Literature DB >> 26964536

Bioprospecting potential of halogenases from Arctic marine actinomycetes.

Li Liao1, Ruiqin Chen1,2, Ming Jiang3, Xiaoqing Tian4, Huan Liu1,5, Yong Yu1, Chenqi Fan4, Bo Chen6.   

Abstract

BACKGROUND: Halometabolites, an important group of natural products, generally require halogenases for their biosynthesis. Actinomycetes from the Arctic Ocean have rarely been investigated for halogenases and their gene clusters associated, albeit great potential of halometabolite production has been predicted. Therefore, we initiated this research on the screening of halogenases from Arctic marine actinomycetes isolates to explore their genetic potential of halometabolite biosynthesis.
RESULTS: Nine halogenase genes were discovered from sixty Arctic marine actinomycetes using in-house designed or previously reported PCR primers. Four representative genotypes were further cloned to obtain full coding regions through genome walking. The resulting halogenases were predicted to be involved in halogenation of indole groups, antitumor agent ansamitocin-like substrates, or unknown peptide-like compounds. Genome sequencing revealed a potential gene cluster containing the halogenase predicted to catalyze peptide-like compounds. However, the gene cluster was probably silent under the current conditions.
CONCLUSIONS: PCR-based screening of halogenase genes is a powerful and efficient tool to conduct bioprospecting of halometabolite-producing actinomycetes from the Arctic. Genome sequencing can also identify cryptic gene clusters potentially producing new halometabolites, which might be easily missed by traditional isolation and chemical characterization. In addition, our study indicates that great genetic potential of new halometabolites can be expected from mostly untapped actinomycetes from the polar regions.

Entities:  

Keywords:  Actinomycetes; Arctic; Bioprospecting; Halogenase

Mesh:

Substances:

Year:  2016        PMID: 26964536      PMCID: PMC4785625          DOI: 10.1186/s12866-016-0662-2

Source DB:  PubMed          Journal:  BMC Microbiol        ISSN: 1471-2180            Impact factor:   3.605


Background

Actinomycetes are especially important in producing various bioactive secondary metabolites, including well-known antibiotics such as chloramphenicol [1] and anticancer molecules such as rebeccamycin [2]. Actinomycetes isolated from terrestrial environments have been well studied, which results in frequent rediscovery of known natural products [3, 4]. In contrast, marine actinomycetes from the deep ocean or the polar regions are mostly untapped resources [5]. Currently, new actinomycetes have been described from the Arctic and Antarctica, using cultivation-dependent and -independent approaches [6-9]. An increasing number of natural products have been reported from marine actinomycetes as well [5, 10]. To meet the urgent medical needs of drug candidates, advanced approaches are required to improve the efficiency of natural product discovery [11-13]. Generally, similar secondary metabolites are biosynthesized by gene clusters that contain certain homologous genes [14, 15]. The presence of marker genes, such as polyketide synthase (PKS), non-ribosomal peptide synthetase (NRPS) genes and tailoring enzyme genes, may indicate production of certain secondary metabolites. Therefore, PCR-based marker gene screening is an efficient way to find promising natural products from the environment [16]. Halogenation catalyzed by halogenases is an important tailoring step for bioactivities of many natural products [17, 18]. Halogenated natural products span from simple halogenated indoles, terpenes and phenols to complex oligopeptides and polyketides. Halogenated compounds are important sources for new drugs, due to their high diversity in structure and activity. More than 4,700 halogenated compounds have been reported, showing diverse biological activities and structures [19]. Some of them have been used for decades as pharmaceuticals. For example, the well-known antibiotic chloramphenicol [1], the antitumor agent rebeccamycin [2] and the antifugal antibiotic pyrrolnitrin [20] have been used widely in clinic or currently under clinical trials. Therefore, exploration of halometabolites is an important and promising approach to discover new drugs. In addition to potential biotechnological applications, antibiotics including halometabolites are considered to be bacterial weapons for fighting competitors in the indigenous ecosystems or signals regulating the homeostasis of the microbial communities [21]. Therefore, they may also have important ecological functions. Halogenase is a key tailoring enzyme in producing halometabolites in nature and can be used to explore halometabolites. Currently, halogenases can be divided into two types [22]. One type is highly substrate-specific, including flavin adenine dinucleotide (FADH2)-dependent halogenases (FDHs), non-heme FeII/α-ketoglutarate halogenases and SAM-dependent halogenases. The other type is haloperoxidases that generally lack of substrate specificity. FDHs are the major type of halogenases involved in biosynthesis of halometabolites, and are usually indicative of halometabolite types [23-25]. One group of well-studied FDHs is tryptophan halogenases (Trp-halogenases) that regioselectively halogenate tryptophan (e.g., [26-30]). Halogenases from the polar regions and deep sea have been much less investigated than from terrestrial environments and coasts. PCR-based screening of FDHs has been conducted to study marine sponge-associated microbial consortia [31] and actinomycetes from various terrestrial and other environments [32]. FADH2-dependent halogenases have been studied in detail from marine and soil actinomycetes, such as Amycolatopsis [33] and Streptomyces [34], in the context of related gene clusters. However, FDHs from the polar regions are poorly investigated. The Arctic attracts increasing attention due to its unique environmental conditions and strategic importance. Bioprospecting has been carried out in the Arctic for microorganisms in biotechnology [35, 36]. However, few reports have been involved in halogenases. Previously, we detected halogenase genes from Arctic actinomycetes without gene cloning and sequencing [9]. In this study, we screened FDHs from actinomycetes isolated from marine sediments of the high Arctic, and sequenced them for the first time. Novel FDH genes were further cloned to obtain the full coding sequences for analysis. In addition, genome sequencing was performed to discover a cryptic gene cluster predicted to produce an unknown halometabolite. Our study showed that halogenase genes are helpful in bioprospecting Arctic actinomycetes. Great genetic potential of halometabolite production can be expected from the Arctic actinomycetes.

Results and Discussion

Bioprospecting for halogenase-containing actinomycetes

PCR-based screening was very efficient for bioprospecting of halogenase-containing actinomycetes. Nine out of 60 strains were discovered to contain halogenase genes. The 60 investigated actinomycetes strains were mostly Streptomyces, with a few exceptions belonging to Nocardiopsis, Pseudonocardia and Brevibacterium (Additional file 1: Table S1). Moderate frequency of occurrence of halogenases was observed in Arctic actinomycetes, compared with actinomycetes from other environments [16, 32, 37]. The nine strains were distributed at various water depths in the Arctic Ocean (Fig. 1), ranging from shallow (e.g., 514 F at 173 m) to deep (e.g., 597 F at 2,531 m) marine sediments. They grew well at 15 °C in ISPII medium (0.4 % yeast extract, 1.0 % malt extract, 0.4 % glucose), with the optimum temperature around 20 to 25 °C. No correlation between phylogenetic distances and geographic distribution was observed (Fig. 1). The nine halogenase-containing strains were grouped into two genera, Streptomyces (seven strains) and Nocardiopsis (two strains) (Fig. 1). It agreed with previous studies that Streptomyces was the major genus containing halogenases and also one of the most important producers of halometabolites [16, 32, 38]. Nocardiopsis is less commonly found containing halogenases. Indeed, no halometabolites have been reported from Nocardiopsis to the best of our knowledge. However, higher occurrence of halogenases was observed in Nocardiopsis (2 out of 10) than in Streptomyces (7 out of 49) in our study (Additional file 1: Table S1), even though the sample size was not large enough to show statistical significance. In addition, the two Nocardiopsis strains were isolated from deep-sea sediments of the Arctic Ocean. Hence, the detection of two halogenase-containing Nocardiopsis strains is of interest and worthy of further investigation.
Fig. 1

Phylogenetic tree of 16S rRNA genes of halogenase-positive strains and their closest type strains

Phylogenetic tree of 16S rRNA genes of halogenase-positive strains and their closest type strains The closest type cultures of the nine strains are shown in the phylogenetic tree (Fig. 1), sharing 99 to 100 % 16S rRNA gene identities. The seven Streptomyces strains could be clustered into three subgroups in the phylogenetic tree based on 16S rRNA genes (Fig. 1). To identify whether halogenase genes are present in the closely related strains, we searched the NCBI databases for genome and halogenase sequences of them. Only one genome of closely related strains was sequenced, i.e., Nocardiopsis lucentensis DSM 44048(T). However, no halogenase genes were found in the draft genome of Nocardiopsis lucentensis DSM 44048(T) [GenBank: NZ_ANBC00000000.1]. In addition, no halogenase genes were reported from the remaining closely related strains.

Analysis of putative halogenase partial sequences

The nine partial putative halogenase genes were amplified by different degenerative primer pairs (Table 1), with five genes amplified by SZ002/SZ003/SZ005, three genes amplified by Halo-B4-FW/Halo-B7-RV, and one gene amplified by Trp-RW/Trp-RV (Fig. 2). It seems that different primer pairs have unequal efficiency, probably related to primer sequences and the conserved domains targeted. Hence, it suggests that more primers used for screening can improve the opportunity of finding halogenases. In addition, false positives occurred more frequently using the primer pairs Halo-B4-FW/Halo-B7-RV and SZ002/SZ003/SZ005 than using the primer pairs Trp-RW/Trp-RV designed in this study. Screening of halogenase genes only based on electrophoresis of PCR products is not reliable. Further cloning and sequencing are required to confirm the presence of halogenase genes.
Table 1

Degenerative primers used for screening of halogenase genes

PrimerSequence (5´- 3´)Target regionsReference
Halo-B4-FWTTCCCSCGSTACCASATCGGSGAGFPRYHIGES[16]
Halo-B7-RVGSGGGATSWMCCAGWACCASCCGWYWVIPL
SZ002TCGGYGTSGGCGARGCGACCRTCCCGVGEATIP[26]
SZ003TSGGCGGCGGCACYGCSGGMTGGATGGGGTAGWM
SZ005GCCGGAGCAGTCGAYGAASAGGTCDLFIDCSGFR
Trp-FWTCGGSGTSGGCGARGCSACCKTGVGEATFThis study
Trp-RVCGGTRSWCTCCAGCGGCTCGACGAAFVEPLESSG
Fig. 2

Phylogenetic tree of partial halogenase genes based on DNA sequences

Degenerative primers used for screening of halogenase genes Phylogenetic tree of partial halogenase genes based on DNA sequences The nine partially sequenced FDHs could be clustered into two groups based on DNA sequences, Trp-halogenases (I) and non-Trp-halogenases (II) (Fig. 2). High homology was shared by halogenase genes from strains with different phylogenetic affiliation. For example, Streptomyces sp. 514 F shared almost identical partial halogenase gene (phal514) with Nocardiopsis sp. 531 F (phal531). Streptomyces strains 551 F, 545 F and 543 F had nearly identical halogenase partial sequences (phal551, phal545 and phal543). In addition, Streptomyces strains 620 F and 604 F contained 99 % identical partial halogenase sequences (phal620 and phal604). Therefore, halogenases may have complex evolutionary history. Representative halogenase partial genes were compared against the NCBI GenBank database to search for homologs. The partial halogenase of Streptomyces sp. 531 F (pHal531) shared 96 % nucleotide identity and 98 % amino acid identity with Trp-halogenase from Sphingomonas melonis [GenBank: WP_017979780]. The closest relative of the partial halogenase from Streptomyces sp. 623 F (pHal623) was Trp-halogenases from Brevundimonas sp. DS20 (98 % amino acid and nucleotide identities) [GenBank: WP_054765358]. Interestingly, the closest relatives of pHal531 and pHal623 are halogenases from alphaproteobacteria rather than actinomycetes. In addition, these alphaproteobacterial halogenases were either partially cloned or predicted by genome sequencing. Moreover, the alphaproteobacterial halogenases were not located in any potential biosynthetic gene clusters. It raises the question of roles played by halogenases in non-actinomycetes, such as alphaproteobacteria that are not perceived commonly as a natural product-producing group. Whether halogenases in alphaproteobacteria are involved in halometabolite production is still unknown. The closest biochemically characterized halogenases of pHal531 and pHal623 were halogenase RebH from Lechevalieria aerocolonigenes ATCC 39243 [GenBank: CAC93722] [30] and halogenase Thal from Streptomyces albogriseolus [GenBank: ABK79936] [28], sharing less than 40 % nucleotide and amino acid identities. Hence, pHal531 and pHal623 showed some novelty in sequence and probably in physiological roles as well. pHal551, representative of pHal545 and pHal543, had highest homology (99 % nucleotide and amino acid identities) with three tryptophan 6-halogenases of Streptomyces from mangrove soil. These closest strains are Streptomyces fungicidicus strains MGR162 [GenBank: KF425752] and MGR136 [GenBank: KF425746], and Streptomyces griseus subsp. griseus strain MGR054 [GenBank: KF425729]. However, neither genomes of these mangrove strains were sequenced, nor further studies on their halogenases were published. Therefore, no information of potential gene clusters or products could be obtained from these highly identical halogenases. Nevertheless, pHal551 showed significant identities with halogenases known to be involved in biosynthesis of identified halometabolites. For example, pHal551 had 71 % nucleotide identity and 70 % amino acid identity with Thal from Streptomyces albogriseolus [GenBank: ABK79936]. It also showed 75 % nucleotide identity and 70 % amino acid identity with RebH from Lechevalieria aerocolonigenes ATCC 39243 [GenBank: CAC93722]. Therefore, pHal551 may resemble the characterized Trp-halogenases, indicating that similar biosynthesis could occur in strain 551 F. The three non-Trp-halogenases shared high identities with putative halogenases from actinomycetes but low identities with halogenases catalyzing recognized halometabolites. The partial halogenase of Nocardiopsis sp. 597 F (pHal597) shared 98 % nucleotide identity and 97 % amino acid identity with putative halogenases from Streptomyces sp. NRRL F-6628 [GenBank: WP_037845354] and Streptomyces griseus [GenBank: WP_030771994]. However, pHal597 shared only 54 % nucleotide identity and 56 % amino acid identity with the halogenase (Asm12) characterized from Actinosynnema pretiosum [39]. pHal620 and pHal604 shared 99 % nucleotide and amino acid identities with halogenase of Streptomyces sp. L131(2011) [GenBank: JN035304], but were distinct from halogenases involved in biosynthesis of known halometabolites.

Analysis and implication of the full-length halogenase genes

Since the partial halogenases showed promising novelty and diversity, representatives were chosen to clone full coding sequences. Four full-length halogenase genes were cloned based on genome walking of partial sequences from Streptomyces strains 604 F and 551 F, as well as Nocardiopsis strains 597 F and 531 F. Both Nocardiopsis strains and Streptomyces sp. 551 F were isolated from deep-sea sediments from the high Arctic, while Streptomyces sp. 604 F was obtained at a shallower depth. Halogenases were reported to usually occur in gene clusters for biosynthesis of related secondary metabolites. Thus, a phylogenetic tree was built for the four complete halogenases and the previously identified halogenases from known biosynthetic gene clusters (Fig. 3).
Fig. 3

Phylogenetic tree of the full-length halogenases and previous halogenases identified in halometabolite biosynthesis. Phylogenetic tree was built using amino acid sequences. Protein symbols/names, the producing strains, GenBank accession numbers in parentheses, and the corresponding halometabolites underlined were given in order

Phylogenetic tree of the full-length halogenases and previous halogenases identified in halometabolite biosynthesis. Phylogenetic tree was built using amino acid sequences. Protein symbols/names, the producing strains, GenBank accession numbers in parentheses, and the corresponding halometabolites underlined were given in order The complete halogenase gene (hal551) of Streptomyces sp. 551 F was similar to Trp-halogenases involved in biosynthesis of well-known halometabolites. The hal551 gene contained 1,605 bp encoding 534 amino acids. It shared 85 % amino acid identity with multiple putative Trp-halogenases from genome sequencing of Streptomyces and 71 % amino acid identity with Thal from Streptomyces albogriseolus [GenBank: ABK79936] [28]. Thal was a 6-Trp-halogenase that regioselectively catalyzed chlorination or bromination at the 6-position of tryptophan to produce thienodolin, a growth-regulating factor in plants [28]. The phylogenetic tree showed that Hal551 was phylogenetically related to RebH (67 % amino acid identity) from Lechevalieria aerocolonigenes ATCC 39243 [GenBank: CAC93722] [30]. RebH was a Trp-halogenase selectively catalyzing the halogenation of 7-position of tryptophan during the biosynthesis of rebeccamycin. In addition, Hal551 clustered with other known Trp-halogenases, which regioselectively acted on the 5, 6 or 7 position of tryptophan. Therefore, Hal551 is predicted to regioselectively catalyze tryptophan to produce final halometabolites. Hal531 was probably a new kind of Trp-halogenase. It lay outside of the identified Trp-halogenases and Hal551 in the phylogenetic tree, but was not related to non-Trp-halogenases. The complete gene still had highest identity with halogenases from alphaproteobacteria, but remotely related to actinobacterial halogenases as shown in the tree (Fig. 3). It indicates that Hal531 likely represents an ancestral form of Trp-halogenases that originated from non-actinomycetes such as alphaproteobacteria. However, this hypothesis requires further investigation. Since the function of these closely related halogenases in alphaproteobacteria is unknown, it is of interest to examine the roles of Hal531 in Nocardiopsis sp. 531 F. Hal597 was a non-Trp-halogenase that implied the potential of halometabolite biosynthesis of strain 597 F. The complete gene consisted of 1,203 bp encoding 400 amino acids. Hal597 had highest amino acid identity (98 %) with two putative halogenases in the draft genomes of Streptomyces sp. NRRL F-6628 [GenBank: WP_037845354] and Streptomyces griseus NRRL F-5618 [GenBank: WP_030771994]. The two Streptomyces genomes were highly similar, especially the two contigs (contig 32 of strain NRRL F-6628 and contig 44 of strain NRRL F-5618) containing the halogenases. However, no information on the two Streptomyces genomes as well as the halogenases has been published in the literature. In addition to the unidentified putative halogenases, Hal597 shared 54 % amino acid identity with the halogenase (Asm12) from Actinosynnema pretiosum subsp. auranticum ATCC 31565. Asm12 was identified in the biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin [39]. The phylogenetic tree also showed that Hal597 clustered with Asm12 with 100 % bootstrap support. Ansamitocin was 19-membered macrocyclic lactams, with chlorine at position C-19 of an aromatic ring. The biosynthetic gene cluster of ansamitocin was split into two parts, which is uncommon. Further investigation of hal597 in the context of genome would provide more information on its possible gene cluster and potential products. Hal604 was predicted to be related to peptide-like halometabolite biosynthesis. The complete gene was 1,443 bp in length encoding 480 amino acids, highly similar with the halogenase gene previously cloned from this strain in our lab [40]. Hal604 shared 99 % amino acid identity with two putative halogenases in genomes of Streptomyces sp. GBA 94–10 [GenBank: ESQ01308] and Streptomyces sp. PVA 94–07 [GenBank: ESQ07118] isolated from a sponge. The two draft genomes were highly similar and contained almost identical halogenases as well as same flanking genes. The halogenases were located in putative gene clusters which probably produce glycopeptide-like secondary metabolites, as analyzed in antiSMASH [41]. In addition, Hal604 had 58 % amino acid identity with two halogenases of Actinoplanes sp. ATCC 53533, which were identified in the biosynthesis of the sulfated glycopeptide UK-68,597 [42]. Moreover, Hal604 clustered with halogenases involved in biosynthesis of vancomycin [33], balhimycin [43], teicoplanin [44], A40926 [45] and complestatin [46], with 100 % bootstrap support in the tree. These products were all built from peptides and modified by halogenation and glycosylation, except complestatin that was a heptapeptide without glycosylation. In addition, halogenation occurred on the benzene rings derived from amino acids of the above peptide-like macrocyclic compounds. Taken together, Hal604 was expected to function in a similar way in the biosynthesis of peptide-like macrocyclic compounds. Since peptide-like macrocyclic natural products are promising in antibacterial activity and other bioactivities, Streptomyces sp. 604 F is worthy of further investigation of natural products and the potential gene clusters. However, no halometabolites were detected under the regular conditions using HPLC-TOF MS (High-Performance Liquid Chromatography Time-of-flight Mass Spectrometry) analysis (Additional file 2). In addition, qRT-PCR failed to detect the expression of hal604 under the same conditions (Additional file 2). Therefore, the HPLC-TOF MS and qRT-PCR data suggested that hal604 was probably silent under the examined conditions.

Genome mining for target gene cluster

The failure in detection of predicted halometabolites and expression of hal604 requires further genomic investigation to detect potential halogenase-containing gene cluster in strain 604 F. Genome was sequenced using Illumina platform. The gap closure and manual correction of the draft genome are still in progress. As expected, a potential gene cluster containing hal604 was predicted by using the antiSMASH program. The gene cluster was annotated as in Table 2, containing PKS, modular NRPS genes and genes encoding modification enzymes such as halogenase Hal604. The predicted product of the hal604-containing gene cluster was a peptide-derived molecule, corresponding to the prediction based on Hal604 alone. Further investigations of the hal604-containing gene cluster are planned to identify the potential halometabolite and its biosynthesis. As an example, it demonstrated that bioprospecting based on halogenase and genomic data mining is promising to discover strains with halometabolite biosynthesis potential. It is especially powerful to discover hidden products usually missed in traditional chemical isolation, since most encoding gene clusters are silent under normal conditions. In addition, halogenases identified in this study could be used in combinatorial biosynthesis to produce new compounds with halogen modification. This was demonstrated previously in PyrH and Thal that halogenate at 5 and 6 positions of tryptophan respectively. Co-expression of PyrH and Thal with rebeccamycin biosynthetic genes produced new derivatives with novel halogenation [47].
Table 2

Annotation of the potential halogenase-containing biosynthetic gene cluster

ORFAnnotation
1cysteine synthase
2mbtH-like protein
3halogenase (Hal604)
4condensation domain-containing protein
5AMP-dependent synthetase and ligase
6enoyl-CoA hydratase
7chalcone and stilbene synthase domain protein (PKS)
8cytochrome P450
9phosphopantetheine-binding domain containing protein
10condensation domain-containing protein (NRPS)
11cytochrome P450
Annotation of the potential halogenase-containing biosynthetic gene cluster

Conclusions

New halogenases with indications of potential halometabolite production were discovered from Arctic marine actinomycetes. It showed that halogenase gene-based bioprospecting allowed rapid discovery of microbial strains with potential in halometabolite production. In addition, it could increase the robustness of halometabolite discovery from cryptic or silent gene clusters. Furthermore, it suggested that Arctic marine actinomycetes were promising targets for discovering new halogenases and halometabolites. It encourages further investigation of halometabolite biosynthetic gene clusters and their products from the almost untapped polar microorganisms.

Methods

Strains and 16S rRNA gene analysis

A total of 60 actinomycetes strains previously isolated and kept in our lab from marine sediments at various depths (173 m to 2531 m) of the Arctic, sampled during the Third Chinese Arctic Scientific Expedition in 2008, were used for halogenase gene screening (Additional file 1: Table S1). The strains were previously isolated using serial dilution and plating on ISPII agar plates with nalidixic acid (15 μg ml−1). The plates were incubated at 15 °C for a few weeks. Colonies were streaked on new agar plates for purification. Purified single colonies were cultured in ISPII liquid medium at 15 °C. Genomic DNA was extracted using the gDNA Bacteria Kit (BioDev-Tech Co., Beijing). Universal bacterial primers 27 F (5´-AGAGTTTGATCCTGGCTCAG-3´) and 1492R (5´-GGTTACCTTGTTACGACTT-3´) were used to amplify 16S rRNA genes. PCR products with the expected size of approximately 1,500 bp were purified using the GENEray Agarose Gel DNA Purification Kit (GENEray Biotechnology Co., Shanghai) and cloned into pMD18-T vectors (TaKaRa). Positive clones of each PCR product were sequenced using 27 F/1492R primers. The resulting 16S rRNA gene sequences were searched against the EzTaxon-e database (http://eztaxon-e.ezbiocloud.net/). Sequences were aligned using the ClustalW algorithm in MEGA 6.0 [48], and phylogenetic trees were constructed accordingly, using the neighbor-joining method with 1,000 bootstrap replicates. Bootstrap values less than 50 were not shown.

PCR-based screening for putative halogenase genes

Three primer pairs were used to amplify halogenases (Table 1), including two previously designed primer pairs, Halo-B4-FW/Halo-B7-RV [16] and SZ002/SZ003/SZ005 [26], and a new primer pair specific for Trp-halogenases (Trp-FW/Trp-RV) designed in this study. Primers Halo-B4-FW/Halo-B7-RV and SZ002/SZ003/SZ005 targeted FADH2-dependent halogenases at different conserved regions (Table 1). Degenerate primers Trp-FW/Trp-RV were designed based on the alignment of known Trp-halogenases PrnA from Streptomyces viridochromogenes [GenBank: WP_037891957] and Streptomyces rimosus subsp. rimosus ATCC 10970 [GenBank: ELQ80637], PyrH from Streptomyces rugosporus [GenBank: AFV71318] and Streptomyces hygroscopicus subsp. Jinggangensis TL101 [GenBank: YP_007697383], and Thal from Streptomyces albogriseolus [GenBank: AHD24351] and Streptomyces toxytricini [GenBank: ADW94630]. Each 50 μL PCR mixture contained 1 × PCR buffer (without Mg2+), 1.5 mM MgCl2, 0.2 mM dNTPs, 0.5 μM each primer, 0.2 μg genomic DNA, and 1 U Taq DNA polymerase in final concentration. The touchdown PCR was programmed as follows: 3 min at 95 °C for 1 cycle; 30 s at 95 °C, 45 s at (Tm + 10) °C, 1 min at 72 °C for 10 – 15 cycles; 30 s at 95 °C, 45 s at (Tm or Tm – 5) °C, 1 min at 72 °C for 25 cycles; and 10 min at 72 °C for 1 cycle. PCR products with the expected size of 450 – 900 bp were cloned into pMD18-T vectors (TaKaRa) and sequenced. The resulting sequences were searched against the GenBank database using the BLASTx algorithm. Sequences that did not match to halogenase genes in the database were defined as false positives. DNA sequences of the partial halogenases were aligned with the ClustalW algorithm in MEGA 6.0 to construct a neighbor-joining tree.

Cloning of full coding sequences of representative halogenases

Two approaches of genome walking were used to amplify the upstream and downstream of partial halogenase genes, including modified thermal asymmetric interlaced (TAIL)-PCR [49, 50], and SiteFinding-PCR [51]. Nested specific primer sets designed for genome walking were listed in Table 3. PCR products with expected size were purified and cloned into pMD18-T vectors for sequencing. The resulting sequences were assembled with the partial halogenase gene sequences to obtain full coding sequences identified by using the NCBI ORF Finder (http://www.ncbi.nlm.nih.gov/gorf/gorf.html). The complete halogenase genes were then analyzed by BLASTn and BLASTp against the GenBank database. Neighbor-joining tree was built for complete halogenases cloned in this study with previous halogenases catalyzing the halogenation of known secondary metabolites.
Table 3

Primers designed for genome walking in this study

GeneUpstream primers (5´- 3´)Downstream primers (5´- 3´)
531 F531USP1: GCTCCTTCAGCCAGAATTGATG531DSP1: GATTACGCCTATCATTTCGATGCCTC
531USP2: ATCTTGCCGAAGCCGTGGATGT531DSP2: CGCATCGTCGCCGCCAACCGCC
531USP3: ATCTTGCCGAAGCCGTGGATGT531DSP3: ATGGCGACCTGTTCATCGACTGCTC
551 F551USP1: GTGCTTGCGCTGGAACCAGTAGT551DSP1: GGCTGGGCGTGGAAGATCCCGATGC
551USP2: CGAACGGGTGGTAGAAGTGGTCCGGC551DSP2: GCGAGTTCTGCGAGATGTGGGGGCTGG
551USP3: CATCTTGAAGCTGGCGTTGCACTCCCGCA551DSP3: GCCTGGGTGAAGAACGTGGTCAGCATCG
597 F5GSP597-1: CCTTACGGGCGTGGTCCAGCA3GSP597-1: GCCCACGTACTGACACAGGCCCAT
5GSP597-2: CCACCTGCGTCAGTGAACTCG3GSP597-2: GCCGCCTACGTCGTCGACTCCAGC
5GSP597-3: CCATGTAGGGCAGCAGAGACTC3GSP597-3: AGCGGAAAGATCGCCAAGGCATAC
604 F604USP1: CGCTCACGGACCACGACGCCCTT604DSP1: GGTGCGCTTCGAGGACGAGAACGG
604USP2: GAGGAGCATCTGGTCGAACTTCAT604USP3: TGCCGCCCCGCTTCTTGACGAAC604DSP2: ACGATGGACTCCAGTCGCCGCTACTCGGACTTCTTCCAG604DSP3: GACGCGGGCTGGTACTGGTACAT
Primers designed for genome walking in this study

Genome sequencing and biosynthetic gene cluster identification

The genome of strain 604 F was sequenced on the Illumina HiSeq 2000 platform at the Beijing Genomics Institute (BGI). Sequences were assembled using SOAPdenovo software [52]. Secondary metabolite biosynthetic gene clusters were predicted by using the Antibiotics and Secondary Metabolites Analysis Shell (antiSMASH) [41].

Sequence accession numbers

Sequences produced in this study have been submitted to GenBank under the accession numbers below: 16S rRNA gene sequences (KJ017969, KP998446 – KP998453), halogenase gene sequences (KF597545 – KF597550, KP998454 – KP998458), and the biosynthetic gene cluster containing the halogenase gene hal604 (KT439326).

Declarations

Ethics approval and consent to participate

Not applicable.

Consent for publication

Not applicable.

Availability of data and materials

The datasets supporting the conclusions of this article are included within the article and its additional files.
  49 in total

1.  Molecular cloning and sequence analysis of the complestatin biosynthetic gene cluster.

Authors:  H T Chiu; B K Hubbard; A N Shah; J Eide; R A Fredenburg; C T Walsh; C Khosla
Journal:  Proc Natl Acad Sci U S A       Date:  2001-07-10       Impact factor: 11.205

2.  A regioselective tryptophan 5-halogenase is involved in pyrroindomycin biosynthesis in Streptomyces rugosporus LL-42D005.

Authors:  Susanne Zehner; Alexander Kotzsch; Bojan Bister; Roderich D Süssmuth; Carmen Méndez; José A Salas; Karl-Heinz van Pée
Journal:  Chem Biol       Date:  2005-04

3.  Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis.

Authors:  Xin-Ying Jia; Zhen-Hua Tian; Lei Shao; Xu-Dong Qu; Qun-Fei Zhao; Jian Tang; Gong-Li Tang; Wen Liu
Journal:  Chem Biol       Date:  2006-06

Review 4.  What's new in enzymatic halogenations.

Authors:  Danica Galonić Fujimori; Christopher T Walsh
Journal:  Curr Opin Chem Biol       Date:  2007-09-18       Impact factor: 8.822

5.  [Cloning and analysis of a halogenase gene of Streptomyces sp. 604F from the Arctic Ocean].

Authors:  Ruiqin Chen; Li Liao; Xiaohua Zhang; Bo Chen
Journal:  Wei Sheng Wu Xue Bao       Date:  2014-06-04

6.  The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species.

Authors:  Margherita Sosio; Sofia Stinchi; Fabrizio Beltrametti; Ameriga Lazzarini; Stefano Donadio
Journal:  Chem Biol       Date:  2003-06

7.  Detection, distribution, and organohalogen compound discovery implications of the reduced flavin adenine dinucleotide-dependent halogenase gene in major filamentous actinomycete taxonomic groups.

Authors:  Peng Gao; Ying Huang
Journal:  Appl Environ Microbiol       Date:  2009-05-15       Impact factor: 4.792

8.  antiSMASH: rapid identification, annotation and analysis of secondary metabolite biosynthesis gene clusters in bacterial and fungal genome sequences.

Authors:  Marnix H Medema; Kai Blin; Peter Cimermancic; Victor de Jager; Piotr Zakrzewski; Michael A Fischbach; Tilmann Weber; Eriko Takano; Rainer Breitling
Journal:  Nucleic Acids Res       Date:  2011-06-14       Impact factor: 16.971

9.  SOAPdenovo2: an empirically improved memory-efficient short-read de novo assembler.

Authors:  Ruibang Luo; Binghang Liu; Yinlong Xie; Zhenyu Li; Weihua Huang; Jianying Yuan; Guangzhu He; Yanxiang Chen; Qi Pan; Yunjie Liu; Jingbo Tang; Gengxiong Wu; Hao Zhang; Yujian Shi; Yong Liu; Chang Yu; Bo Wang; Yao Lu; Changlei Han; David W Cheung; Siu-Ming Yiu; Shaoliang Peng; Zhu Xiaoqian; Guangming Liu; Xiangke Liao; Yingrui Li; Huanming Yang; Jian Wang; Tak-Wah Lam; Jun Wang
Journal:  Gigascience       Date:  2012-12-27       Impact factor: 6.524

10.  Phylogenetic diversity and biological activity of actinobacteria isolated from the Chukchi Shelf marine sediments in the Arctic Ocean.

Authors:  Meng Yuan; Yong Yu; Hui-Rong Li; Ning Dong; Xiao-Hua Zhang
Journal:  Mar Drugs       Date:  2014-03-06       Impact factor: 5.118

View more
  11 in total

1.  Bioprospecting of Novel and Bioactive Compounds from Marine Actinomycetes Isolated from South China Sea Sediments.

Authors:  Na Yang; Fuhang Song
Journal:  Curr Microbiol       Date:  2017-09-16       Impact factor: 2.188

Review 2.  Enzymatic Halogenation and Dehalogenation Reactions: Pervasive and Mechanistically Diverse.

Authors:  Vinayak Agarwal; Zachary D Miles; Jaclyn M Winter; Alessandra S Eustáquio; Abrahim A El Gamal; Bradley S Moore
Journal:  Chem Rev       Date:  2017-01-20       Impact factor: 60.622

3.  Colibrimycins, Novel Halogenated Hybrid Polyketide Synthase-Nonribosomal Peptide Synthetase (PKS-NRPS) Compounds Produced by Streptomyces sp. Strain CS147.

Authors:  Laura Prado-Alonso; Ignacio Pérez-Victoria; Mónica G Malmierca; Ignacio Montero; Elisa Rioja-Blanco; Jesús Martín; Fernando Reyes; Carmen Méndez; José A Salas; Carlos Olano
Journal:  Appl Environ Microbiol       Date:  2021-10-20       Impact factor: 5.005

4.  Biosynthetic Genes for the Tetrodecamycin Antibiotics.

Authors:  Tomas Gverzdys; Justin R Nodwell
Journal:  J Bacteriol       Date:  2016-06-27       Impact factor: 3.490

5.  A Phenotypic and Genotypic Analysis of the Antimicrobial Potential of Cultivable Streptomyces Isolated from Cave Moonmilk Deposits.

Authors:  Marta Maciejewska; Delphine Adam; Loïc Martinet; Aymeric Naômé; Magdalena Całusińska; Philippe Delfosse; Monique Carnol; Hazel A Barton; Marie-Pierre Hayette; Nicolas Smargiasso; Edwin De Pauw; Marc Hanikenne; Denis Baurain; Sébastien Rigali
Journal:  Front Microbiol       Date:  2016-09-21       Impact factor: 5.640

6.  Zunyimycins B and C, New Chloroanthrabenzoxocinones Antibiotics against Methicillin-Resistant Staphylococcus aureus and Enterococci from Streptomyces sp. FJS31-2.

Authors:  Yuhong Lü; Meiyun Shao; Yinyin Wang; Shengyan Qian; Miao Wang; Yingquan Wang; Xiaoqian Li; Yuxin Bao; Chengmin Deng; Changwu Yue; Daishun Liu; Ning Liu; Minghao Liu; Ying Huang; Zehui Chen; Yonglin Hu
Journal:  Molecules       Date:  2017-02-08       Impact factor: 4.411

Review 7.  Bioactivities of Halometabolites from Marine Actinobacteria.

Authors:  Noer Kasanah; Triyanto Triyanto
Journal:  Biomolecules       Date:  2019-06-11

8.  Diversity of tryptophan halogenases in sponges of the genus Aplysina.

Authors:  Johanna Gutleben; Jasper J Koehorst; Kyle McPherson; Shirley Pomponi; René H Wijffels; Hauke Smidt; Detmer Sipkema
Journal:  FEMS Microbiol Ecol       Date:  2019-08-01       Impact factor: 4.194

9.  Estimation of antimicrobial activities and fatty acid composition of actinobacteria isolated from water surface of underground lakes from Badzheyskaya and Okhotnichya caves in Siberia.

Authors:  Irina V Voytsekhovskaya; Denis V Axenov-Gribanov; Svetlana A Murzina; Svetlana N Pekkoeva; Eugeniy S Protasov; Stanislav V Gamaiunov; Maxim A Timofeyev
Journal:  PeerJ       Date:  2018-10-25       Impact factor: 2.984

10.  Salumycin, a New Pyrazolequinone from a Streptomyces albus J1074 Mutant Strain.

Authors:  Kaixiang Tao; Taijia Ye; Mingming Cao; Xiaolu Meng; Yuqing Li; Huan Wang; Zhiyang Feng
Journal:  Molecules       Date:  2020-09-08       Impact factor: 4.411

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.