Literature DB >> 28293250

Expression of a Human Prostatic Acid Phosphatase (PAP)-IgM Fc Fusion Protein in Plants Using In vitro Tissue Subculture.

Yang J Kang1, Deuk-Su Kim1, Soon-Chul Myung2, Kisung Ko1.   

Abstract

In this study, prostatic acid phosphatase (PAP), which is overexpressed in human prostate cancer cells, was cloned to be fused to the IgM constant fragment (Fc) for enhancing immunogenicity and expressed in transgenic tobacco plants. Then, the transgenic plants were propagated by in vitro tissue subculture. Gene insertion and expression of the recombinant PAP-IgM Fc fusion protein were confirmed in each tested the first, second, and third subculture generations (SG1, SG2, and SG3, respectively). Transcription levels were constantly maintained in the SG1, SG2, and SG3 leaf section (top, middle, and base). The presence of the PAP-IgM Fc gene was also confirmed in each leaf section in all tested subculture generations. RNA expression was confirmed in all subculture generations using real-time PCR and quantitative real-time PCR. PAP-IgM Fc protein expression was confirmed in all leaves of the SG1, SG2, and SG3 recombinant transgenic plants by using quantitative western blotting and chemiluminescence immunoassays. These results demonstrate that the recombinant protein was stably expressed for several generations of in vitro subculture. Therefore, transgenic plants can be propagated using in vitro tissue subculture for the production of recombinant proteins.

Entities:  

Keywords:  propagation; prostatic acid phosphatase; recombinant protein; subculture generation; transgenic plant

Year:  2017        PMID: 28293250      PMCID: PMC5329016          DOI: 10.3389/fpls.2017.00274

Source DB:  PubMed          Journal:  Front Plant Sci        ISSN: 1664-462X            Impact factor:   5.753


Background

Recombinant proteins are commonly produced in animal cells (Andersen and Krummen, 2002; Birch and Racher, 2006). However, production in animal cells is costly, and the cultures are susceptible to human pathogen contamination. Plants have also been effectively used as expression systems for large-scale production of recombinant proteins (Larrick and Thomas, 2001; Twyman et al., 2003; Fischer et al., 2004; Daniell et al., 2009; Ko et al., 2009; So et al., 2013; Lim et al., 2015; Park et al., 2015; Kim et al., 2016), and plant-based production has many advantages over other systems, including low biomass production costs and lack of human pathogen contamination (Twyman et al., 2003). Therefore, a wide range of recombinant biotherapeutic proteins, including industrial enzymes and new protein polymers, have been produced in plants (Ma et al., 2003). Similar to mammalian cell expression systems, plant biomass increases in an in vitro subculture system, and subculture can affect the protein expression level (Kim et al., 2011; Dorai and Ganguly, 2014). Although in vitro plant tissue subculture is an efficient method for clonal propagation, somaclonal variation generation occurred after quite prolong stage of unorganized growth, with a loss of transgene insertion and protein expression (Krishna et al., 2016). The recombinant proteins must be stably expressed in plants during in vitro growth so that the protein product can be extracted and purified. However, loss of the recombinant protein during plant tissue subculture is unpredictable, and sometimes, recombinant protein expression is unstable. Prostatic acid phosphatase (PAP) is a glycoprotein that is synthesized in the epithelial cells of the prostate and is secreted into the seminal fluid (Vihko et al., 1988; McNeel et al., 2009). PAP is a prostate cancer antigen that is overexpressed by malignant prostate cell tissues and is often used as a therapeutic protein (Tarassoff et al., 2006; McNeel et al., 2009; Saif et al., 2014). In addition, due to its high expression in the prostate, PAP has been tested as a prostate cancer target antigen (Graddis et al., 2011). PAP-based peptide vaccination has been reported to induce antigen-specific T-cell responses and inhibit tumor growth in mice (Saif et al., 2014). In this study, we examined the expression of a PAP-IgM Fc fusion protein in plant leaves from in vitro tissue subculture, as a vaccine candidate. The aim of this study was to determine whether PAP-IgM Fc fusion protein expression is stable over several in vitro subculture generations (SG1, SG2, and SG3).

Materials and Methods

Construction of the PAP-IgM Fc Gene Expression Vector

The synthetic DNA sequence encoding PAP (GenBank accession no. M34840.1) was cloned as a fusion to the Fc fragment of the human IgM μ chain (GenBank accession No. X57086.1). The PAP sequence was modified by the addition of an N-terminal extension encoding a signal peptide (MATQRRANPSSLHLITVFSLLAAVVSAEVD; Lu et al., 2012). The gene encoding PAP-IgM Fc was cloned under the control of the enhanced cauliflower mosaic virus (CaMV) 35S promoter and the tobacco etch virus 5’-leader sequence (TEV; Figure ). The PAP-IgM Fc expression cassette was subcloned into the HindIII and EcoRI restriction enzyme sites of the binary plant expression vector pBI121 to generate pBI PAP-IgM Fc. Then, the vector was transformed into competent Escherichia coli DH5α cells for amplification. Schematic diagram of the plant expression vector, the structure of the recombinant prostatic acid phosphatase (PAP)-IgM Fc fusion protein, plant transformation procedure, and sampling procedure for top, middle, and base leaf tissues in the various subculture generations (SG The PAP-IgM Fc gene expression cassette in the binary pBI121 plant vector containing the cauliflower mosaic virus 35S promoter with a duplicated enhancer region (E/35S-P), the untranslated leader sequence of the tobacco etch virus, and the nopaline synthase gene terminator (NOST). Expected structure of the recombinant PAP-IgM Fc fusion protein, with a spring-shaped region (PAP) and a gray oval region (IgM Fc). A PAP-IgM Fc transgenic tobacco plantlet growing on kanamycin selection medium in a Magenta GA-7 vessel. T, top SG1 stem sample; M, middle SG1 stem sample; BA, base SG1 stem sample; T-T’, T of the SG2 stem produced from the T of the SG1 stem; T-M’, M of the SG2 stem produced from the T of the SG1 stem; T-BA’, BA of the SG2 stem produced from the T of the SG1 stem; M-T’, T of the SG2 stem produced from the M of the SG1 stem; M-M’, M of the SG2 stem produced from the M of the SG1 stem; M-BA’, BA of the SG2 stem produced from the M of the SG1 stem; BA-T’, T of the SG2 stem produced from the BA of the SG1 stem; BA-M’, M of the SG2 stem produced from the BA of the SG1 stem; and BA-BA’, BA of the SG2 stem produced from the BA of the SG1 stem. The circle with the dotted line indicates the part of the leaf tissue of the top portion that was harvested for analyses. (B) polymerase chain reaction (PCR) analysis to confirm the presence of the PAP-IgM Fc gene in tissues from subculture generations SG1, SG2, and SG3. PAP-IgM Fc (1,786 bp): positive control (+), pBI PAP-IgM Fc recombinant vector in DH5α competent cells, negative control (-), and non-transgenic tobacco plant (NT). The loading amount was 5 μL per sample. (C) Reverse transcription (RT)-PCR. Gene expressions were analyzed using RT-PCR of SG1, SG2, and SG3 leaf section. The negative control (-) consists of mRNA of a non-transgenic tobacco plant. The EF-1α gene was used as a housekeeping gene.

Plant Transformation

The recombinant pBI PAP-IgM Fc vector was transferred into Agrobacterium tumefaciens strain LBA4404 by electroporation. Then, transgenic tobacco (Nicotiana tabacum) plants were generated by Agrobacterium-mediated transformation (Ko et al., 2003; Lu et al., 2012; So et al., 2013). Transgenic plant lines were selected on Murashige and Skoog (MS) medium [30 g⋅L-1 of Sucrose, 6 g⋅L-1 of Phyto agar, and 4.8 g⋅L-1 of MS B5 vitamin (Duchefa Biochemie, Haarlem, Netherlands)] containing 100 mg⋅L-1 kanamycin and 250 mg⋅L-1 cefotaxime. Transgenic plants were grown in a chamber at constant temperature (23°C) and light intensity of 50 μmol⋅m-2⋅s-1 under a long-day photoperiod (16:8 h light-dark cycle). Among the transgenic plants with high protein expression, three PAP-IgM Fc expressing transgenic lines (T502, T506, and T509) were randomly selected for in vitro tissue subculture.

In vitro Subculture of PAP-IgM Fc Plants

Transgenic plants expressing PAP-IgM Fc were grown in vitro as the first generation tissue culture (SG1) in a Magenta GA-7 vessel (Sigma–Aldrich, St. Louis, MO, USA) for 4 weeks. Plant stems were divided into three sections [top (T), middle (M), and base (BA)]. T, M, and BA plantlet stem pieces were transplanted into new media and grown as the second-generation tissue subculture (SG2) for 2 weeks. This tissue subculture was repeated to generate the third generation SG3 (Figure ).

Genomic DNA Extraction and PCR Analysis

Leaf tissue samples were harvested from the top portion of transgenic and non-transgenic plantlets. Genomic DNA from fresh leaf tissue was isolated using a DNA extraction kit (RBC Bioscience, Seoul, South Korea) according to the manufacturer’s protocol. The extracted genomic DNA was analyzed by polymerase chain reaction (PCR) to confirm the presence of the recombinant PAP-IgM Fc gene using the following primer pairs: forward primer 5′-GCC CTC GTT TTC AAG AAC TTG-3′ and reverse primer 5′-CGG GAT CCT CAG TAG CAG GTG CCA GCT GTG-3′. The PCR was performed with 30 cycles of 94°C for 20 s, 62°C for 20 s, and 72°C for 120 s. Genomic DNA isolated from non-transgenic plant leaves was used as the negative control, and the pBI PAP-IgM Fc gene was used as a positive control. The expected size of PAP-IgM Fc PCR product was 1,685 bp. PCR analysis was performed for more than three times.

Real Time-PCR (RT-PCR) and Quantitative Real Time-PCR (RT-qPCR) Analyses

Leaf tissue samples were used from each top portion of transgenic plantlets. Total RNA was isolated from the leaves of transgenic plant samples (SG1, SG2, and SG3) using an Rneasy plant mini kit (Quagen, Valencia, CA) according to the manufacturer’s recommendations, and the isolated RNA samples were stored at -80°C. Genomic DNA removal and cDNA synthesis were performed using the Quantitect reverse transcription kit (Quagen, Valencia, CA) according to the manufacturer’s protocol. Each RNA sample was used as a template for RT-PCR and RT-qPCR analyses. RT-PCR and RT-qPCR reactions were performed using the Maxime PCR premix kit (Intron Biotechnology, Seoul, South Korea) and Rotor-Gene SYBR Green PCR kit (Quagen, Valencia, CA), respectively. PAP-IgM Fc primers were as follows: 5′-CTC ATG CTA CCT GGT TGC AG-3′; forward, 5′-GGT GGG ACG AAG ACG CTC A-3′. Quantitative RT-PCR was analyzed using real-time PCR machine (Rotor-Gene Q, Quagen) with the following cycling parameters: 5 min at 95°C, 5 s at 95°C, 10 s at 60°C, and 40 cycles of 5 s at 95°C and 10 s at 60°C. The elongation factor 1-α (EF-1α) gene was used as a housekeeping gene. RT PCR and RT-qPCR analyses were performed for 3 times.

Quantitative Immunoblot Analysis

The PAP-IgM Fc protein expression level in transgenic lines T502, T506, and T509 was investigated using immunoblot analysis. Leaf samples (100 mg) were harvested from the plantlet top and homogenized in 300 μL of 1 × PBS (137 mM NaCl, 10 mM Na2HPO4, 2.7 mM KCl, and 2 mM KH2PO4) to extract total soluble proteins. PAP-IgM Fc leaf extracts were boiled with 5 × protein loading buffer (1 M Tris-HCl, 50% glycerol, 10% SDS, 5% 2-mercaptoethanol, and 0.1% bromophenol blue) for 10 min and cooled for 2 min. Total soluble proteins were separated by 10% SDS-PAGE and transferred to a nitrocellulose membrane (Millipore, Billerica, MA, USA). Membranes were incubated with 5% skim milk (Sigma, St. Louis, MO, USA) in 1 × PBS buffer at 4°C overnight. Blots were incubated with a goat anti-human IgM (μ chain) antibody conjugated to horseradish peroxidase (Abcam Inc., Cambridge, MA, USA) diluted 1:5,000 in 1 × PBS solution for 2 h at room temperature (Figure ). After three 10-min washes, proteins were detected with the SuperSignal West Pico Chemiluminescent Substrate (Thermo Scientific, Rockford, IL, USA) and visualized by exposing the membrane to X-ray film (Fuji, Tokyo, Japan). Leaf tissue extract from non-transgenic plants was used as a negative control. Detected protein bands were digitized as an electronic image, and band intensity was measured using ImageJ software (National Institutes of Health, Bethesda, MD, USA). Immunoblot analysis was performed for more than three times. Densitometry analysis of PAP-IgM Fc protein expression levels in the tissues of plantlets from subculture generations SG and chemiluminescence immunoassay (CLIA) to confirm PAP-IgM Fc protein expression in various leaf tissues from subculture (T of SG2 and T-T, M-T’, and BA-T’ of SG3 protein expression SG3 (F–I). (A) Illustration showing the interaction between PAP-IgM Fc and the anti-human IgM antibody conjugated to horseradish peroxidase (HRP) in the western blot. (B) Western blot analysis to confirm PAP-IgM Fc protein expression in top (T), middle (M), and base (BA) stem tissues from different subculture generations (SG1, SG2, and SG3). Negative control (-) and non-transgenic plant (NT). PAP-IgM Fc (83 kDa) was detected with HRP-conjugated goat anti-human IgM (μ chain) immunoglobulin. Black arrowheads indicate the PAP-IgM Fc protein band (83 kDa). Expression levels of PAP-IgM Fc in T502 (C), T506 (D), and T509 (E) leaf tissues were assessed by western blotting with an anti-human IgM (μ chain) immunoglobulin conjugated to HRP. Protein expression rates in the three PAP-IgM Fc transgenic lines were calculated based on the protein band density in the western blot analysis. (F) Illustration of the double sandwich CLIA. The interaction between PAP-IgM Fc and the anti-human IgM antibody conjugated to alkaline phosphatase. The expression in the transgenic lines T502 (G), T506 (H), and T509 (I) PAP-IgM Fc proteins in transgenic plants from the top of SG2 and SG3. Data are the mean and standard error (∗∗∗p < 0.01, ∗∗p < 0.05, t-test).

Chemiluminescence Immunoassay

Expression of PAP-IgM Fc in plant leaf tissue was analyzed using a chemiluminescence immunoassay (CLIA). Leaf samples from PAP-IgM Fc transgenic plants were harvested from the plantlet top (T of SG2 and T-T’, M-T’, and BA-T’ of SG3; Figure ) and homogenized in 300 μL of 1 × PBS (137 mM NaCl, 10 mM Na2HPO4, 2.7 mM KCl, and 2 mM KH2PO4) for total soluble protein extraction. All samples were diluted 1:100 in 1 × PBS solution. A cuvette containing the anti-PAP coated beads (Siemens Healthcare Diagnostics Inc., Llanberis, UK) was incubated with PAP-IgM Fc and an anti-PAP antibody conjugated to alkaline phosphatase for 30 min at 37°C (Figure ). After the antibodies were removed and the beads were washed in deionized distilled water as a centrifugal washing buffer, the PAP-IgM Fc proteins were detected using the chemiluminescent substrate. The samples were analyzed on an IMMULITE 2000 xpi (Siemens Healthcare Diagnostic Inc., Flanders, NJ, USA). CLIA was performed for more than three times.

Statistical Analysis

All values are shown as the mean ± SD. Recombinant PAP-IgM Fc protein expression in transgenic plant leaves was compared by using the unpaired t-test, and p values less than 0.01 (∗∗∗) or 0.05 (∗∗) were considered statistically significant. Statistical significance was assessed using Excel (Microsoft Office Excel 2013; Microsoft Corporation, Redmond, WA, USA).

Results

Confirmation of PAP-IgM Fc Gene Presence

Transgenic tobacco plant lines were obtained by Agrobacterium-mediated transformation with plant expression vectors carrying PAP-IgM Fc. Genomic DNA extracted from three transgenic lines (T502, T506, and T509) was analyzed by PCR to confirm insertion of the PAP-IgM Fc transgene. The PAP-IgM Fc gene was detected in the top leaves of each subculture generation (SG1, SG2, and SG3) obtained from the T, M, and BA stems harvested from tobacco transgenic plants (SG1). The size of the PAP-IgM Fc PCR product in the genome of the transgenic plants was 1,685 bp (Figure ). No PAP-IgM Fc PCR product was detected in non-transgenic plants.

Gene Transcription Level Analysis of PAP-IgM Fc in All Subculture Generations (SG1, SG2, and SG3)

In real-time PCR and quantitative real-time PCR, the relative transcription level was observed in the top portions of all subculture generations (SG1, SG2, and SG3) leaf tissues (Supplementary Figure S1). The transgene was not detected in non-transgenic plant (Figure ). RT-PCR product of the expected size of PAP-IgM Fc was detected in all samples of transgenic plants (T502, T506, and T509; Figure ). In RT-qPCR, the PAP-IgM Fc transcriptional levels were consistently higher than 0.9 level in SG1, SG2, and SG3 leaf section (T, M, and BA; Supplementary Figure S1). Non-transgenic plant showed no PAP-IgM Fc signal.

Confirmation of PAP-IgM Fc Protein Expression

PAP-IgM Fc protein expression in leaf samples from transgenic plants was analyzed by western blotting. All transgenic plant lines harboring the PAP-IgM Fc transgene showed a protein band of approximately 83 kDa (Figure ). Recombinant PAP-IgM Fc fusion proteins were expressed in all subculture generations (SG1, SG2, and SG3) obtained from the T, M, and BA stems of SG1 transgenic plants (Figure ). No PAP-IgM Fc protein band was detected in non-transgenic plants, which were used as a negative control (Figure ).

Densitometry Analysis of PAP-IgM Fc Protein Expression Levels in SG1, SG2, and SG3

Quantitative western blot analysis was performed to determine the expression level of the recombinant PAP-IgM Fc fusion protein in the top leaves of SG1, SG2, and SG3 (Figure ). The intensity of the PAP-IgM Fc fusion protein bands in the top leaf samples was quantified using Image J software. Although the PAP-IgM Fc recombinant protein expression level differed slightly among the SG1, SG2, and SG3 samples, all leaf samples showed stable expression of the recombinant protein (Figures ).

Quantitative CLIA of PAP-IgM Fc in Transgenic Plant Leaves

A CLIA was performed to quantify the expression of recombinant PAP-IgM Fc protein in the transgenic leaves of SG2 and SG3 plants. In T502, PAP-IgM Fc expression levels in each leaf position were slightly different. However, the mean values at each position in SG3 were not significantly different (Figure ). In T506, the PAP-IgM Fc expression levels were significantly different at each leaf position, and the mean values at each position in SG3 were significantly different (Figure ). In T509, the PAP-IgM Fc expression levels in SG2, T-T’ of SG3, and M-T- of SG3 differed. However, the mean values at all positions were not significantly different (Figure ). Overall, the expression of the recombinant PAP-IgM Fc fusion protein was maintained without loss in all in vitro SG samples (Figures ).

Discussion

This study demonstrated that the production of different subculture generations of transgenic plants did not affect the expression of the recombinant PAP-IgM Fc fusion protein. The fusion of antigenic protein to IgM Fc can assembled to form large quaternary circular protein enhancing immunogenicity (David et al., 2011). The PAP is a PAP glycoprotein fused to the Fc fragment of the human IgM immunoglobulin. The PAP-IgM Fc gene was constitutively expressed under the control of the enhanced CaMV 35S promoter (Lu et al., 2012; Lim et al., 2015). The N-terminus of PAP was fused to a signal peptide. In this study, we hypothesized that PAP-IgM Fc expression in transgenic plants would be stable through several generations produced by in vitro tissue subculture. With this in mind, each cultured stem section (T, M, and BA) was transplanted and grown to investigate the stability of the transgene insertion and transgenic protein expression. PCR analysis confirmed that the recombinant PAP-IgM Fc gene insertion was stable in all tested subculture generations (SG1, SG2, and SG3). In vitro subcultured transgenic plants may lose the recombinant gene during propagation (Fladung and Kumar, 2002; Zeng et al., 2010; Martinelli et al., 2015). Loss of recombinant genes may occur because they are not strongly attached to the genomic DNA of plant cells (Doran, 2006). However, in this study, stable insertion of the PAP-IgM Fc gene was confirmed in all subculture generations. RT-PCR and RT-qPCR analysis were applied to investigate whether the mRNA levels of the PAP-IgM Fc gene expression at all subculture generations (SG1, SG2, and SG3). The mRNA levels slightly differed at each subculture generations. However, transcription levels in all transgenic plants were constantly maintained at each subculture generation (Supplementary Figure S1). These results indicate that the PAP-IgM Fc transgene was not deleted during tissue propagation. Immunoblot analysis and CLIA were conducted to investigate whether the PAP-IgM Fc fusion protein was expressed in the different subculture generations. The protein expression levels slightly differed at leaf tissue positions among SG1, SG2, and SG3. Such of the PAP-IgM Fc protein level is due to leaf tissue position and developmental stage, at which water content and plant cell number might be variable (Streatfield, 2007; Lim et al., 2015). Thus, in the future normalization for protein level quantification should be optimized, which can precisely calculate amount of recombinant protein per amount of total soluble protein in plant tissue (Alkanaimsh et al., 2016). In addition, the protein level might be fluctuated by variation factors, which are total soluble protein levels to be hardly controlled because of low ratio between leaf tissue material weight and homogenizing buffer volume in this study. However, all leaf samples harvested from the top portion of the plants showed stable expression of the PAP-IgM Fc recombinant protein. In addition, the PAP-IgM Fc recombinant protein was expressed without degradation in a consistent pattern in all subculture generations (SG1, SG2, and SG3). The PAP expression levels in each plant sample, as quantified by western blotting, were correlated with the PAP levels detected by CLIA (data not shown). This shows that both these quantitative methods are reliable for confirming PAP expression in transgenic plant tissues. Plant expression systems are advantageous both in terms of safety and production cost, when compared to conventional cell systems, such as yeast, mammalian, and insect cells (Twyman et al., 2003; Ko, 2014). In animal cell systems, loss of recombinant protein expression often occurs during subculture due to deletion of the recombinant transgenes (Heller-Harrison et al., 2009; Kim et al., 2011; Dorai and Ganguly, 2014). The ultimate purpose of in vitro plant tissue subculture is the mass propagation of transgenic plants. However, somatic variations that occur during in vitro subculture can alter the genetic components and protein expression. Therefore, expression of the recombinant protein in the transgenic plants must be confirmed through in vitro subculture. Taken together, the transgenic plants obtained through in vitro tissue subculture showed that the transgene and transgenic protein expression were stable. Thus, transgenic plants can be used to produce highly valuable therapeutic recombinant proteins via in vitro subculture. PAP is highly expressed in human prostate cancer cells, which can be a promising vaccine candidate. In addition, PAP itself can be used as one of prostate cancer indicators in medical diagnosis. Thus, plant-derived recombinant PAP-IgM Fc fusion protein can be highly useful in both research medical and purposes.

Author Contributions

YK contributed for acquisition of data and writing of manuscript. D-SK contributed for acquisition of data and interpreted data. S-CM analyzed and interpreted data, and KK made substantial contributions to conception and design of the study.

Conflict of Interest Statement

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
  27 in total

Review 1.  Producing proteins in transgenic plants and animals.

Authors:  J W Larrick; D W Thomas
Journal:  Curr Opin Biotechnol       Date:  2001-08       Impact factor: 9.740

Review 2.  Recombinant protein expression for therapeutic applications.

Authors:  Dana C Andersen; Lynne Krummen
Journal:  Curr Opin Biotechnol       Date:  2002-04       Impact factor: 9.740

Review 3.  Molecular farming in plants: host systems and expression technology.

Authors:  Richard M Twyman; Eva Stoger; Stefan Schillberg; Paul Christou; Rainer Fischer
Journal:  Trends Biotechnol       Date:  2003-12       Impact factor: 19.536

Review 4.  The production of recombinant pharmaceutical proteins in plants.

Authors:  Julian K-C Ma; Pascal M W Drake; Paul Christou
Journal:  Nat Rev Genet       Date:  2003-10       Impact factor: 53.242

Review 5.  Plant-based production of biopharmaceuticals.

Authors:  Rainer Fischer; Eva Stoger; Stefan Schillberg; Paul Christou; Richard M Twyman
Journal:  Curr Opin Plant Biol       Date:  2004-04       Impact factor: 7.834

Review 6.  Antibody production.

Authors:  John R Birch; Andrew J Racher
Journal:  Adv Drug Deliv Rev       Date:  2006-05-22       Impact factor: 15.470

Review 7.  Foreign protein degradation and instability in plants and plant tissue cultures.

Authors:  Pauline M Doran
Journal:  Trends Biotechnol       Date:  2006-07-14       Impact factor: 19.536

8.  Approaches to achieve high-level heterologous protein production in plants.

Authors:  Stephen J Streatfield
Journal:  Plant Biotechnol J       Date:  2007-01       Impact factor: 9.803

Review 9.  Therapeutic vaccines for prostate cancer.

Authors:  Christopher P Tarassoff; Philip M Arlen; James L Gulley
Journal:  Oncologist       Date:  2006-05

10.  Function and glycosylation of plant-derived antiviral monoclonal antibody.

Authors:  Kisung Ko; Yoram Tekoah; Pauline M Rudd; David J Harvey; Raymond A Dwek; Sergei Spitsin; Cathleen A Hanlon; Charles Rupprecht; Bernhard Dietzschold; Maxim Golovkin; Hilary Koprowski
Journal:  Proc Natl Acad Sci U S A       Date:  2003-06-10       Impact factor: 11.205

View more
  5 in total

Review 1.  Cancer biologics made in plants.

Authors:  Matthew Dent; Nobuyuki Matoba
Journal:  Curr Opin Biotechnol       Date:  2019-11-27       Impact factor: 9.740

2.  Expression and in vitro function of anti-cancer mAbs in transgenic Arabidopsis thaliana.

Authors:  Ilchan Song; Yang Joo Kang; Dae Heon Kim; Mi Kyung Kim; Kisung Ko
Journal:  BMB Rep       Date:  2020-04       Impact factor: 4.778

3.  Expression and In Vitro Function of Anti-Breast Cancer Llama-Based Single Domain Antibody VHH Expressed in Tobacco Plants.

Authors:  Se Ra Park; Jeong-Hwan Lee; Kibum Kim; Taek Min Kim; Seung Ho Lee; Young-Kug Choo; Kyung Soo Kim; Kisung Ko
Journal:  Int J Mol Sci       Date:  2020-02-17       Impact factor: 5.923

4.  Endoplasmic reticulum retention motif fused to recombinant anti-cancer monoclonal antibody (mAb) CO17-1A affects mAb expression and plant stress response.

Authors:  Ilchan Song; YangJoo Kang; Young Koung Lee; Soon-Chul Myung; Kisung Ko
Journal:  PLoS One       Date:  2018-09-24       Impact factor: 3.240

5.  A Plant-Derived Antigen-Antibody Complex Induces Anti-Cancer Immune Responses by Forming a Large Quaternary Structure.

Authors:  Deuk-Su Kim; Yang Joo Kang; Kyung Jin Lee; Lu Qiao; Kinarm Ko; Dae Heon Kim; Soon Chul Myeung; Kisung Ko
Journal:  Int J Mol Sci       Date:  2020-08-05       Impact factor: 5.923

  5 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.