Literature DB >> 28469554

Physiological Functions of the β-Site Amyloid Precursor Protein Cleaving Enzyme 1 and 2.

Riqiang Yan1.   

Abstract

BACE1 was discovered as the β-secretase for initiating the cleavage of amyloid precursor protein (APP) at the β-secretase site, while its close homology BACE2 cleaves APP within the β-amyloid (Aβ) domain region and shows distinct cleavage preferences in vivo. Inhibition of BACE1 proteolytic activity has been confirmed to decrease Aβ generation and amyloid deposition, and thus specific inhibition of BACE1 by small molecules is a current focus for Alzheimer's disease therapy. While BACE1 inhibitors are being tested in advanced clinical trials, knowledge regarding the properties and physiological functions of BACE is highly important and this review summarizes advancements in BACE1 research over the past several years. We and others have shown that BACE1 is not only a critical enzyme for testing the "Amyloid Hypothesis" associated with Alzheimer's pathogenesis, but also important for various functions such as axon growth and pathfinding, astrogenesis, neurogenesis, hyperexcitation, and synaptic plasticity. BACE2 appears to play different roles such as glucose homeostasis and pigmentation. This knowledge regarding BACE1 functions is critical for monitoring the safe use of BACE1 inhibitors in humans.

Entities:  

Keywords:  Alzheimer’s disease; BACE substrates; BACE1; BACE2; amyloid plaques; amyloid precursor protein; aspartic protease; secretase

Year:  2017        PMID: 28469554      PMCID: PMC5395628          DOI: 10.3389/fnmol.2017.00097

Source DB:  PubMed          Journal:  Front Mol Neurosci        ISSN: 1662-5099            Impact factor:   5.639


Introduction

For over 30 years, the study of β-amyloid (Aβ) peptides has been the largest field of research geared toward understanding Alzheimer’s pathogenesis and therapeutic intervention. After the molecular cloning of amyloid precursor protein (APP; Kang et al., 1987; Tanzi et al., 1987), it became clear that Aβ is a small fragment of APP that is located in the region partially spanning the transmembrane (TM) domain. The excision of Aβ from APP requires the sequential cleavage of APP by both β- and γ-secretase. In 1999, four groups independently reported identification of membrane-anchored aspartic protease as the β-secretase (Hussain et al., 1999; Sinha et al., 1999; Vassar et al., 1999; Yan et al., 1999), while the γ-secretase consists of presenilin-1 or -2, which forms a complex with additional multi-TM proteins nicastrin, pen2, and Aph1 (De Strooper et al., 1998; Wolfe et al., 1999; Li et al., 2000; Yu et al., 2000; Francis et al., 2002). After initial discovery, the β-secretase was named as BACE1, meaning β-site APP converting enzyme (Vassar et al., 1999). For the past 17 years, extensive efforts have been focused on the development of compounds that specifically inhibit BACE1 activity for Alzheimer’s disease (AD) therapy, and several major hurdles of producing brain-penetrable small molecular inhibitors have been overcome. Several highly potent BACE1 inhibitors have been developed by pharmaceutical and biotech companies and have been advanced to phase II/III clinical trials (see reviews by Ghosh and Osswald, 2014; Oehlrich et al., 2014; Vassar, 2014; Yan, 2016). Concurrently, BACE1 has also been shown to cleave multiple membrane substrates and its physiological roles in neuronal functions continue to be revealed (Vassar et al., 2014; Yan and Vassar, 2014; Hu et al., 2015a; Barao et al., 2016). Because of the importance of BACE1 inhibitors for therapeutic benefits in AD, this review will focus on summarizing the growing body of knowledge regarding the biological functions of BACE1.

Bace1 is a Typical Aspartic Protease

In the initial molecular cloning of β-secretase, the Pharmacia group was exploring whether an aspartic protease functions as such a secretase (Yan et al., 1999). Two other groups had also screened for β-secretase activity through their aspartic protease collections (Hussain et al., 1999; Lin et al., 2000). Independently, all five groups demonstrated that the β-secretase is a type I TM aspartic protease having a classical bilobal structure with two active aspartate motifs (D93TG and D289SG). Although not broadly cited, this enzyme was also named to be memapsin 2 based on the standard nomenclature for aspartic proteases (Lin et al., 2000). The crystal structure of BACE1 shows gross similarity to other aspartic proteases, but the catalytic pocket is more open and less hydrophobic than that of other human aspartic proteases (Hong et al., 2000). BACE1 is synthesized in the endoplasmic reticulum (ER) as a precursor protein having pre- (residues 1–21), pro- (residues 22–45), core protease- (residues 46–460), TM- (residues 461–477), and C-terminal domains (residues 478–501). BACE2 has 518 amino acids and almost identical structural organization (Figure ). Both proteins share 59% identity and are two known aspartic proteases docked on the membrane through the type I TM domain (Hussain et al., 1999; Yan et al., 1999; Bennett et al., 2000; Lin et al., 2000). In the aspartic protease family, the prodomain usually assists in protein folding (Baker et al., 1993) and can flip to block the active pocket by conferring zymogen-like properties (Khan and James, 1998). Therefore, this prodomain is normally removed by furin-like proprotein convertases during maturation in the Golgi compartment to produce active enzyme. Interestingly, this prodomain has weak inhibitory effects and proBACE1 is enzymatically active (Shi et al., 2001). Consistent with this, BACE1 is active in the ER compartment (Yan et al., 2001a). While inhibiting prodomain removal has a weak effect on blocking BACE1 activity, enhancing shedding of BACE1 near the ectodomain region impacts its cleavage of APP. It is known that docking on the lipid bilayer is essential for BACE1 to cleave APP at the β-secretase site, as removing this TM domain abolishes cleavage of APP at the β-secretase site in cells (Yan et al., 2001a). This is consistent with observations that many soluble aspartic proteases cleave APP peptides at the β-secretase site in vitro, but not in vivo (Brown et al., 1996; Chevallier et al., 1997; Mackay et al., 1997; Gruninger-Leitch et al., 2000; Turner et al., 2002; Tomasselli et al., 2003). Schematic illustration of BACE1 and BACE2 structural organizations. Both BACE1 and BACE2 are type I transmembrane aspartic proteases, which have similar in length and 59% identify in the amino acid level. Both proteins are cleaved by furin to become mature form. BACE1 is also palmitoylated at C474, C478, C482, and C485; ubiquitinated at K501. Multiple lysine residues are suggested to be acetylated. BACE1 also undergoes other multiple post-translational modifications: it is N-glycosylated on four sites (N-153, N-172, N-223, and N254; Haniu et al., 2000), acetylated on seven Lys residues (Lys-126, Lys-275, Lys-279, Lys-285, Lys-299, Lys-300, and Lys-307) in the ER (Costantini et al., 2007), ubiquitinated at Lys-501 for the control of endocytosis to lysosomes for degradation (Tesco et al., 2007; Kang et al., 2012) and at Lys-203 and Lys-382 for the proteasomal degradation of BACE1 (Wang R. et al., 2012), palmitoylated in four C-terminal Cys residues (Cys474/478/482/485) for lipid raft localization (Benjannet et al., 2001; Vetrivel et al., 2009; Bhattacharyya et al., 2013), and phosphorylated at Ser-498 (Walter et al., 2001), which is linked to BACE1 cellular trafficking (Pastorino et al., 2002; He et al., 2005). Phosphorylation of BACE1 at Thr252 by the p25/Cdk5 complex appears to increase BACE1 activity (Song et al., 2015). A recent study suggests that glycol modifications of BACE1 by N-acetylglucosamine (GlcNAc), a sugar-bisecting enzyme highly expressed in brain, regulates BACE1 stability (Kizuka et al., 2015). Loss of GlcNAc will lead to enhanced degradation of BACE1 by increased trafficking of BACE1 to lysosomes from the late endosomes. This is reminiscent of deubiquitinylation by ubiquitin-specific peptidase 8 (USP8), an endosome-associated deubiquitinating enzyme. Studies have shown that RNAi-mediated depletion of USP8 increased BACE1 ubiquitination on Lys-501, promoted BACE1 accumulation in the early endosomes and late endosomes/lysosomes, and decreased levels of BACE1 in the recycling endosomes (Yeates and Tesco, 2016). It should be noted that most post-translational modifications, except for the disulfide linkage, can regulate BACE1 activity but are not necessary for BACE1 proteolytic activity per se, as recombinant BACE1 produced in bacteria lacks these modifications but is sufficiently active.

Cellular Trafficking of Bace1

BACE1 is first synthesized in the ER and then is distributed to various cellular compartments such as the Golgi network, endosomes, and cell surface, where the luminal BACE1 catalytic domain will cleave its cellular substrates such as APP. Like other aspartic proteases, the catalytic activity of BACE1 is elevated in more acidic environments (Shimizu et al., 2008). Because of this preferential activation, altered localization or cellular trafficking of BACE1 in cellular compartments impacts generation of Aβ from the cleavage of APP (Vassar et al., 2009). Several proteins have now been shown to bind BACE1 and to alter cellular localization. Golgi-localized γ-ears containing proteins from the ADP ribosylation factor-binding (GGA) family were first shown to bind to BACE1 via the dileucine motif, and this binding impacts not only BACE1 endosomal trafficking but also cellular stability (He et al., 2002, 2005; Wahle et al., 2005; Tesco et al., 2007; Santosa et al., 2011; Walker et al., 2012; von et al., 2015). Depletion of both GGA1 and GGA3 induces a rapid and robust elevation of BACE1, and such an effect is likely inhibited by flotillin, which can compete with GGA proteins for binding to the same dileucine motif in the BACE1 tail (John et al., 2014). Reticulon (RTN) proteins, mainly localized in the ER, have been shown to bind BACE1 and this binding induces retention of BACE1 in the ER, which has a relatively neutral pH environment and thus is less favorable for APP cleavage by BACE1 (Sharoar and Yan, 2017). On the other hand, increased trafficking of BACE1 to the more acidic endosomes by cellular trafficking proteins such as the Vps10p domain-sorting receptor sortilin (Finan et al., 2011), the small GTPase ADP ribosylation factor 6 (ARF6; Sannerud et al., 2011), Rab-GTPases Rab11 (Udayar et al., 2013), and Sorting nexin 12 (Zhao et al., 2012) results in significant increases in Aβ generation. In neurons, BACE1 is also targeted to axons and presynaptic terminals (Kandalepas et al., 2013) and its axonal transport is regulated by altered levels of calsyntenin-1 (Steuble et al., 2012; Vagnoni et al., 2012), retromer vps35 (Wen et al., 2011; Wang C.L. et al., 2012), RTN3 (Deng et al., 2013), Rab11 and Eps15 homology domain proteins (Buggia-Prevot et al., 2013, 2014; Udayar et al., 2013). The enhanced localization of BACE1 at synaptic sites is suggested to increase release of Aβ by the synaptic terminals and directly facilitates amyloid deposition in AD patients (Sadleir et al., 2016).

Identified Bace1 Substrates

BACE1 cleaves many cellular substrates other than APP, so its biological functions will be affected by altered cleavage of these substrates. Various biochemical and proteomic approaches have been employed to search for BACE1 substrates. Initially, optimal BACE1 cleavage sites were explored (Gruninger-Leitch et al., 2002; Turner et al., 2002; Tomasselli et al., 2003), but this effort together with the use of bioinformatic tools was not successful in determining potential substrates. Instead, several BACE1 substrates were identified through candidate-based characterizations. For example, neuregulin-1 (Nrg1) was identified via the finding that BACE1 plays a role in regulating myelination (Hu et al., 2006; Willem et al., 2006). Using unbiased proteomic analysis of cultured media from cell lines with or without overexpression of BACE1, Selkoe and his colleagues reported 68 putative BACE1 substrates (Hemming et al., 2009). By using the developed secretome protein enrichment with click sugars (SPECS) method, Lichtenthaler and his colleagues identified 34 membrane-associated proteins as potential BACE1 substrates (Kuhn et al., 2012). This group has also compared cerebrospinal fluids from BACE1-null vs. wild-type mice using label-free quantitative proteomics, and they identified additional novel substrates while validating several previously reported substrates (Dislich et al., 2015). Among these reported BACE1 substrates, the proteins listed in Table have gained the most attention and/or are fully validated. Partial list of characterized BACE1 substrates.

Biological Functions Attributable To Bace1-Cleavable Substrates

As outlined above, the list of BACE1 substrates has grown in recent years (Table ). It is highly important to understand the biological functions associated with BACE1 cleavage of these individual substrates. The following sections summarize studies on this topic that have been published in recent years.

Astrogenesis and Neurogenesis

BACE1 was found to cleave Jagged-1 (Jag1), a type I TM ligand for Notch receptors (Hu et al., 2013). BACE1 mainly cleaves Jag1 at the A1050–A1051 site near the TM domain (He et al., 2014), and abolished cleavage in BACE1-null mice causes elevation of full-length Jag1, which in turn enhances Notch activation by producing high levels of Notch intracellular domain (NICD; Hu et al., 2013). Notch is highly expressed during neonatal stages and then gradually declines, with persistent low levels of expression in adulthood. BACE1 and Jag1 expression concurrently have the exact same patterns: high levels in neonatal stages and gradual reduction thereafter. Such parallel expression patterns in early developmental stages imply indispensable roles during development. Indeed, BACE1 deficiency causes enhanced astrogenesis and reduced neurogenesis, which is restricted to the hippocampal dentate gyrus (Hu et al., 2013). BACE1 and Jag1 are mainly expressed by pyramidal neurons, while Notch is highly expressed in neural stem cells in the subgranular zone. In earlier studies, high NICD activity was shown to inhibit neurogenesis in the postnatal dentate gyrus and to act as a switch from neurogenesis to gliogenesis (Morrison et al., 2000; Breunig et al., 2007). Hence, it appears that BACE1 regulates Notch signaling, via cleavage of Jag1, to control proliferation and differentiation of multi-potent neural precursor cells into neurons or astrocytes in the early developmental hippocampus.

Myelination and Remyelination

The role of BACE1 in the control of myelination during development and of remyelination in the adult appears to occur through its cleavage of Nrg1 (Fleck et al., 2012; Hu et al., 2015a). Nrg1, which is one of the largest genes in the human genome with 33 spliced isoforms due to specific uses of six different transcriptional initiation sites as well as multiple splicing isoforms, is typically recognized by the presence of exons coding for the epidermal growth factor (EGF)-like domain (Holmes et al., 1992; Chang et al., 1997). Although Nrg1 isoforms with six different membrane topology types are found in the brain, types I and III β1 Nrg1 isoforms are mainly expressed by neurons and have been established as BACE1 substrates (Hu et al., 2006, 2008; Willem et al., 2006; La et al., 2011; Fleck et al., 2013). BACE1 specifically cleaves Nrg1 at the F-M site, which is located 10 residues before the TM domain and is shared by both types I and III β1 isoforms (Hu et al., 2008; La et al., 2011; Fleck et al., 2013). These two Nrg1 isoforms can also be cleaved by ADAM10 and ADAM17 at the F-Y site, which is seven residues upstream of BACE1 cleavage site. After cleavage by either BACE1 or ADAM10/17, type I Nrg1 releases its N-terminal fragment (Nrg1-ntf) to the extracellular space, where Nrg1-ntf binds to ErbB receptors (ErbB2 and ErbB3 heterodimers and ErbB4 homodimers) on nearby cells in a paracrine fashion, while type III Nrg1-ntf, which remains tethered to the lipid bilayer due to a hydrophobic CRD in its N-terminus, signals to adjacent cells in a juxtacrine fashion (Warren et al., 2006). Activated Nrg1 signaling, mainly initiated by type III Nrg1, is critical for optimal myelination: mice with reduced Nrg1 signaling activity exhibit hypomyelination of peripheral nerves during development (Michailov et al., 2004; Taveggia et al., 2005). BACE1-null mice also display hypomyelination in their sciatic nerves, which are typically ensheathed by Schwann cells (Hu et al., 2006; Willem et al., 2006). This phenocopy is not only seen in BACE1-null mice but also in zebrafish (van Bebber et al., 2013) and rat (Weber et al., 2017) knockout (KO) models, and is consistent with reduced Nrg1 activity, which leads to decreased downstream signaling events such as reduced Akt phosphorylation and transcriptional expression of myelin genes like myelin basic proteins. Although type III Nrg1 is abundantly expressed in brain neurons (Liu et al., 2011), it has less effect on entheathing axons in the central nervous system, and both Nrg1 heterozygous mice and BACE1-null mice display weak hypomyelination phenotype in central nerves (Hu et al., 2006; Taveggia et al., 2008). Hypomyelination was observed in BACE1-null optic nerves, but not in broad brain regions of BACE1-null mice (Hu et al., 2006). Interestingly, inhibition of BACE1 produces more dramatic suppression of myelination in a co-culture myelination system than pan inhibition of ADAM proteases (Luo et al., 2011). This is likely related to the presence of an additional BACE1 cleavage site between L-Q, located 16 residues upstream of the EGF-like domain in type III Nrg1 (Fleck et al., 2013). Cleavage of type III Nrg1 at these two BACE1 sites will release the EGF-like domain for signaling through ErbB receptors. This observation further supports the importance of BACE1-dependent Nrg1 signaling in myelination. When peripheral nerves are severely injured, myelin on proximal segments of damaged axons can be removed due to Wallerian degeneration and regrowing axons will be remyelinated by Schwann cells via contacting regenerating axons in the proximal band of Büngner. BACE1 has been shown to be indispensable for remyelination in nerve crush experiments, as remyelinated axons remained hypomyelinated in BACE1-null sciatic nerves (Hu et al., 2008). In nerve transplantation experiments, it has been further demonstrated that nerve injury induces expression of BACE1 in Schwann cells and that this increased expression of BACE1 in Schwann cells is required for remyelination (Hu et al., 2015b). nerve region leads to shortened internode as well as reduced nerve conduction. BACE1 is also required for initial and optimal remyelination of corpus callosum axons, as demonstrated in cuprizone-induced demyelination experiments (Treiber et al., 2012). In peripheral nerves, BACE1 cleavages of type I Nrg1 in Schwann cells and type III Nrg1 in axons contribute to normal remyelination. This conclusion is supported by mouse genetic studies using conditional deletion of Nrg1 isoforms or transgenic mice overexpressing either type I or type III Nrg1 (Fricker et al., 2011, 2013; Stassart et al., 2013). These studies show that Schwann cell-derived type I Nrg1 is dispensable for developmental myelination and myelin maintenance, but is required for an autocrine signaling function for remyelination, as loss of Nrg1 expression in Schwann cells severely impairs remyelination after nerve crush. More recently, it is shown that BACE1 can cleave Jag1 and Delta1 in axons and Schwann cells, and abrogated cleavage of these two Notch ligands enhances Schwann cell proliferation (Hu et al., 2017). This abnormally increased Schwann cell density within the given sciatic Hence, by cleaving types I and III Nrg1 as well as Jag1/Delta1 in different cell types, BACE1 controls these two signaling pathways to regulate optimal myelination and remyelination.

Epileptic Seizures

BACE1-null mice develop convulsive and spontaneous behavioral seizures in an age-dependent manner, beginning at a young age and becoming more frequent with aging (Kobayashi et al., 2008; Hitt et al., 2010; Hu et al., 2010). Long-sustained epileptic seizures in BACE1-null mice likely contribute to neuronal loss in the 2-year-old mouse hippocampus, although neurodegeneration in this region was not evident in young mice (Hu et al., 2010). The molecular mechanism underlying this epileptic seizure activity remains elusive, and cleavages of multiple BACE1 substrates may each contribute. It has been shown that BACE1 cleaves voltage-gated sodium channel β subunits (Kim et al., 2005; Wong et al., 2005; Huth et al., 2011). Voltage-gated sodium channels consist of a heterotrimeric complex of one 260 kDa α-subunit and one or two auxiliary β subunits (Catterall, 2000), and abolished cleavage in BACE1-null mice likely increases surface expression of ion-conducting, channel-forming α-subunits through cellular trafficking (Isom, 2002; Yu et al., 2005). Sodium channel Nav1.2 protein was found to be elevated in BACE1-null hippocampal mossy fiber regions (Hu et al., 2010; Kim et al., 2011). This increase is consistent with greater neuronal excitability, as manifested by more frequent firing with larger amplitude in BACE1-null brain slices and a significant shift of the inactivation curve in the direction of depolarization (Dominguez et al., 2005; Hu et al., 2010). However, the BACE1- and subsequently γ-secretase-cleaved β subunit is also known to enhance gene expression of Nav α subunits (Kim et al., 2007) and BACE1 deficiency will reduce the level of Nav α subunits (Kim et al., 2011). Pharmacological blockage of sodium channel activity was not sufficient to reduce seizure activities (Hitt et al., 2010). Hence, the altered activity of sodium channel activity is unlikely to be the only explanation for seizure activity. BACE1 can also cleave KCNE1 and KCNE2, two auxiliary subunits of voltage-gated potassium channels (Sachse et al., 2013). Both KCNE1 and KCNE2 are expressed in brains and altered functions of these two proteins are linked to epileptic seizures (Goldman et al., 2009; Heron et al., 2010). On the other hand, BACE1 deficiency may cause epilepsy through a none-enzymatic mechanism, as BACE1 interacts with an M-current-producing KCNQ (Kv7) family member, resembling the function of a β-subunit (Hessler et al., 2015). The loss of M-current due to BACE1 deficiency enhances neuronal excitability, which could also contribute to epileptic seizures. Another family of proteins, the seizure-related gene 6 (Sez6) and its family member Sez6L, was identified as BACE1 substrate through an unbiased proteomic approach and was recently validated as a strong substrate of BACE1 (Kuhn et al., 2012). Their levels in BACE1-null CSF are significantly lowered, reflecting the abrogated cleavage by BACE1 (Pigoni et al., 2016). Although Sez6 KO mice have not been shown to have seizures, Sez6 is suggested to be a susceptibility gene for febrile seizures (Mulley et al., 2011). It remains to understand whether the abolished cleavage of Sez6 in BACE1-null mice contributes to epileptic seizures. Taking all of these findings into consideration, it is reasonable to postulate that multiple factors, including epigenetic factors, contribute to epileptic seizures in BACE1-null mice, which display variable spiking patterns on electroencephalography (Hitt et al., 2010; Hu et al., 2010).

Muscle Spindle Defects

Muscle spindles, which are composed of specialized intrafusal muscle fibers, are innervated by afferent axons extending from sensory neurons (Hunt, 1990). Nrg1 in sensory neurons transduces its signals through ErbB2/ErbB3 receptors in muscles to control the formation of muscle spindles (Andrechek et al., 2002; Hippenmeyer et al., 2002; Leu et al., 2003). BACE1 deficiency impairs coordinated muscle function between forelimbs and hindlimbs, resulting in a swaying walking pattern as well as a reduction in the number of muscle spindles (Cheret et al., 2013). Such an ambulatory defect, likely due to dysfunctional proprioception governed by muscle spindles, is more dramatic in newborns while less severe in BACE1-null adult mice or heterozygous mice (Cheret et al., 2013). This role of BACE1 in reduced muscle spindle maintenance is due to abrogated or reduced cleavage of Ig domain-containing type I β1 Nrg1 (IgNrg1β1) isoforms, which are preferentially expressed by proprioceptive sensory neurons and are sufficient to induce muscle spindle differentiation in animals (Hippenmeyer et al., 2002). Consistently, transgenic mice overexpressing IgNrg1β1 develop supernumerary muscle spindles (Rumsey et al., 2008). If wild-type mice are treated with the BACE1 inhibitor Ly2811376 for 29 days, up to 40% of muscle spindles are lost (Cheret et al., 2013). As discussed previously (Hu et al., 2015a), abolished cleavage of Nrg1 reduces the expression of transcription factors in the early growth response (Egr) family. Egr3, in particular, controls expression of the muscle spindle-specific genes necessary for forming muscle spindle fibers. Hence, BACE1-dependent type I IgNrg1β1 signaling is critical for motor coordination.

Axonal Growth and Neuronal Migration Defects

The neural cell adhesion molecule close homolog of L1 (CHL1), which is a type I membrane protein and a component of Sema3A receptors, is a natural BACE1 substrate with identified cleavage sites located between Y1086 and E1087, 18 residues upstream of the TM domain (Kuhn et al., 2012; Zhou et al., 2012). After BACE1 cleavage, which is inducible by Sema3A, CHL1-ntf, and CHL1-ctf are released. The CHL1-ctf appears to induce growth cone collapse in thalamic neurons (Barao et al., 2015), while the soluble CHL1-ntf may interact with neuropilin-1 to influence axon guidance (Hitt et al., 2012; Kuhn et al., 2012; Zhou et al., 2012). BACE1-null mice show axon pathfinding defects with mistargeting olfactory sensory neuron projections to glomeruli in the olfactory bulb and a shortened and disorganized infrapyramidal bundle of the mossy fiber projection from the dentate gyrus to CA3 in the hippocampus (Rajapaksha et al., 2011; Cao et al., 2012; Hitt et al., 2012). It should also be noted that BACE1 and CHL1 are co-localized in the terminals of hippocampal mossy fibers, olfactory sensory neuron axons, and growth cones of primary hippocampal neurons, and that axonal defective phenotypes in BACE1-null mice and CHL1-null mice are correlated, confirming the importance of BACE1 cleavage of CHL1 in neuronal development.

Synaptic Dysfunctions

The effects of BACE1 inhibition on APP- or Aβ-mediated synaptic functions has recently been summarized in a separate review (Yan et al., 2016). As mentioned above, BACE1 can cleave type I Nrg1, which is highly important for synaptic functions through the signaling of ErbB4 receptors in the brain (see recent comprehensive review by Mei and Nave, 2014). More relevantly, Nrg1 has been identified as a susceptible gene in schizophrenia, which is a disease of synaptic dysfunction (Stefansson et al., 2002) and BACE1-null mice display schizophrenia-like behaviors, which include positive (hyperactivity and pre-pulse inhibition), negative (social withdrawal), and panel (cognitive functions) behaviors (Savonenko et al., 2008). In recent years, altered functioning of Nrg3, a member of the Nrg gene family, has also been found in association with schizophrenia pathogenesis. Nrg3 is an identified BACE1 substrate (Hu et al., 2008), further showing the importance of BACE1-dependent Nrg1 signaling functions. While hypo-function of Nrg1 is linked to schizophrenia-like behaviors in BACE1-null mice, enhanced expression of either BACE1-cleaved Nrg1-ntf fragment or of full-length Nrg1 surprisingly also induces schizophrenia-like behaviors (Kato et al., 2010; Luo et al., 2013; Yin et al., 2013; Agarwal et al., 2014). This is in line with clinical observations that increased Nrg1 or ErbB4 transcripts and proteins are found in schizophrenia patients (Harrison and Law, 2006; Geddes et al., 2011), supporting the importance of balanced BACE1-cleaved Nrg1 in synaptic functions. BACE1-null mice also exhibit other synaptic dysfunctions. By electrophysiological recording of brain slices, it was demonstrated that hippocampal activity-dependent long-term potentiation at mossy fibers to CA3 is impaired, while long-term depression is increased (Wang et al., 2008, 2014). Intriguingly, a recent study reported that mice treated with the BACE1 inhibitors SCH1682496 and LY2811376 show impaired cognitive functions (Filser et al., 2015). As the list of identified BACE1 substrates has continued to grow (Hemming et al., 2009; Kuhn et al., 2012; Dislich et al., 2015), many of these potential substrates have been shown to control synaptic plasticity and their roles in BACE1-dependent synaptic functions have begun to gain attention. One such example discussed earlier is Sez6, which has been shown to play a role in synaptic function (Gunnersen et al., 2007). In Sez6 KO mice, dendritic spines are significantly shorted and excitatory synapses are thinner in the deep-layer pyramidal neurons of the somatosensory cortex, showing the importance of Sez6 in forming dendritic arbors and controlling synaptic plasticity. More roles of other BACE1 substrates are likely to emerge over the coming years.

Retinopathy

The role of BACE1 in retinal pathophysiology has gained increasing attention in recent years, as several BACE1 inhibitors have been found to cause retinal thinning, lipofuscin accumulation, and vascular dysfunction, which terminated clinical trials (Fielden et al., 2015). BACE1 was initially suggested to mediate these retinopathies in a report that BACE1-null mice were found to develop retinal thinning, apoptosis, reduced retinal vascular density, and an increase in age pigmentation and lipofuscin (Cai et al., 2012). The mechanism is linked to the BACE cleavage of vascular endothelial growth factor receptor (VEGFR1). However, the retinal phenotypes in BACE1-null mice are controversial and are not seen in all lines of BACE1-null mice or in BACE1-null rat (Fielden et al., 2015), suggesting possible off-target toxicity. While retinopathy is closely monitored in BACE1 inhibitor clinical trials, recent studies have shown that it is likely due to cross-inhibition of cathepsin D by BACE1 inhibitors (Zuhl et al., 2016). Likely, this side effect can be mitigated by developing BACE1 inhibitors with minimal off-target inhibition of other aspartic proteases such as cathepsin D and E, both of which are important in lysosomal functions. On the other hand, specific inhibition of BACE1 is likely to benefit retinal functions, as BACE1 activity in retina is elevated in response to stress conditions such as mitochondrial respiratory inhibition or oxidative stress (Xiong et al., 2007). It has been suggested that changes in BACE1 expression appear earlier in the retina than in the brain and precede behavioral deficits, and abnormal expression of BACE1 in the retina appears to be an early pathological change in APP/PS-1 transgenic mice (Li et al., 2016). BACE in the adult retina is mostly present in the plexiform layers, consistent with localization of this enzyme to synaptic terminals (Xiong et al., 2007). In AD, Aβ levels are elevated in neurodegenerative retinas, and this potentially causes damage in retinal function in aging (Dentchev et al., 2003; Gupta et al., 2016; Masuzzo et al., 2016). In this sense, inhibition of BACE1 will be beneficial to retinal function.

Bace2 Substrates and its Biological Functions

While BACE2 was discovered simultaneously with BACE1 (Vassar et al., 2014), the functional importance of BACE2 has emerged after the finding that BACE2 cleaves the pro-proliferative plasma membrane protein Tmem27 and PMEL (see summary in Table ). In pancreatic MIN6 cells treated with a BACE2 inhibitor or siRNA, BACE2 was initially shown to mediate insulin receptor β-subunit (IRβ) expression and surface trafficking (Casas et al., 2010). A separate BACE2 silencing study in murine and human β cells reveals Tmem27, known to promote the preservation of functional β-cell mass, as a BACE2 substrate (Esterhazy et al., 2011). Mice with BACE2 deficiency have been shown to correlatively increase β-cell mass, and improved control of glucose homeostasis is associated with increased insulin levels. Hence, BACE2 inhibition should be beneficial to diabetic patients by controlling β-cell maintenance and glucose metabolism. Characterized BACE2 substrates. To maintain glucose homeostasis, islet amyloid polypeptide (IAPP) in pancreatic β cells needs to co-secrete with insulin, and the formation of IAPP amyloid is a hallmark pathological feature of type 2 diabetes (Mukherjee et al., 2015). BACE2 was recently shown to cleave IAPP at two ectodomain sites (Rulifson et al., 2016) and loss of BACE2 cleavage likely increases IAPP homodimer formation and subsequent production of cytotoxic oligomers and amyloid fibrils. Hence, this study suggests that BACE2 inhibition may lead to β-cell dysfunction due to IAPP accumulation in proteinaceous plaques in and around pancreatic islets. These two controversial aspects will be further resolved in more detailed future studies. On the other hand, BACE2 inhibition can cause loss of pigmentation, as BACE2 cleaves the integral membrane form of PMEL within the juxtamembrane domain and exerts its role in melanosome biogenesis (Rochin et al., 2013). Although BACE1 is expressed in pigment cells, the level of BACE2 is 37-fold higher as that in retinal pigment epithelial cells, suggesting that BACE2 is the major BACE homolog in pigment cells. Consistently, mice with BACE2 deficiency show loss of pigment in skin and retina. However, BACE2 depletion reduces neither the number of stage IV melanized melanosomes nor the total melanin content. Instead, the loss of BACE2-cleaved PMEL N-terminal fragment impairs the organization of PMEL fibrils into parallel sheets, with a threefold decrease in the number of fibrillar stage II and III melanosomes and a sixfold increase in the number of round organelles containing unstructured aggregates. Hence, BACE2 is required for the formation of PMEL amyloid fibrils and for melanosome morphogenesis, consistent with demonstrations by pharmacological inhibition of BACE1 and BACE2 (Shimshek et al., 2016). It is also demonstrated that Sez6L and Sez6L2 are effectively cleaved but in rate limiting proteolytic manner in pancreatic islet β-cells by BACE2 (Stutzer et al., 2013). Although Sez6L is also a BACE1 substrate, it is not cleaved by BACE1 in pancreatic cells (Pigoni et al., 2016). Additional BACE2 substrates, explored through proteomic approaches, include CD200, IGF2R, LAMP2, MPZL1, and SORT1 (Stutzer et al., 2013). The functional importance of BACE2 cleavages of these proteins remains to be established.

Summary

Inhibition of BACE1 is one the most promising therapeutic targets for treating AD, and five drugs have currently entered into clinical trials (Vassar, 2014; Yan, 2016). While there is great promise for BACE1 inhibition in benefiting Alzheimer’s patients, it also raises caution regarding mechanism-based side effects associated with long-lasting inhibition of this enzyme. In addition to the fact that BACE1 is indispensable for proper astrogenesis, axonal growth and migration, myelination and remyelination, neuronal excitation, and synaptic plasticity, BACE1-null mice are also found to be susceptible to early lethality (Dominguez et al., 2005; Weber et al., 2017). Reduced body weight is seen in BACE1-null mice but not in rats. With more efforts, the available BACE1-null mice and rats will identify more shared phenotypes, and these phenotypes will have to be taken into consideration when BACE1 is inhibited for long terms. Moreover, BACE1 inhibition may also cause cross-inhibition with BACE2, as some compounds such as MK8931 appear to be more potent in blocking BACE2 activity (see reviews by Yan, 2016). Although BACE1 and BACE2 exhibit distinct cleavage specificity, substrates like APP, Jag1 and Sez6 family proteins are shared by these two enzymes. The number of studies using BACE2-null mice is increasing, and inhibition of BACE2 may alter glucose homeostasis and pigmentation. Future studies are expected to provide more knowledge regarding the biological functions of BACE1 and BACE2 in brains and other tissues.

Author Contributions

The author confirms being the sole contributor of this work and approved it for publication.

Conflict of Interest Statement

The author declares that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Table 1

Partial list of characterized BACE1 substrates.

Protein substrateThe substrate recognition siteReference
APPKM↓DAEFRHDSGY↓EVHHQKLVFFAEDVGSNK-TM
CHL-lWGDNDSIFQ↓DVIETRGRETAGLDDISTG-TMZhou et al., 2012
Delta-1GYVCECARGYGGPNCQFLLPELPPGPAVVDL↓TEKLEGQGGHu et al., 2017
IL-1R2PVTREDLHMDFKCVVHNTLSF↓QTLRTTVKE-TMKuhn et al., 2007
Jag1KE↓ITDKIIDLVSKRDGNSSLIA↓AVAEVRVQRRPLKNR-TMHe et al., 2014
Jag2LIQGAAHAIVAAITQRGNSSLLL↓AVTEVKVETVVTGGS-TMHe et al., 2014
Navβ2IMNPPDRHRGHGKIHL↓QVL↓MEEPPERDST-TMGersbacher et al., 2010
Nrg1 (type I and III-β1α)GDRCQNYVMASFvYKHLGIEF↓MEAEELYQKR-TMHu et al., 2008
Nrg1 (type III-β1α)TTETNL↓QTAPKLSTSTSTTGT-EGF-like domainFleck et al., 2013
Nrg3FLPKTDSILSDPTDHLGIEF↓MESEEVYQRQ-TMHu et al., 2013
PSGL-1VTHKGIPMAASNL↓SVNYPVGAPDHISVKQC-TMLichtenthaler et al., 2003
Sez6AASLDGFYNGRSL↓DVAKAPASSALDAAH-TMPigoni et al., 2016
Sez6LICKVNQDSFEHALEA↓EAAAESSLEGGNMA-TMPigoni et al., 2016
ST6Gal 1SGMAVKEQSKPMQFEKAQ↓LTLAEYDSGKK-TMKitazume et al., 2003
Table 2

Characterized BACE2 substrates.

Protein substrateThe substrate recognition siteReference
APPKMDAEFRHDSGYEVHHQKLVF↓F↓AEDVGSNK-TMFarzan et al., 2000; Yan et al., 2001b
IAPP (human)KCNTATCATQRLANF↓LVHSSNNF↓GAISSTNVGSNTY-TMRulifson et al., 2016
IAPP (rodent)KCNTATCATQRLANF↓LVRSSNNLGPVLPPTNVGSNTY-TMRulifson et al., 2016
Jag1KEITDKIIDL↓VSKRDGNSSLIA↓AVAEVRVQRRPLKNR-TMHe et al., 2014
Tmem27RMNKNRINNAF↓FL↓NDQTLEF↓LKIPSTLAPP-TMEsterhazy et al., 2012
  163 in total

1.  The neural cell adhesion molecules L1 and CHL1 are cleaved by BACE1 protease in vivo.

Authors:  Lujia Zhou; Soraia Barão; Mathias Laga; Katrijn Bockstael; Marianne Borgers; Harry Gijsen; Wim Annaert; Diederik Moechars; Marc Mercken; Kris Gevaert; Kris Gevaer; Bart De Strooper
Journal:  J Biol Chem       Date:  2012-06-12       Impact factor: 5.157

2.  Membrane-anchored aspartyl protease with Alzheimer's disease beta-secretase activity.

Authors:  R Yan; M J Bienkowski; M E Shuck; H Miao; M C Tory; A M Pauley; J R Brashier; N C Stratman; W R Mathews; A E Buhl; D B Carter; A G Tomasselli; L A Parodi; R L Heinrikson; M E Gurney
Journal:  Nature       Date:  1999-12-02       Impact factor: 49.962

3.  BACE1 regulates hippocampal astrogenesis via the Jagged1-Notch pathway.

Authors:  Xiangyou Hu; Wanxia He; Xiaoyang Luo; Katherine Elyse Tsubota; Riqiang Yan
Journal:  Cell Rep       Date:  2013-07-03       Impact factor: 9.423

4.  Nicastrin modulates presenilin-mediated notch/glp-1 signal transduction and betaAPP processing.

Authors:  G Yu; M Nishimura; S Arawaka; D Levitan; L Zhang; A Tandon; Y Q Song; E Rogaeva; F Chen; T Kawarai; A Supala; L Levesque; H Yu; D S Yang; E Holmes; P Milman; Y Liang; D M Zhang; D H Xu; C Sato; E Rogaev; M Smith; C Janus; Y Zhang; R Aebersold; L S Farrer; S Sorbi; A Bruni; P Fraser; P St George-Hyslop
Journal:  Nature       Date:  2000-09-07       Impact factor: 49.962

5.  BACE1 retrograde trafficking is uniquely regulated by the cytoplasmic domain of sortilin.

Authors:  Gina M Finan; Hirokazu Okada; Tae-Wan Kim
Journal:  J Biol Chem       Date:  2011-01-18       Impact factor: 5.157

6.  β-site amyloid precursor protein cleaving enzyme 1(BACE1) regulates Notch signaling by controlling the cleavage of Jagged 1 (Jag1) and Jagged 2 (Jag2) proteins.

Authors:  Wanxia He; Jinxuan Hu; Yuxing Xia; Riqiang Yan
Journal:  J Biol Chem       Date:  2014-07-25       Impact factor: 5.157

7.  Characterization of Alzheimer's beta -secretase protein BACE. A pepsin family member with unusual properties.

Authors:  M Haniu; P Denis; Y Young; E A Mendiaz; J Fuller; J O Hui; B D Bennett; S Kahn; S Ross; T Burgess; V Katta; G Rogers; R Vassar; M Citron
Journal:  J Biol Chem       Date:  2000-07-14       Impact factor: 5.157

Review 8.  One protein, multiple pathologies: multifaceted involvement of amyloid β in neurodegenerative disorders of the brain and retina.

Authors:  Vivek Gupta; Veer B Gupta; Nitin Chitranshi; Sumudu Gangoda; Roshana Vander Wall; Mojdeh Abbasi; Mojtaba Golzan; Yogita Dheer; Tejal Shah; Alberto Avolio; Roger Chung; Ralph Martins; Stuart Graham
Journal:  Cell Mol Life Sci       Date:  2016-06-22       Impact factor: 9.261

9.  Sorting nexin 12 interacts with BACE1 and regulates BACE1-mediated APP processing.

Authors:  Yonghao Zhao; Yunshu Wang; Jiaye Yang; Xin Wang; Yingjun Zhao; Xian Zhang; Yun-wu Zhang
Journal:  Mol Neurodegener       Date:  2012-06-18       Impact factor: 14.195

Review 10.  Stepping closer to treating Alzheimer's disease patients with BACE1 inhibitor drugs.

Authors:  Riqiang Yan
Journal:  Transl Neurodegener       Date:  2016-07-14       Impact factor: 8.014

View more
  32 in total

Review 1.  Proteolytic ectodomain shedding of membrane proteins in mammals-hardware, concepts, and recent developments.

Authors:  Stefan F Lichtenthaler; Marius K Lemberg; Regina Fluhrer
Journal:  EMBO J       Date:  2018-07-05       Impact factor: 11.598

Review 2.  A Close Look at BACE1 Inhibitors for Alzheimer's Disease Treatment.

Authors:  Brati Das; Riqiang Yan
Journal:  CNS Drugs       Date:  2019-03       Impact factor: 5.749

3.  Randomized Trial of Verubecestat for Prodromal Alzheimer's Disease.

Authors:  Michael F Egan; James Kost; Tiffini Voss; Yuki Mukai; Paul S Aisen; Jeffrey L Cummings; Pierre N Tariot; Bruno Vellas; Christopher H van Dyck; Merce Boada; Ying Zhang; Wen Li; Christine Furtek; Erin Mahoney; Lyn Harper Mozley; Yi Mo; Cyrille Sur; David Michelson
Journal:  N Engl J Med       Date:  2019-04-11       Impact factor: 91.245

4.  β-Secretase BACE1 Promotes Surface Expression and Function of Kv3.4 at Hippocampal Mossy Fiber Synapses.

Authors:  Stephanie Hartmann; Fang Zheng; Michele C Kyncl; Sandra Karch; Kerstin Voelkl; Benedikt Zott; Carla D'Avanzo; Selene Lomoio; Giuseppina Tesco; Doo Y Kim; Christian Alzheimer; Tobias Huth
Journal:  J Neurosci       Date:  2018-03-05       Impact factor: 6.167

5.  Editorial: Translational Control of APP Expression for Alzheimer Disease Therapy.

Authors:  Joanna E Pankiewicz; Martin J Sadowski
Journal:  Ann Pharmacol Pharm       Date:  2017-08-18

6.  Alzheimer-like amyloid and tau alterations associated with cognitive deficit in temporal lobe epilepsy.

Authors:  Sarah Gourmaud; Haochang Shou; David J Irwin; Kimberly Sansalone; Leah M Jacobs; Timothy H Lucas; Eric D Marsh; Kathryn A Davis; Frances E Jensen; Delia M Talos
Journal:  Brain       Date:  2020-01-01       Impact factor: 13.501

7.  Click Chemistry-mediated Biotinylation Reveals a Function for the Protease BACE1 in Modulating the Neuronal Surface Glycoproteome.

Authors:  Julia Herber; Jasenka Njavro; Regina Feederle; Ute Schepers; Ulrike C Müller; Stefan Bräse; Stephan A Müller; Stefan F Lichtenthaler
Journal:  Mol Cell Proteomics       Date:  2018-05-01       Impact factor: 5.911

8.  Development of Kinase Inactive PD173955 Analogues for Reducing Production of Aβ Peptides.

Authors:  Anjana Sinha; Katherina Gindinova; Emily Mui; William J Netzer; Subhash C Sinha
Journal:  ACS Med Chem Lett       Date:  2019-09-06       Impact factor: 4.345

Review 9.  Environmental exposures and the etiopathogenesis of Alzheimer's disease: The potential role of BACE1 as a critical neurotoxic target.

Authors:  Tauqeerunnisa Syeda; Jason R Cannon
Journal:  J Biochem Mol Toxicol       Date:  2021-01-04       Impact factor: 3.642

10.  Multifunctional magnetite nanoparticles to enable delivery of siRNA for the potential treatment of Alzheimer's.

Authors:  Natalia Lopez-Barbosa; Juan G Garcia; Javier Cifuentes; Lina M Castro; Felipe Vargas; Carlos Ostos; Gloria P Cardona-Gomez; Alher Mauricio Hernandez; Juan C Cruz
Journal:  Drug Deliv       Date:  2020-12       Impact factor: 6.419

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.