Literature DB >> 28149043

Molecular modeling of NK-CT1, from Indian monocellate cobra (Naja kaouthia) and its docking interaction with human DNA topoisomerase II alpha.

Pathikrit Bandopadhyay1, Soma Halder2, Mrinmoy Sarkar2, Sujay Kumar Bhunia2, Sananda Dey2, Antony Gomes3, Biplab Giri2.   

Abstract

A 6.76 kDa molecular weight cardio and cytotoxic protein of 60 amino acids in length called NK-CT1, was purified from the venom of Indian monocellate cobra (Naja kaouthia) by ion-exchange chromatography and HPLC as described in our earlier report. Therefore it is of interest to utlize the sequence of NK-CT1 for further functional inference using molecular modeling and docking. Thus homology model of NK-CT1 is described in this report. The anti-proliferative activity of the protein, binding with human DNA topoisomerase-II alpha was demonstrated using docking data with AUTODOCK and AUTODOCK MGL tools. Data shows that M26, V27 and S28 of NK-CT1 is in close contact with the nucleotides of the oligonucleotide, bound with topoisomerase-II alpha complex.

Entities:  

Keywords:  NK-CT1; Naja kaouthia; docking; human DNA topoisomerase II alpha

Year:  2016        PMID: 28149043      PMCID: PMC5267952          DOI: 10.6026/97320630012105

Source DB:  PubMed          Journal:  Bioinformation        ISSN: 0973-2063


Background

Snake venom consists of a large number of biologically active peptides, proteins, non-proteins, macromolecules as well as several metallic elements. It is an abundant source of many toxins including cardiotoxins, neurotoxins, myotoxins, dendrotoxins, haemorrhagins, fibrinolytic enzymes and PLA2s as some major components. Cytotoxins or cardiotoxins are a group of polypeptides (60–70 amino acid residues) present in elapidae family of snake having diversified pharmacological actions such as haemolysis, depolarization of muscles [1], muscle fusion, selective killing of certain type of tumor cells, inhibition of protein kinase C and muscle contraction [2]. Cytotoxins have the ability to damage a wide variety of cells including the cancerous types by targeting lysosome [3]. Calmette et al. (1933) had first reported the anticancer property of snake venom [4]. Since then a number of research studies have been carried out regarding the anticancer activities of snake venoms. Earlier we reported the cardiotoxic and cytotoxic effects of the crude venom of Indian monocellate cobra, Naja kaouthia [5]. Later, it was demonstrated that the cardiotoxic and cytotoxic activities were due to the presence of the protein NK-CT1 in the venom [6]. Research study by Bhowmik et al. (2013) [7] had shown that PEGylated gold nanoparticle conjugated with NKCT1, GNP-NKCT1, possesses significant and selective anticancer activity, likely by inducing programmed cell death through mitochondrial and lysosomal pathways. Topoisomerase II alpha plays a key role in DNA replication and hence, is a target for several chemotherapeutic agents. Its primary function is to alter DNA topology from its super-coiled form to a more exposed (partiallly uncoiled) form by inducing single strand DNA breaks and simaultaneously passing another intact double helix through the gap. Etoposide is an important chemotherapeutic agent that is used to treat wide spectrum of human cancers. It has been used clinically for more than two decades and remains one of the most highly prescribed anticancer drugs in the world. The primary target for etoposide is topoisomerase II alpha [8]. In breast cancer, topoisomerase II alpha expression has been linked to cell proliferation and HER2/neu protein over-expression [9]. Therefore, we are interested to investigate the interaction between NK-CT1 and human topoisomerase II alpha to understand whether the enzyme is linked with the anti-proliferative activity of the toxin. Moreover, determination of X-ray crystallographic structure as well as functional characterization of biological active site of NK-CT1 has not been reported till date. Therefore, in the present study our attempt is to derive the 3-dimensional (3-D) structure of this protein from its primary amino acid sequence and its docking interactions with human topoisomerase II alpha for the identification of the specific amino acid residues, which are responsible for its functions.

Methodology

Template Selection

The primary amino acid sequence (60 amino acids) of NK-CT1, as already reported in our earlier study [6], was used for protein blast search (BLASTP 2.2.29) [10] as query against PDB database using BLOSUM80 matrix having gap costs as existence = 10 and extension=1 and using compositional score matrix alignment [11] to scale all substitution scores by an analytically determined constant, while leaving the gap scores fixed. This procedure was adopted to get more accurate E-value rather than standard un-scaled score. Based on the obtained results, the templates were selected for homology modeling considering the lowest E-value with the query sequence and >30% identity. Uniprot Blast was performed with the primary amino acid sequence of NK-CT1 as query, using BLOSUM62 matrix, having threshold value of 10 and allowing gap and filtering the low complexity region to find out the family of NK-CT1.

Conserved Domain Analysis by CDD

Sequence of NK-CT1 was analysed in CDD database (Conserved Domain Database) of NCBI to find out the span and composition of conserved protein sequence region present in it.CDD database is a resource for the annotation of protein sequences with the location of footprints of conserved domain, and functional sites which are inferred from these footprints. Proteins similar to the query are grouped and scored by architecture [12]. The CD-Search service uses RPS-BLAST, which stands for "Reverse Position-Specific BLAST" that uses the query sequence to search a database of pre-calculated ‘Position Specific Scoring Matrices’ (PSSMs), and report significant hits in a single pass.

Homology Modeling using SWISS MODEL

The protein structure of NK-CT1 was modeled using SWISS MODEL server [13,14,15]. The resultant model was selected based on the lowest QMEAN 4 score. The selected model was checked for its stereo-chemical quality using QMEAN4 &6 and was assessed by different tools present in SWISS MODEl server. At the initial run the database returns 64 template hits. Template selection was done by Blast with lowest E-Value cut off 2e-10 to up to 4 e-34 [10,11] and HHBlits [16] was performed against the SWISS-MODEL template library. A total of 54 templates were found with there corresponding QMEAN4 score [17,18] which is a Z- score, composite score for prediction of model quality based on energy profile, C-beta, torsion, solvation and all atom. Models were built based on the targettemplate alignment using Promod-II [19]. Finally, using a force field regularized the geometry of the resulting model. After completion of the modeling the database returns the modeled structures [20] with there corresponding QMEAN4 score [17, 18]. Prediction of the model quality using QMEAN4 score showed that the predicted model falls within the most favorable range for composite Z-score of a model (QMEAN4 score) that lies between -1 to +1and has the QMEAN4 score 0.00 in comparison to the QMEAN4 scores of other models that were generated (based on other template) by the SWISS MODEL server (Data not shown).

ASA versus residue Number plot

Accessible surface area or solvent accesibility of amino acids in a protein helps for localization of active sites. A characteristic two-dimensional spiral plot of solvent accessibility provides a convenient graphical view of residues in terms of their exposed surface areas. In addition sequential plots of bar charts are also provided by the tool for each amino acid residues with the color coding corresponding to there location i.e. either in the surface or in the core.ASA plot of NK-CT1 was done by ASAView a database and tools for the solvent accessibility representation in proteins [21].

Phyre2 Analysis for Prediction of Mutational Sensitivity, Prediction of Receptor Binding Site

Phyre2 (Protein Homology/analogY Recognition Engine V 2.0) [22] was used for the prediction of receptor binding site, mutational sensitivity of the protein NK-CT1. Phyre2 is a web based service that is used for protein structure prediction with template identity score and confidence score indicating the quality of the model.

Electrostatic distribution of the modeled surface

The electrostatic distribution of the modeled 3D structure of NK-CT1 was analysed by UCSF Chimera [23], a highly extensible programme for analysis of molecular structure. It uses C++ code for color calculations. Electrostatic surface mapping of NK-CT1 was performed for analysis of charge distribution and charge related properties of molecules and the surface of NK-CT1 was color coded as per the Coloumb’s law.

Motif Prediction by ProFunc

ProFunc server [24] was used for the prediction of motiff for the protein NK-CT1 and to know which residues are involved in the motiff formation. PROMOTIF [25] analysis was performed (a tool nested under ProFunc database) for the identification of biochemical functions of NK-CT1 from its three dimensional structure using both sequence and structure based methods for prediction of motifs present in NK-CT1, which includes supersecondary structures i.e. beta turns, 310 helices, beta hairpins.

Docking of NK-CT1 by AUTODOCK

NK-CT1 was docked with human topoisomerase-II alpha by AUTODOCK 4.2.6 [26] using Lamarckian genetic algorithm [27] implemented in the programme suite to identify appropiate binding modes and conformations of the ligand molecules. In this docking study NK-CT1 molecule was treated as ligand and topoisomerase molecule as receptor. Gasteiger charges were added and the rotatable bonds were set by the AutoDock tools. Polar hydrogen atoms were added and Kollaman charges were assigned to the protein using AutoDock tools (ADT). The grid map was constructed using Autogrid (a package nested in AUTODOCK) centered on the macromolecule with a gridbox size 90X90X90 Å3 with grid spacing 0.938 Å. The Lamarckian genetic algorithm, the pseudo-Solis and wets methods were applied for minimization using default parameters. Binding energy, torsional energy, intermolecular energy, number of Hbonds and RMS value were recorded in each ligand bound conformations. The docked conformations that were generated after docking were selected based on their binding energy and corresponding figure was developed from Graphics User Interface of AUTODOCK MGL Tools.

Results & Discussion:

NK-CT1 protein was isolated from Naja kaouthia venom which belongs to Elapidae family of snakes and has cardiotoxic and cytotoxic activity which was reported earlier by our research group [6]. It was observed that crude venom from Indian Monocellate cobra has prominent anticancer effect on carcinoma, sarcoma and leukemia both in vitro and in vivo models [5]. The protein (6.7Kda) was isolated by HPLC from snake venom and the amino acid sequence was determined as: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNKTVPVKRGCID VCPKNSLVLKYVCRCN. But no such research studieshave reported till date regarding derivation of 3 dimensional strucutre of NKCT1. Research study by Roly et al. (2014) [28] had also shown the functional characterization and prediction of structure of bungarotoxin from B. fasciatus snake. Ruggieri et al. (2011) [29] had done the homology modelling and subsequent functional characterization and strucutre/function comparision of phytotoxic protein PcF from Phytophthora cactorum.Therefore in this study, an attempt has been made for homology modelling of NK-CT1 from its primary amino acid sequence and also to identify the residues that are responsible for maintainining the different biological activities of this protein and also to unveil its antiproliferative activity whether linked with human topoisomerase II alpha by docking interaction. The conserved domain of NK-CT1was identified using CDD of NCBI and it was observed that the domain of this protein have specific features i.e. receptor binding site comprise of some specific conserved residues i.e. from 3rd residue to 10th residue, 25th, 26th residues and 31st to 35th residues which are involved in receptor binding that was mapped from the conserved domain annotations to the query sequence (NK-CT1). The conserved domain model of NK-CT1 was based on multiple sequence alignments of related proteins spanning a variety of organisms to reveal sequence regions containing the same, or similar, patterns of amino acids. It showed the similarity of its conserved residue with fasciculin (a powerful inhibitor of acetylcholinesterase), bungarotoxin and other three finger toxins (Figure 1; Panel A). It was also observed that the receptor binding is mainly achieved through 2 fingers which are present in the toxin (Figure 1; Panel-B). Uniprot Blast analysis had revelaed that NK-CT1 belongs to snake three finger toxin families, Type IA cytotoxin subfamily. Mutational sensitivity analysis by Phyre2 investigator had shown that C at position 3, 14, 21, 38, 42, 53 and 54, L 20, P 33, R 36 and Y 51 are very much susceptible to mutation (colour coded as red, Figure 3; Panel A). There are 4 disulphide bonds present in NK-CT1 and mostly all are located inside the core of the protein as observed from the ASA plot (Figure 2; Panel B), so mutation of cysteine leads to loss of its structural stability. We also observed that C 3, F 10, 25 and 26th M and 31st residue (T) to 35th residue (K) constitute the receptor binding site (Figure 3; Panel B). It was interesting to observe that in the receptor binding site K 35, R 36 are present of which R 36 is susceptible to mutation and the residues comprising recpetor binding site are the part of the conserved domain (Refer above to conserved domain analysis by CDD). Surface analysis of the NK-CT1 (Figure 2; Panel B) by ASA-View showed that 31st T, 35th K and 36th R are located outside suggesting the fact that these residues may be involved in receptor binding which supports our previous analysis of receptor binding site in Phyre2. Electrostatic distribution by UCSF Chimera [23] showed that NK-CT1 has more positive charge residues (indicated as blue, Figure 3; Panel C) on the outer surface suggesting the fact that the residues are the part of the conserved domain which have specific functionalities i.e. receptor binding. Type II toposiomerase is required for chromosome seggregation by introducing negative supercoiling of DNA by double strand break in DNA and therefore serves as a prime targets for different cancers [8]. In breast cancer, topoisomerase II alpha expression has been linked to cell proliferation and HER2/neu protein overexpression [9]. NKCT1 molecule was docked with human topoisomerase-II alpha (bound to oligonucleotide) and ten possible interaction sites were found where NK-CT1 can bind with this protein. Out of the ten possible interaction sites, the specific site was selected having the least binding energy (Table 1). The total intermolecular energy of the docked complex was: - 13.78Kcal/mol and lowest RMSD value from the reference structure is 6.7Å in compare to the other conformations (Table 1) and it was observed that NK-CT1 interacts with the core of DNA binding sites of topoisomerase - II alpha. The interactions analysis of AutoDock Suite reveals that this protein interacts with the oligonucleotide molecule bound with the topoisomerase II alpha. It was observed that V 27, M 26, K35, F 10, P 8, T 31, V 7 and S 28 are in close contact with the receptors and also M 26, V 27 and S 28 are in close contact with the nitrogenous base of the oligonucleotide (Table 2) which is complexed with DNA topoisomerase-II alpha (Figure 4). It supports our hypothesis that NK-CT1 shows its antiproliferative action by interacting with the core DNA binding region of human DNA topoisomerase-II alpha and corelates with our present analysis as all these residues (except 28th S are the components of conserved domain which is involved in receptor binding.
Figure 1

Conserved Domain analysis of NKCT1. (A) The Multiple sequence alignment of the Conserved Domain summary shows 10 of the most diverse members from the cluster of sequences that were used to create a domain model. Red color residues are highly conserved while blue color residues are less conserved; lower case grey color residues are unaligned residues. On the left side of the sequence alignment the blue color residues are corresponding accession number of the sequences. Highlighted residues are representing the conserved sequence pattern characteristic to domain. (B) Structure of 2 fingers of the conserved domain of NKCT1 which have similarity with other three finger toxins. NK-CT1 as belongs to 3 fingers toxin subfamily the functional interaction might be achieved by these 2 fingers.

Figure 3

Phyre Investigator analysis for prediction of mutational sensitivity, receptor binding site, rotamers and clashes of the modeled protein NK-CT1, residues are color coded in the model according to that of specific features. (A) Result obtained for mutational sensitivity of each amino acid of NK-CT1. Red color indicates that substitution of this amino acid likely to affect function, blue indicates very low sensitivity, it is to be noted that in NK-CT1, C at position 3, 14, 21, 38, 42, 53 and 54, L at 20, P at 33, R 36 and Y 51 are marked as red indicates that mutation in this amino acid will affect function of this protein. (B) Prediction of Receptor binding site of NK-CT1 by Phyre Investigator residues are color coded as red indicates the receptor binding site of NKCT1. It is to be noted that C3, F10, 25 and M 26, T31, V32, P33, V34, K35 are involved in receptor binding. (C) Electrostatic surface distribution of the modeled surface (by UCSF Chimera) the surface were color coded as per the standard protocol of UCSF Chimera, each amino acids were marked with standard code (red for negative potential, to white near neutral, to blue for positive potential).

Figure 2

A) Modeled structure of NK-CT1 based on template 1tgx.b of the resolution of 1.55Å (not shown here) the arrow represents the strand and the rest of the structure have coiled conformation; B) ASA vs residue number plot by ASA-View the colors are coded as Blue for Positive charged residues (R, K) Red for Negative charged residue (D) Green for Polar uncharged residues (G, N, Y, S, T), Yellow for C and Gray for Hydrophobic residues (All others). (C) Relative solvent accessibility plots in the original order of the residues.

Table 1

Energy profile of 10 docked conformations of NK-CT1 and Human DNA topoisomerase II alpha.

No.Binding Energy (KJ/Mol)Intermolecular Energy (KJ/Mol)Internal Energy (KJ/Mol)Torsional Energy (KJ/Mol)Unbound Extension Energy (KJ/Mol)Cluster RMSRef RMS
122.31-13.780.0336.090.0306.7
222.54-13.550.0536.090.050.446.6
323.09-13.01-0.1236.09-0.12027.8
423.29-12.8-0.1336.09-0.13038.09
523.41-12.69-0.1336.09-0.1304.77
623.6-12.49-0.1236.09-0.12043.95
723.62-12.47-0.1336.09-0.13029.16
824.23-11.86-0.0736.09-0.07025.51
924.25-11.850.0436.090.0407.7
1024.38-11.71-0.1136.09-0.11021.45
Table 2

Intermolecular interaction of docked complexes of NK-CT1 with DNA Topoisomerase II alpha, DG, DT, DA= Deoxy Guanine, Thymine and Adenine respectively of the polynucleotide complexed with DNA Topoisomerase II alpha.

NoBondLigand ResidueReceptor ResidueInteraction Constituents
1Hydrogen Lys 12 Asp 1013 LYS12:NZ-ASP1013:OD2
2Close contact Val 27 DA2 VAL27-DA2
3Close contact Met 26 DC11 MET26-DC11
4Close contact Lys 35 Lys 1011 LYS35-LYS1011
5Close contact Phe 10 Glu 663 PHE10-GLU 663
6Close contact Pro 8 Thr 666 PRO8-THR666
7Close contact Thr 31 Lys 656 THR31-LYS656
8Close contact Val 7 Lys 1011 VAL7-LYS1011
9Close contact Ser 28 C: DG4, D: DT13, C: DA5, SER28-DG4,SER28-DT13, SER28-DA5.
10Close contact Met 24 Asn 998 MET24-ASN998
Figure 4

Docked structure of NK-CT1 with DNA Topoisomerase II alpha. Figure was generated in the GUI of AUTODOCK MGL Tools. Docked structure showing the protein NK-CT1 (in ball and stick model) with DNA Topoisomerase II alpha (marked as blue arrow) complexes with oligo-nucleotide (PDB ID: 4FM9) shown in Panel A (marked as white circle). Interaction of NK-CT1 (Panel B marked with white circle) with the DNA Topoisomerase II alpha showed that some specific residues are interacting with the oligo-nucleotide bound to the protein and therefore can be predicted that NK-CT1 interacts with the DNA binding domain of Topoisomerase II alpha.

The 3D structure of NK-CT1 was derived by In Silico method using SWISS Model server [13,14,15] which generates a composite Z-score i.e. Qmean4 score towards quality of the structure prediction using the template (chain B of 1TGX, gamma cardiotoxin isolated from Taiwan cobra venom). The modeled strucutre has the higest posititve QMEAN4 score amongst all other structures that were generated as a resultant of SWISS Model server. To further investigate we performed QMEAN6 scoring function [18] which is a linear combination of six structural descriptors using statistical potentials: The local geometry was analysed by a torsion angle potential over three consecutive amino acids. Predicted structure was checked by ProCheck which showed maximum atoms (86.5%) lie within the core and allowed region of the Ramachandran Plot. It was observed that the modeled structure of NK-CT1 has QMEAN 6 score of 0.595 which falls within the favourable range when it was compared with the structures of the PDB database (data not shown). The modeled structure (Figure 2; Panel-A) was superimposed with the template 1tgx.1.B, it was observed that RMSD value on superposition of the modeled structure of NK-CT1 with the template structure was 0.89 and all the atoms were found to lie within less than 5.0Å the TM score [30] for the superposition was 0.90 which means that the modeled structure of NK-CT1 and template structure was of same fold (Table 1). The secondary structure of the protein was predicted along with motif analysis by PROMOTIF v3.0 [25] which revealed that NK-CT1 has 2 beta sheets, 2 beta hairpins, 1 beta bulge, 5 strands, 1 helix, 5 beta turns and 4 disulphide bonds. K (2nd, 35th and 49th residue), N (4th residue), Y (11th residue), T (13th residue), L (20th and 49th residue), M (24th and 26th residue), I (39th residue) were involved in motif formation. From PROMOTIF analysis it was observed that C 3 is involved in disulphide bond, V 32 and F 10 are involved in beta turn, M 26 is involved in beta hairpin formation, recalling motif is the functional part of the proteins; it can be predicted that these beta turn, beta hairpin and strand of sheet B are involved in receptor binding (data not shown). So it can be predicted that this residues, which constitute a motif, achieve receptor binding and anti-proliferative activity of NK CT1.

Conclusion:

The structure of NK-CT1 from the venom of Indian cobra is unknown. Hence we describe a homology model of the protein using its structural features and electrostatic properties. We also describe its binding with the human DNA topoisomerase – II alpha using docking illustrating its potential anti proliferative activity.
  28 in total

1.  Scoring function for automated assessment of protein structure template quality.

Authors:  Yang Zhang; Jeffrey Skolnick
Journal:  Proteins       Date:  2004-12-01

2.  HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment.

Authors:  Michael Remmert; Andreas Biegert; Andreas Hauser; Johannes Söding
Journal:  Nat Methods       Date:  2011-12-25       Impact factor: 28.547

Review 3.  Protein database searches using compositionally adjusted substitution matrices.

Authors:  Stephen F Altschul; John C Wootton; E Michael Gertz; Richa Agarwala; Aleksandr Morgulis; Alejandro A Schäffer; Yi-Kuo Yu
Journal:  FEBS J       Date:  2005-10       Impact factor: 5.542

4.  The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling.

Authors:  Konstantin Arnold; Lorenza Bordoli; Jürgen Kopp; Torsten Schwede
Journal:  Bioinformatics       Date:  2005-11-13       Impact factor: 6.937

5.  Protein function prediction using local 3D templates.

Authors:  Roman A Laskowski; James D Watson; Janet M Thornton
Journal:  J Mol Biol       Date:  2005-08-19       Impact factor: 5.469

6.  Venom of Indian monocellate cobra and Russell's viper show anticancer activity in experimental models.

Authors:  Anindita Debnath; Uttora Chatterjee; Minati Das; Joseph R Vedasiromoni; Aparna Gomes
Journal:  J Ethnopharmacol       Date:  2006-12-28       Impact factor: 4.360

7.  Protein structure prediction on the Web: a case study using the Phyre server.

Authors:  Lawrence A Kelley; Michael J E Sternberg
Journal:  Nat Protoc       Date:  2009       Impact factor: 13.491

Review 8.  A case study of cardiotoxin III from the Taiwan cobra (Naja naja atra). Solution structure and other physical properties.

Authors:  T K Kumar; C S Lee; C Yu
Journal:  Adv Exp Med Biol       Date:  1996       Impact factor: 2.622

9.  AutoDock4 and AutoDockTools4: Automated docking with selective receptor flexibility.

Authors:  Garrett M Morris; Ruth Huey; William Lindstrom; Michel F Sanner; Richard K Belew; David S Goodsell; Arthur J Olson
Journal:  J Comput Chem       Date:  2009-12       Impact factor: 3.376

10.  CDD: conserved domains and protein three-dimensional structure.

Authors:  Aron Marchler-Bauer; Chanjuan Zheng; Farideh Chitsaz; Myra K Derbyshire; Lewis Y Geer; Renata C Geer; Noreen R Gonzales; Marc Gwadz; David I Hurwitz; Christopher J Lanczycki; Fu Lu; Shennan Lu; Gabriele H Marchler; James S Song; Narmada Thanki; Roxanne A Yamashita; Dachuan Zhang; Stephen H Bryant
Journal:  Nucleic Acids Res       Date:  2012-11-28       Impact factor: 16.971

View more
  1 in total

1.  Why there are no effective herbal antidotes against snake venom available in India?

Authors:  Antony Gomes; Sourav Ghosh; Aparna Gomes
Journal:  Indian J Med Res       Date:  2020-06       Impact factor: 2.375

  1 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.