jiang; Ling-Hui Zeng; Yi-Cheng Xie
Journal:  World J Pediatr       Date:  2019-04-17       Impact factor: 2.764

Review 2.  NLGN1 and NLGN2 in the prefrontal cortex: their role in memory consolidation and strengthening.

Authors:  Aaron Katzman; Cristina M Alberini
Journal:  Curr Opin Neurobiol       Date:  2017-12-23       Impact factor: 6.627

3.  Specific factors in blood from young but not old mice directly promote synapse formation and NMDA-receptor recruitment.

Authors:  Kathlyn J Gan; Thomas C Südhof
Journal:  Proc Natl Acad Sci U S A       Date:  2019-06-03       Impact factor: 11.205

Review 4.  Transcellular Nanoalignment of Synaptic Function.

Authors:  Thomas Biederer; Pascal S Kaeser; Thomas A Blanpied
Journal:  Neuron       Date:  2017-11-01       Impact factor: 17.173

5.  Alternative Splicing of Presynaptic Neurexins Differentially Controls Postsynaptic NMDA and AMPA Receptor Responses.

Authors:  Jinye Dai; Jason Aoto; Thomas C Südhof
Journal:  Neuron       Date:  2019-04-17       Impact factor: 17.173

6.  MDGAs are fast-diffusing molecules that delay excitatory synapse development by altering neuroligin behavior.

Authors:  Mathieu Letellier; Giorgia Bimbi; Daniel Choquet; Olivier Thoumine; Andrea Toledo; Béatrice Tessier; Sophie Daburon; Alexandre Favereaux; Ingrid Chamma; Kristel Vennekens; Jeroen Vanderlinden; Matthieu Sainlos; Joris de Wit
Journal:  Elife       Date:  2022-05-09       Impact factor: 8.713

7.  The Ig-like domain of Punctin/MADD-4 is the primary determinant for interaction with the ectodomain of neuroligin NLG-1.

Authors:  Semeli Platsaki; Xin Zhou; Bérangère Pinan-Lucarré; Vincent Delauzun; Haijun Tu; Pascal Mansuelle; Patrick Fourquet; Yves Bourne; Jean-Louis Bessereau; Pascale Marchot
Journal:  J Biol Chem       Date:  2020-09-14       Impact factor: 5.157

8.  SPARCL1 Promotes Excitatory But Not Inhibitory Synapse Formation and Function Independent of Neurexins and Neuroligins.

Authors:  Kathlyn J Gan; Thomas C Südhof
Journal:  J Neurosci       Date:  2020-09-24       Impact factor: 6.167

Review 9.  Synaptic Neurexin Complexes: A Molecular Code for the Logic of Neural Circuits.

Authors:  Thomas C Südhof
Journal:  Cell       Date:  2017-11-02       Impact factor: 41.582

10.  Lentiviral transduction of mammalian cells for fast, scalable and high-level production of soluble and membrane proteins.

Authors:  Jonathan Elegheert; Ester Behiels; Benjamin Bishop; Suzanne Scott; Rachel E Woolley; Samuel C Griffiths; Eamon F X Byrne; Veronica T Chang; David I Stuart; E Yvonne Jones; Christian Siebold; A Radu Aricescu
Journal:  Nat Protoc       Date:  2018-12       Impact factor: 13.491

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.