Literature DB >> 26940770

BK channel inactivation gates daytime excitability in the circadian clock.

Joshua P Whitt1, Jenna R Montgomery1, Andrea L Meredith1.   

Abstract

Inactivation is an intrinsic property of several voltage-dependent ion channels, closing the conduction pathway during membrane depolarization and dynamically regulating neuronal activity. BK K(+) channels undergo N-type inactivation via their β2 subunit, but the physiological significance is not clear. Here, we report that inactivating BK currents predominate during the day in the suprachiasmatic nucleus, the brain's intrinsic clock circuit, reducing steady-state current levels. At night inactivation is diminished, resulting in larger BK currents. Loss of β2 eliminates inactivation, abolishing the diurnal variation in both BK current magnitude and SCN firing, and disrupting behavioural rhythmicity. Selective restoration of inactivation via the β2 N-terminal 'ball-and-chain' domain rescues BK current levels and firing rate, unexpectedly contributing to the subthreshold membrane properties that shift SCN neurons into the daytime 'upstate'. Our study reveals the clock employs inactivation gating as a biophysical switch to set the diurnal variation in suprachiasmatic nucleus excitability that underlies circadian rhythm.

Entities:  

Mesh:

Substances:

Year:  2016        PMID: 26940770      PMCID: PMC4785228          DOI: 10.1038/ncomms10837

Source DB:  PubMed          Journal:  Nat Commun        ISSN: 2041-1723            Impact factor:   14.919


Inactivation gating of ion channels is essential to electrical signalling in most neurons. First characterized in Hodgkin and Huxley's classic studies of the action potential1, since then, several distinct inactivation mechanisms have been identified in Na+, Ca2+ and K+ channels2345. Among voltage-gated K+ channels, inactivation can occur via the classic ‘ball-and-chain' mechanism involving pore occlusion by an intrinsic N-terminal ‘ball' located on the cytosolic side of the α pore-forming subunit6. In contrast, large conductance Ca2+- and voltage-activated BK K+ channels (KCa1.1, KCNMA1) are not intrinsically inactivating78. However, inactivating BK currents have been observed in some central neurons, sensory neurons and neuroendocrine cells91011121314151617. In adrenal chromaffin cells, BK inactivation is mediated by the β2 subunit18 and shares several common features with Shaker N-type inactivation, including a rapid time course and contribution of intracellular domains sensitive to proteolytic cleavage19. Chromaffin cells express both inactivating and non-inactivating BK channels, associated with distinct action potential behaviour20. Yet despite the well-described mechanistic basis, understanding the physiological relevance for BK inactivation has been complicated by other properties conferred by the β2 subunit, including a shift in the voltage dependence of activation and slowing of activation and deactivation kinetics1821. To understand the role of BK channel inactivation in neuronal excitability, we identified a circuit where β2 is expressed22 and where dynamic regulation of the BK current is critical for neural coding, the suprachiasmatic nucleus (SCN) of the hypothalamus232425. The SCN circuit undergoes synchronized daily oscillations in action potential firing frequency26, and circadian behavioural and physiological characteristics are established by the parameters of the SCN circuit rhythm2728. BK channel expression varies over the circadian cycle in both mouse SCN and fly clock neurons24293031. The daily rhythm in BK protein abundance is linked to Per2 (ref. 24), a component of the canonical transcription–translation feedback loop that encodes circadian time32. Correlated with expression levels, SCN neurons exhibit a diurnal difference in steady-state BK current magnitude, with smaller currents recorded during the day and larger currents at night232431. Both loss of BK current at night and aberrant increase in BK current during the day result in disrupted circuit rhythmicity, establishing the diurnal variation in BK current as essential for expressing behavioural rhythms2324252933. Loss of this diurnal rhythm in BK current has been recently linked to degradation of circadian rhythm in aged animals33, underscoring the significance of understanding the mechanisms that drive rhythms in BK channel activity in SCN. Here we report that the β2 subunit produces inactivation of SCN BK channels. Using patch-clamp, long-term action potential, and behavioural recordings, we show that loss of β2 (β2 KO) abolishes the diurnal variation in both BK current magnitude and SCN firing, and disrupts circadian circuit and locomotor rhythmicity. We link these changes in excitability specifically to BK channel inactivation by taking advantage of the modular nature of β2, which allows selective rescue of inactivation via delivery of the isolated β2 N-terminal ‘ball-and-chain' domain. We further reveal that neurons with inactivating BK currents fire faster, have depolarized membrane potentials and increased input resistance, demonstrating that inactivation unexpectedly contributes to the daytime ‘upstate' in SCN neurons by controlling the amount of subthreshold BK current during the inter-spike interval. Thus, inactivation underlies the shift in BK's influence on excitability between day and night, and regulation of this biophysical mechanism is a central node for the circadian regulation of firing in the SCN clock circuit.

Results

β2 regulates SCN circuit rhythmicity and circadian behaviour

The SCN expresses two subunits with the potential to modify BK channel properties, β2 and β4 (ref. 22), but of these, only β2 can cause inactivation of BK currents78. Since β subunits are proposed to tailor BK channel properties and contribute to distinct patterns of excitability across tissues34, to establish the importance of the β2 subunit in the SCN circuit, we made long-term recordings of spontaneous action potential activity from wild-type (WT) and β2 KO SCNs. Individual SCN neurons function as coupled, autonomous oscillators, generating a robust synchronized rhythm in firing in ex vivo cultures (Fig. 1a)2835. β2 KO SCNs had significantly reduced rhythmicity overall (Fig. 1b). This was due to both a decrease in the number of rhythmic recordings, as well as a reduction in the circadian amplitude of the rhythmic recordings (Fig. 1c,d)36. The circadian period of the rhythmic activity was not different (WT, 24.2±1.3 h and β2 KO, 23.4±1.2 h, P=0.8), instead, the reduced circadian amplitude stemmed from decreased action potential activity at the peak (Fig. 1e).
Figure 1

The β2 subunit is required for SCN neuronal firing rhythmicity and circadian behaviour.

(a) Representative spontaneous action potential activity recorded for 3 days on a multielectrode array from WT SCNs. Firing rate shows a robust peak-to-trough difference. (b) β2 KO SCN activity. Firing amplitude and rhythmicity were reduced. (c) The percentage of recordings within the SCN exhibiting rhythmic firing is decreased in β2 KO compared with WT and β4 KO SCNs (n=8, 11 and 10 SCN slices, respectively). (d) χ2 periodogram analysis of action potential activity. χ2 circadian peak amplitudes were reduced in β2 KO compared with WT and β4 KO SCNs. (e) Multiunit firing frequency from the peak and trough of rhythmic recordings, or from arrhythmic recordings. β2 KO firing is reduced during the peak. (f) Locomotor wheel running activity from a representative WT mouse. (g) β2 KO actogram. (h) χ2 periodogram analysis of wheel behaviour. Dotted line denotes 3,000 (amplitude). (i) β2 KO mice re-entrained to a 6 h phase advance of the light–dark cycle faster than WT. (j) Exposure to a light pulse at CT16 caused a greater phase delay in β2 KO compared with WT. Representative actograms for i and j are in Supplementary Fig. 1. All values are mean±s.e.m. *P<0.05, Bonferroni post hoc (c–e) or t-test (i–j).

Alterations in the SCN circuit were correlated with disrupted circadian behaviour (Fig. 1f–g). Like SCN circuit activity, circadian behavioural amplitudes were reduced in β2 KO mice (Fig. 1h; Supplementary Table 1). Decreased circadian behavioural amplitudes are associated with a more labile pacemaker233738, and consistent with this, β2 KO mice re-entrained about a day faster to a 6-h phase advance of the light:dark cycle and had augmented responses to a phase-shifting light pulse (Fig. 1i,j; Supplementary Fig. 1; Supplementary Table 1). Taken together, these results suggest that β2 is important for the circadian patterning of action potential activity in the SCN circuit, and that this mechanism is required for proper circadian rhythmicity in the animal as a whole. Furthermore, the circadian alterations were specific to loss of β2, as deletion of the β4 subunit, which is also expressed in SCN22, did not result in significant changes in neuronal firing or behavioural activity (Fig. 1c–e; Supplementary Table 1; Supplementary Discussion).

β2 mediates BK current inactivation in SCN neurons

To determine the functional relevance of β2 regulation of SCN circuit rhythmicity, we recorded BK currents from SCN neurons using whole-cell voltage clamp. We observed two types of macroscopic BK currents which varied by the amount of current decay observed during the voltage step (Fig. 2a). Currents that exhibited a pronounced decay within 30 ms were termed BKi and had a fractional current ratio (IBK/IBKpeak)<0.7 at +90 mV (Fig. 1b; Supplementary Fig. 2a,b). These BKi currents decayed with time constants of 44±4 ms (at +90 mV, n=13) (Fig. 2c; Supplementary Fig. 2c,d), similar to inactivating BK currents described in other neuronal types1820. Other currents were relatively sustained with little decay, termed BKs (IBK/IBKpeak>0.7). The much slower time course of decay for BKs currents (172±13 ms, n=17; Fig. 2c; Supplementary Fig. 2c) is consistent with non-inactivating BK currents that show a limited attenuation of current due to Ca2+ clearance18. Overall, during the day, most currents were BKi, while at night, most currents were BKs (Fig. 2d). This suggested that the number of neurons exhibiting BKi and BKs currents between day and night SCNs was responsible for the diurnal difference observed in the steady-state BK current magnitude within SCN (Fig. 2e).
Figure 2

BKi and BKs currents in SCN neurons.

(a) Representative BK current traces and macroscopic decay time constants (τinact) for BKi and BKs currents from WT SCN neurons. BK currents were isolated by subtraction with the antagonist paxilline (Methods). (b) Fractional BK current (I30ms/Ipeak at +90 mV) was reduced during the day compared to night in WT neurons, D, daytime recording; N, night time recording. (c) τinact (at +90 mV) is lower for daytime BKi currents compared to night BKs currents in WT neurons. (d) Proportion of neurons with BKi and BKs currents. WT neurons have more BKi currents during the day compared with night. (e) Current density versus voltage relationship for day and night BK currents from WT SCN neurons. The average daytime current magnitude is reduced compared with night. (f) BKi current density is lower than BKs, during the day or at night. All values are mean±s.e.m. n values: WT, day BKi (18), BKs (9) and night BKi (3) BKs (19). *P<0.05, Fisher's exact test (d) or Bonferroni post hoc (e,f).

Supporting this idea, we did not find that daytime BKi currents decayed more rapidly, and thus to a lower fractional current value, compared with night time BKi currents. Instead, the average BKi current density (Fig. 2f) and fractional current values (Supplementary Fig. 2b) were similar between day and night. These observations support a model where the simple summation of BKi to BKs currents is a central factor in the day versus night BK current levels observed across the SCN. Since the β2 subunit produces inactivation of BK channels expressed in heterologous cells and native tissues78183439, we examined β2 levels to determine whether expression of the β2 subunit was correlated with the increased number of BKi currents observed in daytime SCNs. BK complexes were immunoprecipitated from SCNs harvested across the circadian cycle. Although the expression of β2 did not differ across time points (Fig. 3a,b), the relative ratio of β2 associated with the BK α subunit was higher during the day (Fig. 3c), correlated with the higher proportion of BKi currents (Fig. 2d). At night as α expression increased, the ratio of β2:α was lower and consistent with the increased number of BKs currents.
Figure 3

Expression of BK α and β2 in WT SCNs.

(a) BK channel complexes were immunoprecipitated with an anti-BK α subunit antibody from WT SCNs at the indicated time points. Western blot analysis was performed for BK α (top panel), β2 (middle) or α-tubulin (bottom). α-Tubulin westerns (loading control) were obtained by running an equivalent volume of supernatant as was used for the immunoprecipitation. Protein was also harvested from α+β2 subunits co-expressed in HEK293 cells (positive control) or from β2 KO SCNs (negative control). ZT, zeitgeber time. Images have been cropped for presentation. Full size images are presented in Supplementary Fig. 3. (b) BK α and β2 band intensities normalized to α-tubulin. α expression increases at night, while β2 expression does not change. Data are the average from four independent timed SCN collections (four SCNs at each timepoint). (c) Ratio of β2:α expression in WT SCNs across the circadian cycle. All values are mean±s.e.m. *P<0.05, Bonferroni post hoc.

To determine whether β2 was required for the macroscopic BKi current decay in SCN, we recorded BK currents from β2 KO neurons. Only BKs currents were observed in β2 KO neurons (Fig. 4a,b; Supplementary Fig. 2a), implicating inactivation as the mechanism for the decay of BKi currents. As a consequence of converting all currents to BKs during the day, the diurnal difference in BK current magnitude was abolished in β2 KO SCNs (Fig. 4c). Although the small number of BKi currents observed in WT neurons at night were also eliminated, the overall night time β2 KO BK current levels remained unchanged. This was expected since the vast majority of currents were already identified as BKs in WT neurons at night. Further consistent with loss of inactivation, the fractional current values and macroscopic current decay time constants were increased in β2 KO during the day, with no change at night (Fig. 4d,e; Supplementary Fig. 2a–c). These results demonstrate that β2 underlies the reduction in steady-state BK current levels during the day and is thereby the central regulator of the diurnal difference in SCN BK current. As a control, we also assayed the expression level and diurnal pattern of the BK channel α subunit in β2 KO SCNs and found no difference (Supplementary Fig. 4a–c), corroborating the alterations in BK current magnitude stemmed from a loss of β2 function and not alteration of BK channel trafficking.
Figure 4

The β2 subunit is required for BKi current decay and the diurnal difference in BK current magnitude in SCN neurons.

(a) Representative BK current traces and macroscopic decay time constants (τinact) for BKs currents from β2 KO neurons. Voltage protocol same as in Figure 2. (b) All currents are BKs from β2 KO SCNs, day or night. (c) β2 KO neurons do not show a day–night difference in BK current density. The β2 KO daytime BK current magnitude is larger than WT, comparable to WT levels at night. (d) The fractional BK current (I30ms/Ipeak) was similar during the day compared with night in β2 KO neurons. (e) τinact values from β2 KO BKs currents are all >100 ms. All values are mean±s.e.m. n values: β2 KO, day (20) and night (20).

β Subunits produce complex effects on BK channel gating, including slowing activation and deactivation, and shifting the voltage dependence of activation to more hyperpolarized potentials783439. However, β2-mediated inactivation is separably mediated by the intracellular N terminus, and transplantation or exogenous application of this domain confers inactivation gating to the BK α subunit in the absence of the β2 subunit7114041. Conversely, mutation of the three residues comprising the hydrophobic ‘ball' (ΔFIW) removes inactivation while leaving other gating properties of β2 intact42. If inactivation is the major determinant of the day versus night difference in steady-state current levels, then selective restoration of inactivation during the day with the isolated N terminus should restore this difference to β2 KO neurons. Alternatively, failure to restore the decreased daytime BK current levels via inactivation with the β2N terminus would suggest that other properties conferred by the β2 subunit are necessary for the daytime decrease in steady-state BK current levels. To test this, we first delivered the β2N terminus (β2N) as a soluble peptide to BK channels expressed in heterologous HEK293 cells (Fig. 5). β2N produced a dose-dependent inactivation, while a peptide harbouring the FIW mutation produced no effect (β2NΔFIW; Fig. 5a–d). The voltage dependence of inactivation with β2N was similar to the intact β2 subunit (Fig. 5e), and τinact values at β2N concentrations above 50 μM were similar to WT BKi currents recorded during the day from SCN neurons (Fig. 5d). We next applied the β2N peptide to SCN neurons via the patch pipette.
Figure 5

The β2N terminus (β2N) causes inactivation of BK currents from α-only channels expressed in heterologous cells.

(a) Representative macroscopic current traces from HEK293 cells expressing BKSRKR channels, a daytime BK variant previously cloned from SCN (ref. 60). β2N (0–100 μM), corresponding to the first 45 amino acids of the N terminus, was dissolved in recording solution and applied to the intracellular side via the patch pipette. (b) Representative currents in the presence of 50 μM β2NΔFIW, a peptide mutating the three residues required for inactivation42. There was no macroscopic current decay with β2NΔFIW. (c) Representative traces from the +90 mV voltage step at each concentration of β2N. The current peaks were scaled to illustrate the dose-dependent speeding of inactivation. (d) τinact values were calculated from the current elicited at +90 mV and plotted as a function of β2N concentration. τinact was plotted for BKi and β2 KO SCN BK currents for cross-comparison. (e) τinact versus voltage for BK channels co-expressed the β2 subunit, or with 50 μM β2N. There is no difference in the voltage dependence of activation using the isolated β2N compared with the intact β2 subunit. All values are mean±s.e.m. For currents from HEK293 patches, n=4 at each concentration of β2N or β2NΔFIW peptide. For currents from daytime SCN neurons, BKi (n=18) and β2 KO+β2N (n=10).

In β2 KO SCN neurons, application of β2N, but not β2NΔFIW, restored the macroscopic decay and reduced the fractional current (Fig. 6a; Supplementary Fig. 2a). The voltage dependence of inactivation and τinact values with β2N in β2 KO were similar to WT BKi currents recorded during the day (β2 KO+β2N at +90 mV: 40±4 ms, n=20, Fig. 6a; Supplementary Fig. 2c,d). Furthermore, β2N decreased β2 KO BK current levels back to levels comparable to WT neurons (Fig. 6b), without affecting the voltage dependence of BK current activation (Supplementary Fig. 5) or other voltage-activated outward currents (Supplementary Fig. 6). The restoration of daytime BK current levels by β2N support the conclusion that inactivation is the critical function of the β2 subunit that underlies its role in driving the diurnal variation in BK current properties in SCN.
Figure 6

β2N rescues inactivation and restores daytime BK current levels in β2 KO SCN neurons.

(a) Representative traces showing rescue of the macroscopic BK current decay in β2 KO neurons with 50 μM β2N applied intracellularly. 50 μM β2NΔFIW did not rescue the current decay. Voltage protocol same as in Fig. 2. (b)Application of β2N reduced the BK current density in β2 KO neurons to levels comparable to WT. β2NΔFIW had no effect on BK current levels. WT and β2 KO I–Vs re-plotted from Figs 2 and 4 for cross-comparison. n values: WT (27); β2 KO (20); β2 KO+β2NΔFIW (18); β2 KO+β2N (20). All values are mean±s.e.m. *P<0.05, Bonferroni post hoc.

Inactivation controls daytime membrane properties and firing

If inactivation is required for the diurnal difference in BK currents, then loss of the β2 subunit or selective rescue of inactivation with β2N should alter neuronal activity. To test this, we recorded spontaneous action potentials from WT and β2 KO SCN neurons. WT neurons fire at higher frequencies during the day and decrease firing at night (Fig. 7a,b). Neurons with BKi currents fired faster than those with BKs currents regardless of time of day, suggesting that inactivation may play a role in setting firing rate. Furthermore, the relative difference in firing between BKi and BKs neurons during the day was as large as the net diurnal difference in firing across the SCN (Fig. 7b), suggesting BK inactivation may be fundamental to the diurnal regulation of firing rate. Consistent with this, β2 KO neurons did not exhibit a day–night difference in firing rate, stemming from a marked reduction in daytime firing (Fig. 7b,c). To verify that the reduced firing, which was correlated with larger BK currents in β2 KO neurons (Fig. 6b), was due to BK, the BK channel blocker paxilline was applied. The reduced firing in β2 KO neurons was reversed by paxilline (Fig. 7b), demonstrating that BK channels were responsible for the altered excitability in β2 KO neurons.
Figure 7

Loss of β2 eliminates the diurnal difference in firing rate, and rescue of inactivation with β2N restores daytime firing rates in SCN neurons.

(a) Spontaneous action potential activity from representative day (BKi) and night (BKs) WT neurons. Dotted line (a,c,d) denotes −50 mV. (b) In WT SCNs, BKi neurons fired at higher frequencies than BKs, similar to the average day–night difference in firing. β2 KO neurons did not exhibit a diurnal difference in frequency, and during the day, fired at levels similar to WT night. Application of β2NΔFIW to daytime β2 KO neurons had no effect on frequency, but β2N increased firing rate to WT levels. (c) Day (BKs) and night (BKs) β2 KO neurons. (d) Day β2 KO neurons with 50 μM β2N (BKi) or 50 μM β2NΔFIW (BKs). All values are mean±s.e.m. n values: WT: BKi (17), BKs (10), day (17), night (20); β2 KO: day (19), night (19), β2NΔFIW (20), β2N (19), β2N/pax (8), and pax (8).

These results corroborate the reduced peak firing observed in SCN circuit recordings (Fig. 1e). In addition, these data may also explain why loss of BK currents during the day has apparently little effect on WT firing rates2443. A detectable change in firing after BK block in WT neurons may be precluded under standard daytime conditions when two-thirds of SCN neurons undergo BK inactivation. Following this idea, application of β2N, but not β2NΔFIW, increased daytime β2 KO firing rates back to WT levels (Fig. 7b,d). β2N had no further consequences on firing beyond that of blocking the BK current with paxilline (Fig. 7b), demonstrating that the restoration of firing with β2N acts selectively through BK channels. These results suggest that inactivation normally removes BK currents from influencing action potential firing rate during the day. Illustrating this in another way, β2N could also aberrantly suppress BK current (Fig. 8a–c) and elevate firing if applied to WT neurons at night (Fig. 8d), underscoring the basis for the normal reduction in the number of BKi currents found in the SCN at night.
Figure 8

β2N can confer inactivation to WT neurons at night.

(a) Representative macroscopic traces from WT neurons at night showing a typical BKs current, and a BKi current resulting from application of 50 μM β2N. Voltage protocol same as in Fig. 2. (b) β2N reduced the night time current density in WT neurons to daytime levels. WT day and night data re-plotted from Figs 2 and 4 for cross-comparison. (c) The proportion of BKi currents increased significantly with β2N (P=0.0001, Fisher's exact test). (d) β2N increased night time firing to daytime levels. WT day and night data re-plotted from Fig. 7 for cross-comparison. All values are mean±s.e.m. n Values: WT, day (27); WT, night (22); and WT+β2N, night (20). *P<0.05, Bonferroni post hoc.

What membrane properties does BK inactivation regulate to facilitate daytime firing? A central node for circadian regulation of action potential frequency is the balance of subthreshold excitatory and inhibitory currents that bring the resting membrane potential closer to the firing threshold during the day, or further from threshold at night2644. K+ currents are proposed to be central regulators of the day–night difference in firing by regulating the daily transition between the daytime ‘upstate' and night time ‘downstate'44454647. These states are designated by differences in the subthreshold membrane properties, with the most attention focused on the increase in night time K+ current associated with hyperpolarization of the membrane and lower input resistance44454748. BK channels comprise a component of this upregulated K+ current, and loss or block of BK currents causes depolarization of the baseline membrane potential and hyperactive firing at night232425. However, block of BK currents also depolarizes the membrane potential during the day434749, suggesting a role for BK channels in daytime excitability not previously explored. Thus to determine whether BK inactivation makes a converse contribution to the daytime reduction in K+ current that defines the ‘upstate' that is required for higher frequency firing, we compared membrane parameters from neurons during the day and night, and with loss of β2 or restoration of inactivation. First, we found that BKi neurons had inter-spike membrane potentials ranging from −36 to −51 mV, while BKs neurons ranged from −47 to −54 mV during the day. Loss of inactivation in β2 KO neurons resulted in hyperpolarization of the inter-spike membrane potential compared with WT BKi neurons (−57±1.4 mV versus −50±1.1 mV, respectively; P<0.001, t-test). This shift could be rescued by β2N (−52±0.8 mV), but not β2NΔFIW (−56±1.5 mV; one-way ANOVA, P=0.04; Bonferroni post hoc, P<0.05 for BKi versus β2 KO or β2NΔFIW), suggesting that BK channel inactivation affects membrane potential during the inter-spike interval. To further address this, resting membrane potential (Vm) and input resistance (Ri) recordings were made in the presence of tetrodotoxin to block action potential activity. Daytime neurons had more positive Vm and higher Ri, while night time neurons had more hyperpolarized Vm and lower Ri (Fig. 9a,b), consistent with previous studies4548. The average daytime membrane potential (−48±0.8 mV) was dominated by the increased number of BKi neurons, which had more positive Vm (−47±0.4 mV) and higher Ri (1.4±0.06 GΩ) than BKs neurons (−55±1.7 mV and 0.7±0.1 GΩ, respectively; Fig. 9a,b). This suggests less current would be required to elicit an action potential in BKi compared with BKs neurons.
Figure 9

BK current inactivation alters membrane potentials and input resistance in SCN neurons.

(a,b) Resting membrane potentials (a) and input resistance (b) measured in 1 μM tetrodotoxin to block action potentials. Conditions with inactivation (BKi, β2 KO/β2N, and WT day overall) had more depolarized Vm and higher Ri than BKs, night, or β2 KO. All values are mean±s.e.m. n values: WT: day/BKi (9), day/BKs (5), day (25), night (18) and β2 KO: β2NΔFIW/day (11), β2NΔFIW/night (10), β2N/day (12). *P<0.05, Bonferroni post hoc.

If inactivation of BK currents is involved in the changes in Vm and Ri between BKi and BKs neurons, then loss of β2 should also alter these parameters. We found that the Vm and Ri of daytime β2 KO neurons was more similar to WT neurons at night (Fig. 9a,b), suggesting β2 is required for the daytime ‘upstate'. Furthermore, β2N restored the Vm and Ri values in β2 KO neurons back to values comparable to WT, establishing the sufficiency for inactivation of the BK current to convert the daytime membranes to pro-excitable. Although β2 can also affect excitability by shifting the voltage dependence of activation and slowing activation and deactivation gating1821 (Supplementary Discussion), the data presented here affirm that these functions are not directly involved in the diurnal regulation of membrane properties that control firing frequency in SCN. The effect of inactivation on resting membrane potential and input resistance predicts that inactivation of BK currents would occur during the inter-spike interval. To demonstrate this, we recorded BK currents from traditional voltage step commands across the subthreshold range of membrane potentials, as well as BK currents evoked by SCN action potential commands (Fig. 10; Supplementary Fig. 7). BKs current–voltage relationships showed that daytime BK current activated at voltages more positive than −60 mV (Fig. 10a,b). There was 5–12 pA of current evoked in the subthreshold range, between the average resting and threshold potentials of SCN neurons (−55 to −40 mV). Night time subthreshold BK currents (BKs) were also larger than the net daytime BK current (Supplementary Fig. 7a). In contrast, daytime BKi neurons had significantly reduced current in the subthreshold voltage range (Fig. 10a,b). Consistent with data obtained from voltage steps, using daytime SCN action potential commands delivered at the normal daytime firing frequency, the amount of BK current activated during the inter-spike interval was negligible in BKi neurons compared with BKs neurons (Fig. 10c,d) or at night (Supplementary Fig. 7b,c). BK currents evoked at the peak of the action potential command were also reduced in BKi neurons compared with BKs neurons during the day (Fig. 10e) or at night (Supplementary Fig. 7d). In parallel experiments using daytime action potential commands applied to channel complexes expressed in HEK293 cells (Supplementary Fig. 8a–j), the subthreshold current was reduced in patches containing BK/β2 or BK/β2N compared with α-only channels (Supplementary Fig. 8f–i).
Figure 10

Steady-state and action potential-evoked BKi currents are reduced compared to BKs in SCN neurons.

(a) Representative macroscopic BK current traces from daytime WT neurons in response to a subthreshold voltage protocol (−60 to −30 mV in 5 mV steps). BK currents were identified as BKi or BKs from a maximally activating step to +90 mV (as in Fig. 2). (b) Current–voltage relationship showing significantly more activation of BKs current above −60 mV compared to BKi. (c) Pre-recorded action potential commands (top) were used to elicit BK currents from BKi or BKs neurons. From a holding potential of −150 mV to remove inactivation completely, cells were stepped to the inter-spike potential (−48 mV) with a sequence of three action potential commands as depicted (Peak, 8 mV; t1/2, 5.5 ms; and AHP/antipeak, −54 mV). Arrow, the subthreshold current level in d was taken just before the second action potential command. (d,e) Average subthreshold BK current density from the inter-spike interval (d) or at the peak of the action potential (e). n values for (a–d): WT: day/BKi (9), day/BKs (5). (f) BK current as a function of conditioning potential in SCN neurons. Representative macroscopic BK current traces from β2 KO neurons during the day with 50 μM β2NΔFIW or β2N. Neurons were held at −90 mV for 150 ms to remove inactivation, and then stepped to a conditioning potential for 100 ms to allow channels to transition into the inactivated state, followed by a maximally activating step to +90 mV. (g) The peak BK current elicited from the +90 mV step was plotted as a function of the conditioning potential. β2N causes a reduction in current, but no reduction is observed in the absence of inactivation with β2NΔFIW. n=5 for each condition. All values are mean±s.e.m. *P<0.05, Bonferroni post hoc.

To further demonstrate that inactivation could affect BK current levels at these subthreshold voltages in SCNs, β2 KO neurons were held at a conditioning voltage for 100 ms, corresponding to the shortest inter-spike intervals encountered in spontaneously firing SCN neurons, followed by a step to +90 mV to elicit a maximal BK current response (Fig. 10f). Inactivation delivered via β2N reduced the maximal BK current elicited following conditioning voltages in the subthreshold range, compared with β2 KO cells treated with β2NΔFIW (Fig. 10f,g). Further depolarization of the conditioning potential resulted in progressive current reduction that was dependent on the presence of inactivation (Fig. 10f,g). Similar results were obtained with BK channels expressed in heterologous cells with the intact β2 subunit or with β2N (Supplementary Fig. 8a,b). These results suggest that inactivation can reduce BK current under conditions similar to the native inter-spike interval and provide a basis for understanding the effect of BK inactivation on the resting membrane potential and input resistance. The data further propose that because some BK current would be inactivated before an action potential, the current evoked by an action potential would be reduced. This would be expected to occur during the day in BKi neurons. To test this, we quantified the peak BK current evoked by daytime action potentials applied to SCN neurons (Fig. 10c,e) and to BK/β2 or BK/β2N channels expressed in heterologous cells (Supplementary Fig. 8e–h,j). The action potential-evoked BK current was reduced in BKi versus BKs neurons (Fig. 10e) and in BK/β2 or BK/β2N conditions in HEK293 cells compared with α-only channels (Supplementary Fig. 8j). Taken together, these data support a model where BK current inactivation is necessary during the day to regulate the membrane parameters that initiate firing (membrane potential and input resistance), while concurrently reducing the BK current activated during an action potential. This idea further predicts there would be little difference in the action potential waveforms of BKi versus BKs neurons, an observation confirmed by analysis of daytime action potential parameters (Supplementary Fig. 9). β2-mediated inactivation thus comprises an essential switch that shifts membrane properties between day and night states by inhibiting or permitting subthreshold BK current activation.

Discussion

The circadian patterning of neuronal excitability is an evolutionarily conserved feature of time-encoding circuits2650. In SCN neurons, which fire relatively slow, spontaneous action potentials characteristic of pacemaker neurons49, the balance of currents during the inter-spike interval is proposed to be the predominant regulator of firing rate and a major node for circadian regulation26444548. Correlated with the increased number of BKi currents in SCN during the day, most neurons have a more depolarized resting membrane potential that is closer to threshold (ΔV ∼7 mV, from our data), increasing the likelihood of firing an action potential. At night, and correlated with the shift to BKs currents, the hyperpolarizing shift places the membrane potential further from threshold (ΔV ∼12 mV), reducing excitability. The amount of current required to produce this shift is small (∼5 pA), owing to the high input resistance of SCN neurons, and the balance can be tipped either by altering the excitatory currents that bring the membrane potential closer threshold, or the inhibitory currents that take the membrane away from threshold. Recently, the identity of the channel underlying the persistent Na+ current that provides the depolarizing drive on excitability was identified as the leak Na+ channel NALCN51. However, the identity of the K+ channels counterbalancing the excitatory current has been uncertain, particularly during the day when SCN neurons undergo a dramatic reduction in K+ current444549. Although abrogation of one type of K+ current during the day, the fast delayed rectifier, has also been shown to decrease firing frequency, the reduced firing stems from slower action potential repolarization and not from depolarization of the resting membrane potential52. Consequently, a direct test of whether the daily shift in submembrane K+ currents is required to drive the day–night difference in action potential firing has been elusive. In this study we provide surprising evidence linking alterations in BK current with the daytime increase in input resistance, depolarization of the membrane and higher frequency firing. BK currents were previously thought to mainly play a night time-restricted role as part of the surge of K+ current that results in the firing nadir244445. The less significant role for BK channels in setting daytime frequency was attributed to a decrease in expression of the pore-forming α subunit. However, in the β2 KO, the intact circadian pattern of α expression was insufficient to support normal diurnal variation in BK current or SCN firing, suggesting there must be other mechanisms that limit BK channels from influencing daytime membrane properties. We demonstrate that inactivation, achieved through β2-dependent regulation of BK channel biophysical properties between day and night, is the central mechanism that changes the influence of BK channels on membrane properties between day and night. Inactivation facilitates the daytime membrane ‘upstate' by reducing the BK current between spikes that would normally inhibit action potential initiation. Inactivation also reduces action potential-evoked current, and the sum of these two mechanisms effectively removes BK channels from influencing daytime excitability. In β2 KO SCN neurons, the absence of BK inactivation during the day results in passive membrane properties that look much like night time membranes. Correspondingly, with β2N, restoration of inactivation is both necessary and sufficient to recapitulate the Vm and Ri properties that define the daytime membrane state. Importantly, the identification of this biophysical mechanism to functionally reduce a K+ current suggests that the balance of excitatory and inhibitory currents is more actively regulated during the day than previously thought45. Moreover, the disruption of circadian behaviour in the absence of the β2 subunit underscores the importance of both BK inactivation, and the diurnal variation in SCN submembrane properties, in the regulation of circadian rhythmicity. As such, BKi currents comprise an electrophysiological signature for a previously undetected class of essential oscillator in SCN that makes a vital contribution to circadian behaviour. Even so, the residual rhythmicity in β2 KOs hints that neuronal heterogeneity contributes redundant mechanisms to circadian behavioural rhythmicity (Supplementary Discussion), and it remains to be determined how SCN neurons without inactivating BK channels balance their daytime currents to control firing, and what separable contribution these cells make to circadian behaviour. Given that the BK current must be functionally reduced by inactivation, what is the relevance of the daytime clock-linked decrease in BK α subunit expression2430? Such differences in ion channel expression across the circadian cycle are broadly proposed to be central to rhythmicity26, but an explicit mechanism that translates channel expression differences into action potential activity has not been established. In this study, we showed β2 KO SCNs retained the normal day–night difference in BK α expression, yet still displayed disrupted BK steady-state current levels and action potential firing, demonstrating that circadian differences in the BK α subunit alone are insufficient to drive rhythmicity. Our data instead suggest a model in which the clock-linked changes in α expression control the ratio of β2:α. Since expression of β2 does not vary appreciably between day and night, the higher daytime β2:α ratio facilitates inactivation in the majority of SCN neurons, permitting transition to the ‘upstate'. At night, inactivation is overcome by increased α subunit expression, reducing the β2:α ratio and facilitating the ‘downstate'. In support of this hypothesis, aberrantly increasing daytime BK expression reduces inactivation in the SCN (Supplementary Discussion). The data in SCN also provide a framework for understanding the physiological relevance of BK channel inactivation, which is too slow to produce substantial BK current decay during a typical central nervous system action potential53. In other neurons where higher frequency firing prevails, BK inactivation is thought to contribute to spike frequency adaptation, which also integrates over timeframes longer than a single action potential101517. In SCN neurons, which exhibit depolarized membrane potentials and slow spontaneous firing, the results here suggest that enough channels undergo inactivation, or remain cumulatively inactivated, during the inter-spike interval (100–500 ms) to impact the input resistance and resting membrane potential. Given τinact values of 35–100 ms in BKi neurons, steady-state inactivation may be most relevant for setting the subthreshold BK current level during the inter-spike interval. SCN neurons have been shown to undergo subthreshold Ca2+ oscillations4954, raising the possibility that Ca2+ influx independent of the action potential could contribute to BK channel activation, and consequently BK inactivation, during the inter-spike interval. In addition, the restoration of firing rate with β2N reveals that inactivation mediated by the N terminus is sufficient for this role. N-type inactivation typically occurs from the open state78, but BK channels may also inactivate from closed states, affecting the amount of steady-state current55. Thus, the data in this study reveal a surprising twist to how cells use BK channels to regulate excitability. While BK channels perform diverse roles spanning excitable and non-excitable cells, in the CNS they are mostly known for regulating firing frequency by underlying the fast AHP565758. Here we show in SCN, BK current activated outside of the action potential is potentially the major contributor to frequency regulation, making dynamic regulation of subthreshold BK current via inactivation a novel role for BK channels. In summary, although the combination of BKi and BKs expressing cells has been observed within other tissues18, the significance for how these currents work together to set the ensemble properties underpinning physiological function is not yet apparent53. In SCN, the cycling between predominantly BKi currents during the day and predominantly BKs currents at night suggests that partnering with the β2 subunit generates a hardwired mechanism linked to the intrinsic clock to dynamically disengage BK channels from regulating action potentials during one phase of the circadian cycle.

Methods

Mice

WT, β2 KO (KCNMB2, gift from C. Lingle), β4 KO (KCNMB4, gift from R. Brenner), and Kcnma1 mice were maintained on inbred C57BL/6 background and genotyped as previously described182459. KCNMB2 floxed mice are available at The Jackson Laboratory (Stock no. 028416). Male and female mice were used (3 weeks to 5 months old) and were group housed separated by sex until experimental procedures as indicated. Day time points were collected from mice housed on a standard 12 h light, 12 h dark cycle (12:12 LD), and night time points were collected from mice housed on a reverse 12:12 LD cycle. All procedures involving mice were conducted in accordance with the University of Maryland School of Medicine Animal Care and Use Guidelines and approved by the IACUC Committee.

Organotypic slice culture

Brains were harvested from postnatal day 4 mice, and the hypothalamus was blocked and sectioned into 300 μm coronal slices using a manual chopper (Stoelting, Wood Dale, IL, USA). Slices containing SCN nuclei were transferred onto Millicell filters (Millipore, Billerica, MA, USA) and cultured as interface explants in a CO2 incubator as described23. After 2 days, 20 μM cytosine β-D-arabinofuranoside (ara-C, no. C6645; Sigma) was added to inhibit glial proliferation, and the media was changed every 3 days thereafter.

Multielectrode array recordings

After 7 days in culture, organotypic slices were cut from the surrounding membrane, inverted over the 64-electrode grid, and adhered to 0.1% polyethylenimine and collagen-treated P210A probes (Alpha MED Scientific, Osaka, Japan). Probes were placed on a MED CO2P connector headstage, sealed with a vacuum-greased coverslip, and maintained in a humidified 5% CO2 incubator at 37 °C for the duration of the recordings. Media changes were maintained every 3 days. Signals from all electrodes on the probe were collected simultaneously with the 64-channel integrated amplifier (Alpha MED Scientific) and analysed as described previously23. Five-second data samples were collected every 5 min at 20 kHz in Conductor v3.1f (Alpha MED Scientific) and filtered at 100 Hz. Spontaneous extracellular action potentials from visually identified electrodes within the SCN were discriminated offline using threshold-based event counting. Circuit analysis was performed on each slice from three cycles of activity at all electrodes within the SCN. The multiunit spontaneous action potential activity from each electrode located within the SCN was classified as rhythmic or arrhythmic. For rhythmic recordings, a 2 h moving window average was applied to the raw data to calculate the daily firing rate peak, and the ‘day' firing rate value was the average of activity for 2 h centred around the peak for each recording. Firing rate at the trough was calculated from 2 h of activity at the nadir between two peaks. Arrhythmic firing was calculated as the average firing across the whole cycle. Circadian amplitude was reported as the χ2 periodogram peak value (Clocklab; Actimetrics, Wilmette, IL, USA). τ, the length of the circadian period of the neural activity rhythm, was determined as the highest peak above the 99% confidence interval of a χ2 periodogram.

Circadian behavioural rhythms

For locomotor rhythms, mice (3–5 months old) were housed individually in cages containing a running wheel for 10 days in LD and 16 days in constant darkness (DD). Activity was sampled every 10 min in ClockLab software (Actimetrics). Actograms were constructed by double-plotting consecutive days of activity over the recording period. Circadian period and amplitude were determined from 10 days of wheel running activity in DD in Clocklab software as described previously2324. For re-entrainment experiments, after 7 days of stable entrainment, the LD cycle was phase advanced by 6 h. The response was calculated as the number of days to stable re-entrainment. After keeping mice in DD for 8 days, phase shifts in response to light pulses were calculated as the number of hours between the activity onset regression fits before and after a 30-min light pulse delivered in early subjective night (CT16). Alpha was determined as the length of time an animal had consolidated activity using default settings with manual adjustment, with rho defined as the portion of the cycle outside of alpha. Bouts were calculated using default settings. Data was excluded from mice that failed to run on wheels for two consecutive days.

Western blots

A single block of hypothalamus containing the SCN (∼2 mm) was harvested at the indicated time points from mice (2- to 3-months old). Four micrograms solubilized protein from individual SCNs were loaded per lane. Densitometry of BK doublet band (1 μg ml−1 L6/60 mouse monoclonal α-BK antibody, Neuromab; University of California, Davis, CA, USA) to DM1α anti-tubulin (1:75,000; Sigma T-9026) was performed as described previously23 and presented as a proportion of ZT20. Three independent circadian cycle tissue harvests were performed for each condition. For immunoprecipitation, individual SCNs (∼50 μg of protein) were pre-cleared by incubation with 20 μl TrueBlot anti-rabbit Ig IP beads (Rockland Immunochemicals; Limerick, PA, USA) for 2 h at 4 °C (ref. 18). Protein samples were centrifuged at 13,200 r.p.m. for 30 min to precipitate the beads. Supernatant was collected and mixed with 1 μg of anti-BK α subunit antibody (anti-KCa1.1, #1184–1200, Alamone Labs; Jerusalem, Israel) and rotated for 2 h at 4 °C. 50 μl TrueBlot anti-rabbit Ig IP beads were added, and the mixture was rotated overnight at 4 °C, centrifuged at 13,200 r.p.m. for 30 min to precipitate beads, and the supernatant was discarded. Beads were washed three times and resuspended in 20 μl lysis buffer. Protein was run on a western blot as detailed previously and probed with 1 μg ml−1 anti-BK (L6/60; Antibodies Incorporated; Davis, CA, USA); 1:75,000 anti-α-Tubulin (DM1a; Sigma; St Louis, MO, USA); or 1 μg ml−1 anti-β2 (N53/32; Antibodies Incorporated; Davis, CA, USA). Full size images for western blots are presented in Supplementary Figs 3 and 4.

Acute SCN slice preparation

Mice were sacrificed in the light, at zeitgeber time (ZT) ZT0–2 (day time points) or ZT11–12 (night) from 3- to 6-week-old mice. Brains were rapidly removed and placed into ice-cold sucrose-substituted saline containing the following (in mM): 1.2 MgSO4, 26 NaHCO3, 1.25 Na2HPO4, 3.5 KCl, 3.8 MgCl2, 10 glucose and 200 sucrose. Coronal slices were cut at 300 μm on a VT1000S vibratome (Leica Microsystems, Wetzlar, Germany) at 3–4 °C. Slices containing SCN were recovered for 1–3 h (day) and 17–19 h (night) at 25 °C submerged in oxygenated artificial cerebrospinal fluid (in mM: 125 NaCl, 1.2 MgSO4, 26 NaHCO3, 1.25 Na2HPO4, 3.5 KCl, 2.5 CaCl2 and 10 glucose). Slices containing SCN were transferred to the recording chamber (RC26GLP/PM-1; Warner Instruments, Hamden, CT, USA) with gravity flow bath perfusion of 1–2 ml min−1 oxygenated artificial cerebrospinal fluid at 25 °C. Neurons were visualized with a Luca-R DL-604 EMCCD camera (Andor, Belfast, UK) under IR-DIC illumination on an FN1 upright microscope (Nikon, Melville, NY, USA). Recordings were made from cells in the centre of the SCN. Current- and voltage-clamp recordings were made with a Multiclamp 200B or 700B amplifier and pCLAMP v10 software (Molecular Devices, Sunnyvale, CA, USA). Data were acquired at a 20 or 100 kHz sampling rate. Drugs were delivered to the bath by a computer-controlled pressurized perfusion system (ValveLink 8.2; Automate Scientific, Berkeley, CA, USA) at the concentrations indicated from 1,000 × stocks. Recording windows were at the peak (ZT4-8) and nadir (ZT17-21) of the circadian rhythm in spontaneous action potential firing, corresponding to the ‘day' and ‘night' time points, respectively. Although the action potential frequencies in this study were lower than our previous studies performed at 35° (refs 22, 23), the day–night difference in firing frequency in this study is preserved (Fig. 4a,c). All recordings were made with synaptic transmission intact, unless indicated (Tetrodotoxin was applied for all Vm and Ri measurements, as well as the subthreshold BK currents in Fig. 5). Reported N's are the number of neurons, and data for each condition was derived from 5 to 15 slices (1–6 neuronal recordings per slice).

SCN electrophysiology

SCN neurons were recorded in whole-cell configuration, first in current-clamp mode to collect action potential data, then switched into voltage clamp mode to obtain macroscopic voltage-activated outward K+ currents. Electrodes (4–7 MΩ) were filled with internal solution, in mM: 123 K-methanesulfonate, 9 NaCl, 0.9 EGTA, 9 HEPES, 14 Tris-phosphocreatine, 2 Mg-ATP, 0.3 Tris-GTP, and 2 Na2-ATP, pH adjusted to 7.3 with KOH. The electrode solution was adjusted to 305 mosM with glucose, and bath osmolarity was 300 mosM. This internal solution supports BK current activation and spontaneous firing2349. After GΩ seal and whole-cell break-in, membrane properties were elicited from a +20 mV voltage step from a holding potential (Vh) of −90 mV. Access resistance was verified to be<25 MΩ with<±5% change at the end of the recording (on average ∼15 MΩ). Series resistance was compensated at 80%. For action potentials, data were acquired in 10 s sweeps and filtered at 10 kHz. Frequency was calculated as the average of each sweep. Baseline potential was determined as the average inter-spike potential in the presence of spontaneous activity. Template-based action potential analysis was performed in Clampfit 10 (Molecular Devices) to obtain action potential peak and half-width (t1/2) values. Afterhyperpolarization (AHP) peak was determined as the peak negative value of the action potential, and AHP amplitude was the baseline membrane potential minus the AHP peak value. Threshold analysis was performed by taking the derivative of each action potential event in the 10 s segment to determine the inflection in the voltage trajectory (Clampfit). This method gives a set of values per neuron with lower standard deviation than automated analysis using dV/dt of 4–5 V s−1 (ref. 49). Action potential analysis was performed blind with respect to genotype or time point. In voltage-clamp mode, total voltage-activated K+ currents were elicited from a holding potential of −90 mV, stepping from −110 to +90 mV for either 30 or 150 ms in 20 mV increments. BK currents were isolated by focal application of the BK antagonist paxilline (10 μM), and subtracting currents after paxilline from the initial current. The effective concentration of paxilline in the recoding chamber was 3.75 μM. Currents were averaged from three to five voltage families. Current–voltage (I–V) relationships were constructed from the current level at 30 ms from each potential, unless noted otherwise (peak or steady-state values). Current density values were obtained by normalizing to cell capacitance, which did not differ between day and night (7.0±0.5 and 6.8±0.4 pF, respectively) or between WT and β2 KO (7.7±0.7 and 7.1±0.4 pF, n=27, 20, respectively). Voltage values were adjusted for the liquid junction potential of 10 mV. τinact values were calculated from single exponential fits of the macroscopic current decay from the +90 mV step for 150 ms (Clampfit, Molecular Devices). BKi and BKs currents were categorized as described using the current ratio at 30 ms from +90 mV step (BKi<0.07, BKs>0.07), corresponding to τinact values<110 ms. For passive membrane properties, whole-cell recordings were performed as above using the same internal solution as for current- and voltage-clamp recording, with tetrodotoxin (1 μM) in the bath. After break in, the membrane potential was recorded, followed by current injection steps (0 to −25 pA, in 5 pA increments). Input resistance was calculated as the linear slope of the voltage. For experiments where currents were categorized as BKs or BKi, cells were switched to voltage-clamp mode after recording Vm and Ri, and BK currents were isolated and τinact values were obtained as described in the previous section. For BKi and BKs recordings of Vm, Ri, subthreshold SCN BK currents, and BK currents evoked by action potential commands, recordings were performed in 1 μM tetrodotoxin. After recording Vm and Ri as described above, cells were switched to voltage-clamp mode and stepped from a holding potential of −90 to +90 mV for 150 ms to determine BKi and BKs by τinact as described previously. After holding at −150 mV for 100 ms, cells were stepped from −60 to −30 mV (in 5 mV increments), and then stepped back to −150 mV for 100 ms followed by action potential commands. Previously acquired native action potential waveform was obtained from daytime or night time SCN recordings. For day (Fig. 10c) and night (Supplementary Fig. 7), the action potential parameters are indicated in the figure legends. Three sequenced action potentials were applied at the average BKi daytime firing rate (2.25 Hz) or night time BKs firing rate (1 Hz) as depicted in the figures. Current–voltage relationships were plotted, and the action potential-evoked peak and subthreshold currents were normalized to the cell capacitance.

Drugs and β2N peptides

Paxilline and tetrodotoxin (Tocris, Bristol, UK) were prepared as 1,000 × stocks in DMSO and water, respectively. β2N, was synthesized as the first 45 amino acids of the β2 subunit (MTSGRTSSSYRQDEKRNIYQKIRDHDLLDKRKTVTALKAGED) (GenScript, Piscatawa, NJ, USA)41. β2NΔFIW was a 42 amino acid peptide with the underlined FIW deletion. Lyophilized peptides were reconstituted in intracellular solution as 100 × stocks and added at the final indicated concentrations.

HEK cell patch-clamp electrophysiology

HEK293T cells (ATCC, Manassas, VA, USA) were transfected with the BKSRKR α subunit cDNA (Genbank accession #JX46275), with or without β2 (ref. 34), both in pcDNA3.1. DNA was transfected at 1 μg (α only) or 1 μg α and 1.7 μg β2 per 35 mm dish using TransIT (Mirus Bio, Madison, WI, USA). Cells were plated on glass coverslips 3–5 h later and recorded from 20 to 30 h after transfection. Patch-clamp recording was performed using the voltage-clamp mode in the inside-out patch configuration using thin-walled borosilicate pipettes with resistances of 2–5 MΩ as described previously60. Recordings were made at room temperature, and the data were acquired at 50 kHz and filtered at 10 kHz. The bath (intracellular) solution was composed of (mM): 140 KMeSO3, 2 KCl, 20 HEPES and 5 HEDTA. Free [Ca2+]i was calculated using Webmax C Standard software61, to a final concentration of 50 μM (from 1 M CaCl2 stock). The pipette (extracellular) solution consisted of (mM): 145 NaCl, 5 KCl, 2 CaCl2, 1 MgCl2 and 10 HEPES, with pH adjusted to 7.2 with NaOH. Cells were held at −150 mV, followed by a maximally activating test step to +150 mV for 150 ms. Data were collected only from patches with <0.7 fractional current (Ipeak/Iss). BK currents were elicited from patches using the voltage protocols indicated in the figures. Single-exponential functions were fit to the macroscopic current decay at +90 mV. For activation of BK currents by action potential commands (Supplementary Fig. 8e), the daytime action potential waveform (as in Fig. 10c) was applied after the standard voltage protocol in whole-cell voltage-clamp mode. The pipette (intracellular) and bath (extracellular) solution were the same as used in the SCN whole recordings above. The action potential-evoked peak current, or the subthreshold current, was normalized to the maximal current elicited from each patch.

Statistics

The number of neurons (BK current and action potential recordings), the number of mice (circadian behaviour) or the number of SCN slice cultures (multielectrode array recordings) are represented as n. Group sample sizes were determined based on power calculations using effect sizes estimated from previous experiments. Behavioural comparisons were performed as comparisons between WT and β2 KO, or WT and β4 KO, using an unpaired Student's t-test. One-way ANOVAs were used for comparisons with more than two conditions, and the P values reported in the text are the Bonferroni post hoc tests only for comparisons where the main effect was P<0.05. Factorial ANOVA was used for comparing multiple conditions across voltages, with Bonferroni post hoc P values for specific comparisons reported in the text. Categorical data (number of rhythmic versus arrhythmic recordings, or BKi versus BKs) were compared with Fisher's exact test, with the Fisher's P value reported in the text. Statistical tests were run in Origin (Originlabs, Northampton, MA, USA). All values are presented as mean±s.e.m.

Additional information

How to cite this article: Whitt, J. P. et al. BK channel inactivation gates daytime excitability in the circadian clock. Nat. Commun. 7:10837 doi: 10.1038/ncomms10837 (2016).
  61 in total

1.  Afterhyperpolarization regulates firing rate in neurons of the suprachiasmatic nucleus.

Authors:  Robin K Cloues; William A Sather
Journal:  J Neurosci       Date:  2003-03-01       Impact factor: 6.167

2.  A Conserved Bicycle Model for Circadian Clock Control of Membrane Excitability.

Authors:  Matthieu Flourakis; Elzbieta Kula-Eversole; Alan L Hutchison; Tae Hee Han; Kimberly Aranda; Devon L Moose; Kevin P White; Aaron R Dinner; Bridget C Lear; Dejian Ren; Casey O Diekman; Indira M Raman; Ravi Allada
Journal:  Cell       Date:  2015-08-13       Impact factor: 41.582

3.  Age-related changes in large-conductance calcium-activated potassium channels in mammalian circadian clock neurons.

Authors:  Sahar Farajnia; Johanna H Meijer; Stephan Michel
Journal:  Neurobiol Aging       Date:  2015-01-31       Impact factor: 4.673

4.  Rapidly inactivating and non-inactivating calcium-activated potassium currents in frog saccular hair cells.

Authors:  C E Armstrong; W M Roberts
Journal:  J Physiol       Date:  2001-10-01       Impact factor: 5.182

5.  The role of BK-type Ca2+-dependent K+ channels in spike broadening during repetitive firing in rat hippocampal pyramidal cells.

Authors:  L R Shao; R Halvorsrud; L Borg-Graham; J F Storm
Journal:  J Physiol       Date:  1999-11-15       Impact factor: 5.182

6.  NMR structure of the "ball-and-chain" domain of KCNMB2, the beta 2-subunit of large conductance Ca2+- and voltage-activated potassium channels.

Authors:  D Bentrop; M Beyermann; R Wissmann; B Fakler
Journal:  J Biol Chem       Date:  2001-08-21       Impact factor: 5.157

7.  Cloning and functional characterization of novel large conductance calcium-activated potassium channel beta subunits, hKCNMB3 and hKCNMB4.

Authors:  R Brenner; T J Jegla; A Wickenden; Y Liu; R W Aldrich
Journal:  J Biol Chem       Date:  2000-03-03       Impact factor: 5.157

8.  Cloning and functional expression of two families of beta-subunits of the large conductance calcium-activated K+ channel.

Authors:  V N Uebele; A Lagrutta; T Wade; D J Figueroa; Y Liu; E McKenna; C P Austin; P B Bennett; R Swanson
Journal:  J Biol Chem       Date:  2000-07-28       Impact factor: 5.157

9.  Chimera analysis of the Clock mutation in mice shows that complex cellular integration determines circadian behavior.

Authors:  S S Low-Zeddies; J S Takahashi
Journal:  Cell       Date:  2001-04-06       Impact factor: 41.582

10.  Knockout of the BK β2 subunit reveals the importance of accessorizing your channel.

Authors:  Robert Brenner
Journal:  J Gen Physiol       Date:  2014-10-13       Impact factor: 4.086

View more
  36 in total

1.  Diurnal properties of voltage-gated Ca2+ currents in suprachiasmatic nucleus and roles in action potential firing.

Authors:  Beth A McNally; Amber E Plante; Andrea L Meredith
Journal:  J Physiol       Date:  2019-07-03       Impact factor: 5.182

Review 2.  Regulation of BK Channels by Beta and Gamma Subunits.

Authors:  Vivian Gonzalez-Perez; Christopher J Lingle
Journal:  Annu Rev Physiol       Date:  2019-02-10       Impact factor: 19.318

Review 3.  Circadian regulation of membrane physiology in neural oscillators throughout the brain.

Authors:  Jodi R Paul; Jennifer A Davis; Lacy K Goode; Bryan K Becker; Allison Fusilier; Aidan Meador-Woodruff; Karen L Gamble
Journal:  Eur J Neurosci       Date:  2019-01-29       Impact factor: 3.386

4.  Large-conductance Ca2+ -activated K+ channel activation by apical P2Y receptor agonists requires hydrocortisone in differentiated airway epithelium.

Authors:  Nathan A Zaidman; Angela Panoskaltsis-Mortari; Scott M O'Grady
Journal:  J Physiol       Date:  2017-06-11       Impact factor: 5.182

5.  An Epilepsy-Associated KCNT1 Mutation Enhances Excitability of Human iPSC-Derived Neurons by Increasing Slack KNa Currents.

Authors:  Imran H Quraishi; Shani Stern; Kile P Mangan; Yalan Zhang; Syed R Ali; Michael R Mercier; Maria C Marchetto; Michael J McLachlan; Eugenia M Jones; Fred H Gage; Leonard K Kaczmarek
Journal:  J Neurosci       Date:  2019-07-26       Impact factor: 6.167

Review 6.  Membrane Currents, Gene Expression, and Circadian Clocks.

Authors:  Charles N Allen; Michael N Nitabach; Christopher S Colwell
Journal:  Cold Spring Harb Perspect Biol       Date:  2017-05-01       Impact factor: 10.005

Review 7.  The Slo(w) path to identifying the mitochondrial channels responsible for ischemic protection.

Authors:  Charles Owen Smith; Keith Nehrke; Paul S Brookes
Journal:  Biochem J       Date:  2017-06-09       Impact factor: 3.857

Review 8.  Circadian redox rhythms in the regulation of neuronal excitability.

Authors:  Mia Y Bothwell; Martha U Gillette
Journal:  Free Radic Biol Med       Date:  2018-02-02       Impact factor: 7.376

9.  Pathophysiology in the suprachiasmatic nucleus in mouse models of Huntington's disease.

Authors:  Dika Kuljis; Takashi Kudo; Yu Tahara; Cristina A Ghiani; Christopher S Colwell
Journal:  J Neurosci Res       Date:  2018-08-31       Impact factor: 4.164

Review 10.  Regulating the Suprachiasmatic Nucleus (SCN) Circadian Clockwork: Interplay between Cell-Autonomous and Circuit-Level Mechanisms.

Authors:  Erik D Herzog; Tracey Hermanstyne; Nicola J Smyllie; Michael H Hastings
Journal:  Cold Spring Harb Perspect Biol       Date:  2017-01-03       Impact factor: 10.005

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.