Literature DB >> 26913187

Prediction of multi-drug resistance transporters using a novel sequence analysis method.

Jason E McDermott1, Paul Bruillard2, Christopher C Overall3, Luke Gosink2, Stephen R Lindemann3.   

Abstract

There are many examples of groups of proteins that have similar function, but the determinants of functional specificity may be hidden by lack of sequence similarity, or by large groups of similar sequences with different functions. Transporters are one such protein group in that the general function, transport, can be easily inferred from the sequence, but the substrate specificity can be impossible to predict from sequence with current methods. In this paper we describe a linguistic-based approach to identify functional patterns from groups of unaligned protein sequences and its application to predict multi-drug resistance transporters (MDRs) from bacteria. We first show that our method can recreate known patterns from PROSITE for several motifs from unaligned sequences. We then show that the method, MDRpred, can predict MDRs with greater accuracy and positive predictive value than a collection of currently available family-based models from the Pfam database. Finally, we apply MDRpred to a large collection of protein sequences from an environmental microbiome study to make novel predictions about drug resistance in a potential environmental reservoir.

Entities:  

Keywords:  antibiotic resistance; bacteria; linguistics; machine learning; microbiome; multidrug resistance transporters; protein function

Year:  2015        PMID: 26913187      PMCID: PMC4743146          DOI: 10.12688/f1000research.6200.2

Source DB:  PubMed          Journal:  F1000Res        ISSN: 2046-1402


Introduction

Gram-negative bacteria are a major cause of many human diseases and, due to the emergence of antibiotic resistance, new means to combat them are a pressing international health issue. Recently the Center for Disease Control and Prevention (CDC) highlighted this problem, by stating that, “… new antibiotics will always be needed to keep up with resistant bacteria…” ( CDC, 2013). Antibiotic resistance is mediated by several distinct mechanisms including enzymatic conversion of antibiotics and transporters that eliminate antibiotics from inside cells ( Blair ). Transporter superfamilies can be easily identified by standard sequence similarity but specific functional information (e.g. substrate specificity) can be more problematic. Protein function has traditionally been determined by costly and time-consuming experimental approaches. Tools to determine sequence similarity such as BLAST have enabled efficient annotation of novel proteins by transfer of function. Such methods have been very effective at delineating families of functionally similar proteins that have similar sequences. More flexible approaches using simple grammars like regular expressions and hidden Markov models have improved this process significantly ( Bateman ; Gough & Chothia, 2002). However, there remain many proteins that cannot be readily associated with known functions using these approaches, largely because they are unrelated by sequence. The field of linguistics is concerned with the structure of languages and studies morphology, syntax, and semantics. This task, which is grounded in mathematics, is directly analogous to the task of interpreting sequences of amino acids to predict function. To date, the application of linguistic-rooted approaches, such as generative grammars, to protein sequences and the use of rigorous and exhaustive approaches to optimize models has been limited. Generative grammars have a rich history in linguistic analysis with limited application to biological problems ( Durbin ). They can be classified in terms of the Chomsky hierarchy where grammars lower in the hierarchy (e.g., regular grammars) are simpler to understand, compute with, and parse; while grammars further up in the hierarchy are more complex but also have more descriptive power. Algorithms such as PROSITE ( Hofmann ) identify simple motifs in proteins using regular expressions, which are the simplest form of grammar (i.e. regular grammars). Hidden Markov models (HMM), a type of regular grammar, have also been applied to detect protein motifs and families. In addition to regular grammars, computational biologists have utilized stochastic context-free grammars for sequence modeling ( Anderson ; Dyrka ). Such grammars are better at modeling palindromic sequences that are found in RNA structure. All three of these are limited, however, because they still require an underlying sequence alignment. The regular expressions contained in the PROSITE database are identified using a manual process to first gather a set of examples of a functional class, perform a multiple sequence alignment on those examples, and finally generate a regular expression by looking at regions of the sequence that align and are generally functionally important, for example a phosphorylated residue or active site. A similar procedure is used to create hidden Markov models (HMMs) such as those found in the Pfam database, except that the process of determining a model is automated. Motif determination using these methods is practically limited to operation on families of related protein sequences that have been aligned and has been carried out manually for individual protein motifs (such as in the PROSITE database). Many proteins with the same function may not have significant sequence similarity to allow alignments to be easily or accurately performed. The dependence on multiple sequence alignments and manual construction of protein patterns limits the ability to provide insight into problematic protein motifs. Previously we have described an effective approach to classification of problematic protein families such as bacterial type III secreted effectors that share little sequence similarity ( McDermott ; Samudrala ). This method used a support vector machine to integrate different sequence-based features and did not use multiple sequence alignment; rather, because the secretion signal is located in the most N-terminal region of the proteins, it took advantage of this natural alignment of disparate sequences. For problematic protein families in which the discriminating motifs are located in different regions of the protein, methods are needed to be able to automatically identify motifs or features, even where the sequence background might be very noisy and traditional methods for aligning sequences based on evolutionary conservation will not be effective. In this study we describe an application of the Proactive Intelligent Learning with Grammar (PILGram) method to protein sequences to develop patterns that can discriminate functional classes of proteins in an alignment-free manner. PILGram uses a genetic algorithm to automate feature selection and build regular expressions that discriminate between classes. We first show that PILGram is able to partially re-create PROSITE patterns for ser/thr phosphatase binding and for zinc fingers in an automated and alignment-free manner. We then apply PILGram to classify transporters involved in drug resistance from other transporter proteins and show that the resulting PILGram model performs better than existing HMM models at classifying proteins in this important functional class. Finally, we combine different PILGram models using a simple voting method to develop an effective classifier called MDRpred. The patterns identified by PILGram map to regions that are likely to be important for substrate specificity, highlighting regions that could be targeted for drug development. We show that PILGram can be a general tool for development of simple patterns for functional classification of protein sequences. As a demonstration we apply MDRpred to a metagenome from an environmental microbial community and highlight several high-confidence predictions of novel MDR transporter proteins. Our results indicate that PILGram may be very effective at identifying functional sequence patterns from groups of protein sequences in the absence of any kind of sequence alignment.

Methods

Protein pattern datasets for proof-of-concept

To examine the ability of PILGram to identify patterns from unaligned protein sequences we used sets of sequences used to define regular expressions for protein motifs from the PROSITE database. In this way we could compare the output of PILGram with the established PROSITE patterns that had been generated from the aligned set of protein examples. Proteins matching each indicated PROSITE pattern (positive examples) were obtained from the PROSITE website ( http://prosite.expasy.org) as the “prosite.dat” file. UniProt identifiers were extracted from the “DR” fields and the matching sequences, obtained from the UniProt database, were listed as true positives “T”. Of the sequences in the UniProt database that did not match the positive examples, approximately 6000 were chosen at random (specific numbers given for each example) to serve as negative examples (See PROSITE_positives_PS000125.fasta, PROSITE_negatives_PS000125.fasta, PROSITE_positives_PS00028.fasta, PROSITE_negatives_PS00028.fasta). The most current PROSITE records available at the time were used (See PROSITE_PS00125.txt and PROSITE_PS00028.txt).

Drug resistance transporter dataset

To construct a training set for multidrug resistance transporters we obtained the protein sequences of 6097 transporter proteins from the Transporter Classification Database [TCDB; ( Saier )] along with family classifications. This database was searched for “drug resistance” giving 71 drug resistance (DR) transporters (See MDR_TCDB_positives.fasta and MDR_TCDB_negatives.fasta datasets). We then searched the protein sequence descriptions from the UniProt database and found an additional 89 sequences annotated with “[drug] resistance” that were not included in the TCDB annotations. We used the TCDB-annotated DR transporters as our positive examples because most are accompanied by references. The ‘candidate’ list of positive examples annotated by UniProt was held out of the training set so as not to interfere with classification. The remaining 5934 sequences were used as negative examples since they are annotated as transporters but not as DR transporters in either database.

Hot Lake peptide sequences

Metagenomic DNA was extracted from two unicyanobacterial consortia cultivated from a microbial mat inhabiting Hot Lake, WA ( Lindemann ) as previously described ( Cole ). Metagenome reconstructions were generated as reported by Nelson et al., (manuscript submitted). Briefly, paired-end reads were generated by the US Department of Energy (DOE) Joint Genome Institute (JGI; http://jgi.doe.gov) under CSP 701, quality trimmed using Trimmomatic ( Bolger ), and assembled using IDBA-UD ( Peng ) with a minimum contig size of 250 bp. Contigs longer than 2 Kb were binned using read coverage for each scaffold using Bowtie2 ( Langmead & Salzberg, 2012) and samtools ( Li ). Gene models for the metagenome reconstructions were generated using Prodigal ( Hyatt ) and hand-curated in some instances. Additionally, axenic organisms isolated from the consortia were sequenced of 10 Kb libraries with PacBio and assembled by the JGI, also under CSP 701. The genomes of axenic organisms were shown to be identical to the corresponding genome reconstructions in the metagenome (Nelson et al., submitted), and replaced these reconstructions in the metagenome database, being more complete. For the axenic isolates, gene models were generated by IMG/ER ( Markowitz ). The sequences are available through NCBI GenBank under accessions, NZ_JQMU00000000.1 GI:675281874 ( Porphyrobacter sp. HL-46), NZ_JMMC00000000.1 GI:653087839 ( Halomonas sp. HL-48), NZ_JAFX00000000.1 GI:635638184 ( Algoriphagus marincola str. HL-49), NZ_JYNR00000000.1 GI:761631804 ( Marinobacter excellens HL-55), and NZ_JMLY00000000.1 GI:654325145 ( Marinobacter sp. HL-58). Metagenome sequences not mapped to sequences from axenic cultures have been submitted to GenBank and are awaiting accessions.

Feature generation

Physiochemical properties (PPs) were calculated using the Python propy module ( Cao ). Properties were calculated using the 147 Composition, Transition, Distribution (CTD) descriptors in propy ( Dubchak, 1995). Classes of properties include hydrophobicity, normalized van der Waals volume (VDWV), polarity, charge, secondary structure, solvent accessibility, and polarizability. In each class amino acids are grouped into three groups based on their physiochemical properties, for example hydrophobicity includes hydrophobic residues (C, L, V, I, M, F, W), polar residues (R, K, E, D, Q, N), and neutral residues (G, A, S, T, P, H, Y). Groups for other classes can be found in ( Dubchak, 1995). Composition calculates a length-normalized score based on the number of residues in the group (for example polar residues) in the sequence. Distribution calculates the portion of the sequence that includes a certain percentage (1, 25, 50, 75, or 100) of the matches for that group. Transition calculates the number of times an amino acid from one group (polar, e.g.) is found next to one from another group (hydrophobic, e.g.) in the sequence, normalized by length. The PP-protein regular expressions (PRE) were represented as a combination of regular expression from the standard PRE with one of the PPs. PILGram treats the PP as an independent element to add to a regular expression. The fitness score for a particular combination is evaluated by calculating the PP score (see above) for the region or regions of the sequence matched by the regular expression. If there is more than one matched region by a regular expression the PP scores from each segment are averaged. As an example if the PRE is “FG*.TL”, then a sequence such as: MKGGLA QQST… would be matched in the underlined region. An additional PP of “hydrophobicityC1” (that is, composition class for hydrophobic amino acids), would be scored by counting the number of hydrophobic residues (C, L, V, I, M, F, W) in the region (6) and dividing by the length of the matched region (12) to give 0.50. A second sequence: MIYTSSG RHCN… would be matched in the underlined region, but the PP hydrophobicityC1 score would be higher 10/12 = 0.83. The PILGram optimization explores many possible combinations using a genetic algorithm (see below) to find the PP and PRE combination that gives the best accuracy. The transmembrane region (TMR) grammar is composed of the PRE with the addition of predefined patterns that represent potential transmembrane regions. These were established by including all transmembrane regions defined in the entire TCDB ( Saier ) with two flanking amino acids from the N- and C-terminal portions of the region, but leaving the sequence of the transmembrane region itself as variable. This means that a given transmembrane region from TCDB (underlined here): AAQT DKWGR would result in a ‘seed’ TMR-PRE of “QT*.DK”. These seed PREs can then be chosen by PILGram to incorporate into parse trees (see below) to generate new PREs. So the resulting models look identical to those generated by the PRE grammar alone, but may be biased toward a focus on transmembrane regions.

Performance evaluation

PILGram models were constructed using half the training data and performance was evaluated with the other half. PILGram optimization was based on accuracy: where TP, TN, FP, and FN are true positive, true negative, false positive, and false negative predictions, respectively. For final evaluation of models we also calculated positive predictive value: and area under the receiver operator characteristic (ROC) curve (AUC) ( Salzberg, 1997).

Pattern clustering

Clustering of patterns for MDRpred was accomplished by assembling a vector of binary values (match or no match) across the 6005 examples (71 positive plus 5934 negative examples) from the training set for each of the 36 final MDR patterns. Euclidean distance was calculated between all pairs of vectors and the hcclust function from R (version 3.0.1) was used for hierarchical clustering using complete agglomeration.

PILGram

Machine learning methods, like SIEVE ( McDermott ; Samudrala ), take features as input to build a model. Features are the smallest elements derived from the examples (protein sequences) that can be categories (e.g. amino acid type) or values (e.g. solvent accessibility values). While the selection of salient features is critical for classification, most algorithms require their manual specification. PILGram (Proactive Intelligent Learning with Grammar) is an approach to automate the feature selection process and allows for the selection of irredundant features. PILGram does this by combining a genetic algorithm and a generative grammar, which is a formalized set of rules for combining features into different patterns in the form of parse trees. PILGram generates a large number of such trees and then applies a genetic algorithm, which iteratively recombines these trees to determine an optimal model for classification of the positive and negative examples. In this way PILGram specifies an absorbing Markov chain on the space of features, and given sufficient time, will always converge to a collection of optimal non-redundant features. The mathematical foundations of and explicit algorithm for PILGram are currently pending review, but the algorithm is perhaps best understood by example. Consider the following toy example: height, weight, and age data are gathered from a population and each person is labeled as obese or not. One might like to automate the determination of obesity using only height, weight, and age. It is known that the body mass index (BMI) is a good indicator of obesity and is given by (weight/(height × height)). In order to determine this quantity, PILGram might make use of the following grammar. 〈expr〉::=(〈expr〉〈op〉〈expr〉)|〈attr〉 〈op〉::=+|-| × |/ 〈attr〉::=height | weight | age In this grammar the ‘|’ symbol is to be read as ‘or’ and ‘::=’ can be read as ‘replace by.’ So the second line tells us that ‘〈op〉’ can be replaced by ‘+’, ‘-‘, ‘×’, or ‘/’. The symbols to the left of ::= are called non-terminal symbols. This grammar can be used to generate features as follows. Write down 〈expr〉. Locate any non-terminal symbol in your expression. Replace the chosen non-terminal according to the grammar. If there is a non-terminal symbol in your expression, then return to step 2. This process can be viewed as a parse tree. That is, at step 1 one writes 〈expr〉. Then every time a non-terminal symbol is replaced one writes the replacement below the non-terminal symbol and connects each symbol in the replacement with the initial symbol with a line. A vertical line is placed below each non-terminal symbol that is not replaced. The resulting expression is then read from left to right along the ‘leaves’ of the resulting tree. For instance, BMI might be produced from the procedure as follows: 〈expr〉→ (〈expr〉〈op〉〈expr〉) → (〈attr〉〈op〉〈expr〉) → (weight 〈op〉〈expr〉) → (weight/〈expr〉) → (weight/(〈expr〉〈op〉〈expr〉)) → (weight/(〈expr〉×〈expr〉)) → (weight/(〈attr〉×〈expr〉)) → (weight/(〈attr〉×〈attr〉)) → (weight/(height ×〈attr〉)) → (weight/(height × height)). This is more succinctly expressed by the parse tree: While one might get lucky and generate this expression by random application of the above grammar, it is highly unlikely. However, one might generate (weight-height) and (age+height × height). While neither of these expressions are BMI, BMI can be produced by mutating and crossing these feature. Mutation is a process by which a node in the parse tree is randomly selected and then replaced with another value such that the tree remains consistent with the generative rules of the grammar. In some cases, one might opt to re-build the tree below the replaced node thereby giving the algorithm greater flexibility. For instance, the first expression can be represented as a parse tree and mutated as follows: The resulting feature, (weight/height), is more similar to BMI than the initial feature, and in fact performs better at classifying obesity. To arrive at BMI we could apply the crossing procedure to (weight/height) and (age+height × height). Crossing is a process by which two features are expressed as parse trees and two of their subtrees are exchanged so that the resulting parse trees are consistent with the grammar. For instance, BMI can be found by crossing (weight/height) and (age+height × height) as follows: Not all crossings and mutations will produce better features, and not all features should be considered for crossing or mutation. To handle this, PILGram behaves stochastically and preferentially selects features for mutation and crossing according to how well they perform. The guiding principle is that features which perform better should be closer to the optimal feature than those that do not. The entire PILGram algorithm can be outlined as follows: Select a grammar for feature generation and a fitness function to evaluate the features against. Randomly generate a population of features and determine the fitness of each feature. Randomly subsample the population where a feature is selected with probability proportional to its fitness. For each feature selected in step 3, copy the feature and randomly change the value of a random node in its parse tree in a manner consistent with the grammar. Return the initial feature and the result of the mutation to the population. Randomly subsample the population for pairs of features with each feature selected with probability proportional to its fitness. For each pair selected in step 5 produce a copy of their parse trees. Randomly select a subtree in each feature’s parse tree and exchange these subtrees ensuring that the exchange produces features which are consistent with the grammar. Return the two initial features and the two new features to the population. Compute the fitness of all features in the population and remove the least fit features until the population returns to its initial size. If the fittest feature has converged, then terminate the algorithm, otherwise return to step 3. A common variation of the algorithm is to randomly generate new features at the start of step 7 and add them to the population before reducing the population size. Another common modification is to iteratively apply the algorithm such that the fitness function is updated between iterations to account for the fittest feature. This allows one to generate a list of irredundant features. Unsurprisingly, the choice of generative grammar strongly influences the quality of the resulting features. Below we will make use of Perl’s regular expression grammar to produce motifs in an alignment free fashion ( Supplemental Figure 1).
Supplemental Figure 1.

Backus–Naur form grammar for proteins.

Many conventional genetic algorithms use ‘chromosomes’, the group of variables that alter algorithm behavior, with a set length. PILGram is based on the idea of recombining parse trees, so does not have a defined length. As described above the trees can be mutated and crossed during the optimization process, and the length of the resulting regular expression is therefore variable, though it is limited by the maximum depth of parse trees allowed. Parse tree depth can be set but larger values become more computationally intensive. PILGram has been applied in areas ranging from text analysis, which uses a combination of atomic features based on letter frequency based atomic features and regular expressions, and to image analysis, which uses more complex image-based atomic features. In both of these cases PILGram not only provided features that were optimal for classification, but that were also easily interpreted by a user (unpublished results). In addition to these application spaces, precursor technology has been applied to loop unrolling in the realm of compiler optimization ( Leather ) where it was found that learned features resulted in an increase from 48% of the theoretical efficiency bound (using expert driven features) to 76% of the theoretical bound using features automatically identified by a PILGram-like algorithm. We note that PILGram does not train a classifier, rather it selects features which means that any improvements are not the result of overfitting but instead, are a consequence of carefully chosen features.

Regular expressions

The protein regular expression (PRE) used by PILGram to identify patterns in protein sequences is expressed in standard regular expression notation. Briefly:

Prediction of multi-drug resistance transporters dataset

Data file 1 Title: Data File PROSITE_positives_PS000125.fasta. Legend: Sequence file in FASTA format of all positive examples for the ser/thr phosphatase model. Data file 2 Data File PROSITE_negatives_PS000125.fasta. Sequence file in FASTA format of all randomly selected negative examples for the ser/thr phosphatase model." Data file 3 Data File PROSITE_positives_PS00028.fasta. Sequence file in FASTA format of all positive examples for the zinc finger model. Data file 4 Data File PROSITE_negatives_PS00028.fasta. Sequence file in FASTA format of all randomly selected negative examples for the zinc finger model. Data file 5 Data File PROSITE_PS00125.txt. PROSITE record used for the ser/thr phosphatase model. Data file 6 Data File PROSITE_PS00028.txt. PROSITE record used for the zinc finger model. Data file 7 Data File MDR_TCDB_positives.fasta. Sequence file of MDR transporters used for training. FASTA format file of positive examples used in this study derived from the TCDB. Data file 8 Data File MDR_TCDB_negatives.fasta. Sequence file of non-MDR transporters used for training. FASTA format file of negative examples used in this study derived from the TCDB. Data file 9 Data File PILGram_PATTERNS_PS00125.txt. Regular expression generated by PILGram for the ser/thr phosphatase model. Data file 10 Data File PS00125_alignments.out. Sequence alignments of PILGram model matches to the positive examples in the ser/thr phosphatase model. Data file 11 Data File PILGram_PATTERNS_PS00028.txt. Regular expressions generated by PILGram for the zinc finger model. Data file 12 Data File PS00028_alignments.out. Sequence alignments of PILGram model matches to the positive examples in the zinc finger model and a summary score line that represents the overlap of the 10 different models for each sequence. Data file 13 Data File PILGram_PATTERNS_MDRpred.txt. The 36 regular expressions and associated physiochemical properties (where applicable) generated by PILGram for the MDR model . Data file 14 Data File MDRpred_alignments.out. Alignments of 36 PILGram model matches on the MDR positive example sequences. Data file 15 Data File Pfam_transporters.txt. A list of Pfam families that were used to identify transporters in the Hot Lake metagenome. Data file 16 Data File HotLake_MDRpred_predictions.fasta. A FASTA format file of 63 protein sequences from the Hot Lake metagenome that are matched by 30 or more MDRpred individual models (high confidence predictions), match Pfam families for transporters (Pfam e-value less than 1e-20), but are not identified by Pfam as multidrug resistance transporters. Click here for additional data file.

Results

Alignment-free identification of discriminatory protein patterns in PROSITE

To test the ability of PILGram to identify discriminatory regular expressions from unaligned sequences we focused on a well-defined group of proteins with a known discriminatory pattern. We first examined the serine-threonine phosphatase pattern (PROSITE PS00125) by obtaining 166 sequences listed as true positives from PROSITE (see Methods). For negative examples we randomly selected 5344 sequences from UniProt that are not included in the positive sequences. We applied PILGram to this dataset using a standard regular expression grammar modified for protein sequences (see Supplemental Figure 1). The algorithm was terminated after 276 iterations when the fitness (classification accuracy) did not change over 10 consecutive iterations. The resulting pattern ( Table 1) had a very high accuracy and positive predictive value (PPV) at 99.9% and 92%, respectively. The pattern identified by PILGram contains the core of the existing PROSITE pattern, a K or R (the PILGram pattern adds a Q) followed by GNH, missing the first and last residue of the PROSITE pattern, and performs nearly as well (See Supplemental Data PILGram_PATTERNS_PS00125.txt). In Table 2 we show several examples of the functional regions identified in sequences by the original PROSITE model and the PILGram-derived model (PRE matches in bold type). Alignments for the complete set of positive examples are included as Supplemental Data PS00125_alignments.out. However, the PILGram pattern required no sequence alignment or manual determination of a conserved pattern.
Supplemental Table 1.

PILGram models for MDR transporter prediction.

OrderPPRESmallAccuracyClusterClusterNameGrammarRE
1_SecondaryStrD1075.{408}$70%1Cluster 1PP-PRE.{408}$
3_SolventAccessibilityD3075LM.*VV72%1Cluster 1PP-PRELM.*VV
4_ChargeD1100VG.*GL[^CQ].{233}72%1Cluster 1PP-PREVG.*GL[^QC].{233}
5_PolarityD3100VG.*GL[^EF].{233}72%1Cluster 1PP-PREVG.*GL[^FE].{233}
6_HydrophobicityD3100VG.*GL[^DH].{233}71%1Cluster 1PP-PREVG.*GL[^HD].{233}
36 NA D[^ADGHY]+[AEFHI].+SR 73% 1 Cluster 1PP-PRE D[IK-SCFK-WE]+[^YC-DQWK-WG].+SR
2_SecondaryStrT13GR[^A-P]70%2AR-RLPP-PREGR[^PA-PA]
19NAAR.+AP[DGILNPQRVW]74%2AR-RLTMR-PREAR.+AP[^YAKASHKTMEHCKTEYMSECMYF]
23NART.*AG.+$66%2AR-RLTMR-PRERT.*AG.+$
29NA[RSTVWY]*.{41}AR.+RL71%2AR-RLPRE[^EA-IEGH-NAAQ]*.{41}AR.+RL
31 NA AR.+RL[DMPRSTVWY] 74% 2 AR-RLPRE AR.+RL[PM-MDUR-YM]
33NAAR.+LR70%2AR-RLPREAR.+LR
7_NormalizedVDWVD2001AQ.+AT73%3AQ-TPP-PREAQ.+AT
8 _SolventAccessibilityD1100 AQ.+AT 73% 3 AQ-TPP-PRE AQ.+AT
22NAAQ.*LF.*LT.*72%3AQ-TTMR-PREAQ.*LF.*LT.*
30NAAQ.*TI[AQRSTVWY]+71%3AQ-TPREAQ.*TI[^LC-P]+
17NARQ.*LA[ACDE]73%4RQ-LTMR-PRERQ.*LA[^TF-YM]
18 NA [AC][DFGLMPQRVY]+RQ 75% 4 RQ-LTMR-PRE [^DM-YYRL-VEUQ][GG-GFVMQD-DLUQ- RMPY]+RQ
20NARQ.+LL[AEFHKNRT]74%4RQ-LTMR-PRERQ.+LL[^PGDV-WSDM-QPYI-LC]
25NARQ.*LA.{12}[^GM-Y]*[^MY]{14}71%4RQ-LPRERQ.*LA.{12}[^M-YG]*[^YM]{14}
26NA[KLNPQSTVW]VR.*AV72%5VRPRE[^RA-IIEKCMAFIM]VR.*AV
27 NA [DGLNPQRSTV]VR.+TV.+[CDEY]*$ 76% 5 VRPRE [LGDN-VU]VR.+TV.+[^QF-NUAF-WH]*$
28NA[^D-LW]+VR.+ML71%5VRPRE[^MD-LW]+VR.+ML
35NA[^A-KNR]SR.*AA[ADEGHIKSTVY]+72%5VRPRE[^NA-KR]SR.*AA[^FF-FLWL-QCFI-RK]+
12NARV.+IA.[K-S]72%6Cluster 6TMR-PRERV.+IA.[MK-SS]
13 NA AQ.+RQ.{49} 75% 6 Cluster 6TMR-PRE AQ.+RQ.{49}
14NANV.+AQ.{48}70%6Cluster 6TMR-PRENV.+AQ.{48}
24NAVV.+VR.*RQ.*LA*[ACDT]72%6Cluster 6PREVV.+VR.*RQ.*LA*[^WE-SC]
32NAID.+AQ.{48}70%6Cluster 6PREID.+AQ.{48}
34NA.{45}AQ.+LV.*AR.*FN*74%6Cluster 6PRE.{45}AQ.+LV.*AR.*FN*
9_SolventAccessibilityT12MF.*QL72%7M-LPP-PREMF.*QL
10_NormalizedVDWVT13MF.*QL71%7M-LPP-PREMF.*QL
11_PolarizabilityT12MF.*QL71%7M-LPP-PREMF.*QL
15NAMR.+LV.{49}.{49}71%7M-LTMR-PREMR.+LV.{49}.{49}
16 NA MR.+LL[STVW] 73% 7 M-LTMR-PRE MR.+LL[^HA-RD]
21NAMR.+AQ71%7M-LTMR-PREMR.+AQ
Table 1.

Ser/Thr Phosphatase model.

ModelPatternAccuracy
PS00125 [LIVMN][KR]GNHE 100.0%
1[KQR]G+NH99.9%
Table 2.

Example alignments of ser/thr phosphatase sequences.

SequenceModelFunctional region
Q9LHE7PS00125 PANITL LRGNHESRQLTQ
Q9LHE7PILGram 1 PANITLL RGNHESRQLTQ
P12982PS00125 SENFFL LRGNHECASINR
P12982PILGram 1 SENFFLL RGNHECASINR
A2XN40PS00125 PQRITI LRGNHESRQITQ
A2XN40PILGram 1 PQRITIL RGNHESRQITQ
The ser/thr phosphatase pattern is relatively simple and does not include any gaps of variable size. We were interested in determining if PILGram would also work on a more complicated pattern and so chose the zinc finger pattern (PS00028), which is a somewhat variable arrangement of conserved cysteine and histidine residues. We obtained the 1997 sequences used for the construction of the PROSITE pattern and additionally collected 5435 randomly selected protein sequences from the UniProt database to serve as negative examples for this test example. Because individual runs converged on different predictive patterns we ran PILGram 10 times on the dataset. In principle, PILGram will always eventually converge to the optimal pattern. However, in practice there may be ‘flat regions’ over which the fitness function does not significantly vary with feature modification or local extrema. In such situations, PILGram may take significant time to escape these regions and it is more economical to employ a weak convergence test, run PILGram several times, and aggregate the features. The resulting patterns ( Table 3; Supplemental Data PILGram_PATTERNS_PS00028.txt) vary in composition and accuracy, with a maximum accuracy obtained of about 92%. All patterns fall short of the manually determined PROSITE pattern that has an accuracy of 99%. It is interesting to note that none of the identified patterns perfectly matches any portions of the manually determined PROSITE pattern, though there are some consistently identified features such as multiple cysteine residues.
Table 3.

Zinc finger patterns identified.

ModelPatternAccuracy
PS00028 C.{2,4}C.{3}[LIVMFYWC].{8}H.{3,5}H 99.0%
1[^LV][^F][^VW]{8}[^ADILN]{7}C87.6%
2C[D-H].+[R][^EFG]H87.4%
3.{15}C[^FGIRW][^C]C92.7%
4[CHP][^V]{53}81.2%
5[C].{27}[C]89.0%
6[^VW]{55}.*.+$80.0%
7C[^V]{42}83.0%
8K.{3}C+87.0%
9C[AGHNQT]K87.2%
10C[^IFPV]{3}F+[^CE]91.0%
Combined95.3%
We examined the possibility that the patterns identified by PILGram would be synergistic in their discriminatory ability. For each example protein (positive and negative) we counted how many of the individual PILGram patterns matched, then used this number as a discriminator. We found that using this simple voting procedure increased the accuracy from 92% to a maximum of 95.3% when six or more patterns match a sequence ( Figure 1). While this performance still does not reach the level of the original PROSITE pattern (99%), we believe it demonstrates the utility of PILGram for identifying patterns from unaligned sequences.
Figure 1.

Accuracy for prediction of zinc finger proteins.

Matches to PILGram-generated regular expression patterns for the zinc finger domain (represented in PROSITE PS00028) were counted (X axis) and accuracy (Y axis) calculated based on the known positives and negative examples datasets (see text). Peak accuracy of the approach is attained at six pattern matches.

Accuracy for prediction of zinc finger proteins.

Matches to PILGram-generated regular expression patterns for the zinc finger domain (represented in PROSITE PS00028) were counted (X axis) and accuracy (Y axis) calculated based on the known positives and negative examples datasets (see text). Peak accuracy of the approach is attained at six pattern matches. We were interested to know if PILGram was identifying regions of the sequence that overlap with the PROSITE pattern. We identified regions in all positive example sequences that match the ten PILGram patterns and calculated a score for each sequence based on the number of matches, per residue, that PILGram identified in the real zinc finger region. On average, 3.4 PILGram patterns match each residue of the known PS00028 pattern, whereas the number of patterns matching arbitrary residues in the sequence was 2.1. This shows that PILGram identifies more patterns overlapping the canonical zinc finger motif. However, it is clear that PILGram-derived motifs may not be canonical and further work needs to be done in this area. We show examples of matches from individual PILGram models as well as the per-residue overlap score (as “Summary”) in Table 4. Note that none of the individual PILGram models matches the single (Q24174, beginning at residue 540) or double (Q59RR0, beginning at residue 645) zinc finger motifs completely, but that the overlap score for the functional regions in both sequences are higher than surrounding sequences. Alignments for the complete set of positive examples are provided as Supplemental Data PS00028_alignments.out.
Table 4.

Example alignments of zinc finger regions.

SequenceModelFunctional region
Q24174PS00028 ATDPRP CPKCGKIYRSAHTLRTHLEDKHTVCPGY
Q24174PILGram 1 ATDPRPCPKCGKIYRSAH TLRTHLEDKHTVCPGY
Q24174PILGram 2 ATDPRPCPKCGKIYRSAHTLRTHLEDKHTVCPGY
Q24174PILGram 3 ATDPRPCPKCGKIYRSAHTL RTHLEDKHTVCPGY
Q24174PILGram 4 ATDPRPCPKCGKIYRSAHTLRTHLEDKHTVCPGY
Q24174PILGram 5 ATDPRPCPKCGKIYRSAHTLRTHLEDKHTVCPGY
Q24174PILGram 6 ATDPRPCPKCGKIYRSAHTLRTHLEDKHTVCPGY
Q24174PILGram 7 ATDPRPCPKCGKIYRSAHTLRTHLEDKHTVCPGY
Q24174PILGram 8 ATDPRPCPKCGKIYRSAHTLRTHLED KHTVCPGY
Q24174PILGram 9 ATDPRPCPK CGKIYRSAHTLRTHLEDKHTVCPGY
Q24174PILGram 10 ATDPRPCPKCGKIYRSAHTLRTHLEDKHTVCPGY
Q24174Summary 222222 3334332222223344444455444333
Q59RR0PS00028 EDKIYT CTYKNCGKKFTRRYNVRSHIQTHLSDRPFG CQFCPKRFVRQHDLNRHVKGHIEARYS
Q59RR0PILGram 1 EDKIYTCTYKNCGKKFTRRYNV RSHIQTHLSDRPFGCQFCPKRFVRQHDLNRHVKGHIEARYS
Q59RR0PILGram 2 EDKIYTCTYKNCGKKFTRRYNVRSHIQTHLSDRPFGCQFCPKRFVRQHDLNRHVKGHIEARYS
Q59RR0PILGram 3 EDKIYTCTYKNCGKKFTRRYN VRSHIQTHLSDRPFGCQFCPKRFVRQHDLNRHVKGHIEARYS
Q59RR0PILGram 4 EDKIYTCTYKNCGKKFTRRYNVRSHIQTHLSDRPFGCQFCPKRFVRQHDLNRHVKGHIEARYS
Q59RR0PILGram 5 EDKIYTCTYKN CGKKFTRRYNVRSHIQTHLSDRPFGCQFCPKRFVRQHDLNRHVKGHIEARYS
Q59RR0PILGram 6 EDKIYTCTYKNCGKKFTRRYNVRSHIQTHLSDRPFGCQFCPKRFVRQHDLNRHVKGHIEARYS
Q59RR0PILGram 7 EDKIYTCTYKNCGKKFTRRYNVRSHIQTHLSDRPFGCQFCPKRFVRQHDLNRHVKGHIEARYS
Q59RR0PILGram 8ED KIYTCTYKNCGKKFTRRYNVRSHIQTHLSDRPFGCQFCPKRFVRQHDLNRHVKGHIEARYS
Q59RR0PILGram 9 EDKIYTCTYKN CGKKFTRRYNVRSHIQTHLSDRPFGCQFCPKRFVRQHDLNRHVKGHIEARYS
Q59RR0PILGram 10 EDKIYTCTYKNCGKKFTRRYNVRSHIQTHLSDRPFGCQFCPKRFVRQHDLNRHVKGHIEARYS
Q59RR0Summary 334444544446665444444566666665555555666633333333333333333222222

Drug resistance transporters

A more difficult task for functional classification is to develop a model that will discriminate a group of functionally related proteins that cannot be aligned by traditional sequence alignment methods, or where the alignment does not allow discrimination between closely related sequences with different functions. To test its utility with these kinds of problematic proteins we applied PILGram to develop a classifier for antibiotic drug resistance transporters. Though transporter superfamily members can be identified fairly readily using standard sequence alignment approaches, previous studies have shown that sequence similarity has limited utility for classifying of transporters by substrate specificity ( Barghash & Helms, 2013). The same authors also showed separately that integrating simple data (amino acid composition, dipeptide composition) could be used to classify some substrate families with good accuracy ( Schaadt ; Schaadt & Helms, 2012), but these models have little potential for providing biological insight. Additionally, it remains unclear if there are members of functional families that have yet to be discovered because of lack of strong sequence similarity. ATP-binding cassette transporters (ABC), resistance-nodulation-cell division (RND) superfamily, and major facilitator superfamily (MFS) transporters are common superfamilies of proteins involved in the transport of a wide variety of different compounds, such as sugars, ions, peptides, and more complex organic molecules. Multidrug resistance (MDR) transporters are found in each of these superfamilies and are primary mediators of antibiotic drug resistance ( Nikaido, 2009; Nikaido & Pages, 2012). Though MDR transporters actually encompass a range of substrate specificities because there are many types of drugs they export, we hypothesized that there would be some unifying features of MDR transporters that could be captured using PILGram. We gathered a set of 73 known MDR transporter sequences (positive examples) from the TCDB ( Saier ) and used the remainder of sequences classified in the TCDB as non-MDR transporters (negative examples; 5935 sequences). This dataset (Supplemental Data MDR_TCDB_positives.fasta and MDR_TCDB_negatives.fasta) was used to train and cross-validate MDRpred as described below.

Traditional methods of identifying antibiotic resistance transporters

We first evaluated how well previously generated HMM models from the Pfam database could discriminate between MDR and non-MDR transporters. We identified four Pfam models that seem to definitively identify drug resistance transporters (PF00893, PF08370, PF00873, and PF13536) and applied them to the set of sequences considering a ‘hit’ as a sequence matched by any of the models with high confidence (E value < 1e-100). The Pfam models provide very good accuracy (~97%), but only identify 10 of 73 MDR transporters (14%), and these are likely hits to many of the sequences used to create the models in the first place.

PILGram model training

We examined the ability of PILGram to find patterns capable of identifying MDR transporters from other transporter sequences. Though regular expressions have been shown to be effective at capturing many types of functional patterns in proteins ( Hofmann ), other patterns may be more amenable to broader chemical and structural characteristics of regions of proteins ( Dubchak, 1995). Because we believed that transmembrane regions (TMRs) would be important features in this classification task we modified our protein regular expression (PRE) grammar ( Supplemental Figure 1) to bias the feature generation processes toward producing TMRs (TMR-PRE). Additionally, we included a large set of different types of protein physiochemical properties in our PILGram search (PP-PRE). PILGram included the 147 types of properties as features that could be chosen during the search. If a physiochemical property was used in a search the score (value for that particular property) was calculated for all matches of the accompanying regular expression on a sequence. If there were multiple matches to the protein then the scores were averaged. Using a 2-fold cross-validation approach (see Methods) we used PILGram to generate 36 models ( Supplemental Table 1 and Supplemental Data PILGram_PATTERNS_MDRpred.txt), approximately 12 models from each of the three grammars (PRE, TMR-PRE, and PP-PRE). The models had individual accuracies ranging from 70–75%, underperforming the combination of HMM models that already exist. However, application of the simple voting approach used above in which the number of models that matched each sequence was counted, improved the results dramatically. The accuracy and PPV for increasing numbers of model matches is shown in Supplemental Figure 2, and have maximum values at the most stringent threshold (requiring all patterns be matched) of 99% and 28%, respectively. Using models from each of the grammars individually in the voting approach showed that each grammar, PRE, TMR-PRE, and PP-PRE, performs very similarly in terms of accuracy and PPV when considering the maximum number of model matches (accuracies 96%, 97%, and 95%, respectively, and PPVs all at 12%). From these results it appears that the overall performance of our approach benefits from the combination of different kinds of models, which more than doubles the PPV.
Supplemental Figure 2.

Simple voting method for combining models.

A. Accuracy of combined patterns for classification. Matches to PILGram-generated regular expression patterns for the MDR transporters were counted (X axis) and accuracy (Y axis) calculated based on the known positives and negative examples datasets (see text). Peak accuracy is attained when all 36 patterns match the sequence, indicating that the diversity of MDR transporter sequences is likely to be high. Redundancy analysis ( Table 3) shows that a similar accuracy can be obtained with seven patterns. B. Positive-predictive value of combined patterns for classification. Positive predictive value (the percentage of true positives in all positive predictions; Y axis) was calculated for each number of MDR transporter pattern matches (X axis). The maximum value is reached in sequences that match all patterns.

To examine whether the individual scores could be combined to provide better prediction we employed logistic regression and found that this improved our results somewhat ( Figure 2; Supplemental Figure 3). As a comparison for the same ~97% accuracy level provided by the traditional methods (Pfam family matches) our method, we call MDRpred, identifies 37 of the MDR transporters from our training set (50%) versus 10 for the traditional methods. It is clear that further development is needed to improve classification of this important group, but our approach provides the best method to date of identifying drug resistance transporters using sequence alone.
Figure 2.

MDR classification results.

The accuracy (blue line), positive predictive value (black line), and percentage of total MDR transporters identified (coverage; red line) are shown as a function of the score threshold used (X axis). The score is derived from a logistic regression on the complete set of 36 models generated (see text).

Supplemental Figure 3.

Comparison of MDRpred models.

The receiver-operator characteristic curves (ROC) are shown for the simple vote combination of 36 models (black line), the logistic regression combination of 36 models (blue line), and the logistic regression combination of the selected seven models shown in Table 3 (red line). The area under the curve (AUC) for each method is indicated in the legend. The results show that using all models in a score derived by logistic regression provides the best performance, though the other methods also perform adequately.

MDR classification results.

The accuracy (blue line), positive predictive value (black line), and percentage of total MDR transporters identified (coverage; red line) are shown as a function of the score threshold used (X axis). The score is derived from a logistic regression on the complete set of 36 models generated (see text).

Functional motifs identified

In addition to classification of sequences a second goal of this work is to identify biologically relevant regions of proteins that are responsible for protein function. We showed that PILGram can identify regions known to be functionally important in zinc fingers. Here we apply a similar approach to identify regions that may be important for drug resistance in transporters. That is, those regions of the transporter that are most important for their function of transporting a broad class of substrates, antibiotic drugs. We first examined the overlap in patterns by clustering models based on the training sequences that they matched ( Supplemental Figure 4). The models were arranged using hierarchical clustering and then seven clusters of similar models were identified. We found that most of the clusters exhibited some similarity in patterns and model from each cluster with the highest independent accuracy listed in Table 5. We found that applying logistic regression to combine these seven models provided a similar performance as the voting method, but underperformed the logistic regression on the complete set of models somewhat ( Supplemental Figure 3). This indicates that the seven models represent a large portion of the information in the approach but that the additional models add significant value.
Supplemental Figure 4.

Clustering of MDRpred individual models.

For each labeled sequence (rows) we assessed the presence (red cell) or absence (white cell) of a match to any of the 36 MDRpred regular expression models (columns). Hierarchical clustering was used to highlight relationships between models based on their patterns of matches. Dendrograms for sequences and models are shown. The patterns highlight seven groups of models that share a large number of predictions. Representative members from each of these clusters are shown in Table 3.

Table 5.

Drug resistance transporter patterns identified.

ModelPatternPhysiochemicalPropAccuracyClusterName
36D[^ADGHY]+[AEFHI].+SR73%Cluster 1
31AR.+RL[DMPR-Y]74%AR-L
8AQ.+ATSolvent Accessibility73%AQ-T
18[AC][DFGLMPQRVY]+RQ75%RQ-L
27[DGLN-V]VR.+TV.+[CDEY]*$76%VR
13AQ.+RQ.{49}75%Cluster 6
16MR.+LL[STVW]73%M-L
EmrD is an MDR transporter with a solved crystal structure ( Yin ). We examined the overlap of the PILGram models on the EmrD sequence and found that the maximum overlap in matched expressions from our models occurred in H3 69-103 and the loop following H4 118-131. The latter region has been highlighted as the ‘selectivity filter’, a loop extending in to the cytoplasm and that abrogates substrate selectivity when mutated ( Yin ) ( Figure 3). This suggests that for this case where a substrate selectivity region is known, our model can correctly identify it, though more examples would be necessary to fully demonstrate this. Alignments of matches with individual models with all positive example MDR sequences is provided as Supplemental Data MDRpred_alignments.out.
Figure 3.

Prediction of selectivity in EmrD.

The structure of the MDR transporter EmrD from E. coli (2GFP) is shown with the regions of maximum pattern overlap shown in red. This region has been shown to be the substrate selectivity filter for substrates transported by the protein, showing that MDRpred predictions can highlight functionally important regions.

Prediction of selectivity in EmrD.

The structure of the MDR transporter EmrD from E. coli (2GFP) is shown with the regions of maximum pattern overlap shown in red. This region has been shown to be the substrate selectivity filter for substrates transported by the protein, showing that MDRpred predictions can highlight functionally important regions.

Identification of novel MDR transporter candidates from environmental microbiomes

New antibiotic resistance mechanisms are thought to be acquired from a very large natural reservoir of environmental bacteria, most of which have not yet been characterized ( D'Costa ; Forsberg ; Li ). This means that novel antibiotics may face emergence of antibiotic resistance in pathogenic bacteria by lateral gene transfer or other means ( Aminov & Mackie, 2007; Forsberg ). We were interested in determining if our models could be used to identify candidate MDRs from environmental samples. We therefore searched a species-resolved metagenomic dataset acquired from consortia ( Cole ) cultivated from a phototrophic microbial mat in Hot Lake, Washington ( Lindemann ). Though soil microbial communities have been examined for antibiotic resistance potential previously ( D'Costa ) communities living in extreme environments such as Hot Lake have not. We postulated that these kinds of communities might be rich sources of novel MDR transporters given the manifold interactions between community members ( Martinez ; Piddock, 2006). We first searched the 69010 protein sequences from the Hot Lake consortial metagenomes (Nelson et al., submitted) for known MDR transporters using the Pfam families (PF00893, PF08370, PF00873, and PF13536) and identified 118 high-confidence (E value < 1e-100) matches. Interestingly, when we examined a set of clones gathered from 18 soil samples and selected for expression of multidrug resistance phenotypes ( Forsberg ) we found only 14 MDR transporters at the same stringency, though one caveat is that the efficiency of expression of transporters could be a limitation in this system. This suggests that the Hot Lake community has a relatively large number of MDR transporters. We believed that there would be MDR in this metagenome that would not be detected using the Pfam families available. Therefore, we searched the Hot Lake consortium metagenome using all 36 models and then ranked the results by number of matched sequences. A histogram of number of matching models is shown in Supplemental Figure 5. Because MDRpred was trained only on transporter proteins it cannot discriminate transporter proteins from non-transporters. That is, there are a significant number of false positive predictions that match proteins unlikely to be transporters. Accordingly, we filtered candidates to only those proteins identified as transporters by Pfam (list of Pfam transporter families provided as Supplemental Data Pfam_transporters.txt) and at the highest stringency we identified five candidate MDR sequences ( Table 6). This step is included in the overall MDRpred process to allow accurate prediction in entire genomes or metagenomes. We provide a full list of other high-confidence predictions (matching more than 30 individual models, annotated as transporters but not multidrug resistance transporters by Pfam) as Supplemental Data HotLake_MDRpred_predictions.fasta.
Supplemental Figure 5.

Histogram of MDRpred votes for metagenomic sequences.

The number of sequences (Y axis) with N matches (X axis) in the Hot Lake metagenome (69,010 sequences total) is shown as a histogram. This plot can be compared with similar plots in Supplemental Figure 2 showing accuracy and positive predictive value at each of these stringency thresholds.

Table 6.

Predicted novel multidrug resistance transporters from Hot Lake.

IDDescriptionLength
CY41DRAFT_3272Arabinose efflux permease family protein434
HLSNC01_00824ATPase components of ABC transporters547
HLSNC12_00368Putative oligoketide cyclase/lipid transport protein152
Though two of these predictions are already annotated as transporters (arabinose efflux permease and lipid transporter) these are largely automated predictions based on traditional sequence analysis approaches (BLAST searches and family/motif matches). Novel antibiotic resistance transporters are likely to show some similarities with known transporters ( Forsberg ), but definite substrate specificity is often not revealed by these relationships. The value of MDRpred is the potential to identify novel antibiotic resistance transporters from sequences annotated as transporters where substrate specificity has not been experimentally established.

Discussion and conclusions

The explosion in number of sequences available from a large number of sources has driven the need for better methods to capture patterns in distinct groups of functionally related sequences. Our method, based on linguistic approaches to pattern identification, has several advantages over existing methods. Not requiring a sequence alignment means that important and discriminatory sequence regions can be identified from functionally similar proteins that may be highly evolutionarily divergent or where the evolutionary relationships are unclear. Having a wide range of grammars that can be applied in the framework is a significant strength, allowing for flexible pattern discovery. In the current paper we use only variants of a protein regular expression grammar, but other grammars can easily be used depending on the application. For example, context-free grammars could be applied to better identify potential non-local interactions between different regions in the protein sequences. In the current study we have shown that PILGram can be successfully applied to identify patterns in proteins sequences, first by application to known functional sequences from the PROSITE database, and then by application to a set of proteins related by function but where functional determinants of specificity are not well understood. From our initial work with PROSITE families we found that some kinds of patterns may be more amenable to identification using PILGram, but this was a limited proof-of-concept application that would merit further characterization. In the case of the zinc finger pattern, which has variable spacing between active cysteine and histidine measurements we found that very accurate models could be obtained by taking a simple voting approach between multiple independent PILGram models. Application of our approach to the MDR sequences identified a set of over 30 individual PILGram models that, when combined, provided very good accuracy and positive predictive value, relative to a combination of existing HMM models in Pfam. To our knowledge this is the first attempt to develop a predictive model for MDR transporters across families. Similar to our results with PROSITE patterns we found that these models could identify regions known to be important for substrate specificity in MDRs. This represents a step forward in classification of this important group of transporters. The vast number of uncharacterized and often unculturable bacteria in environmental communities represent a large amount of genetic potential given the ability of bacteria to share genetic information. As an example application, we ran our method on sequences identified from a moderately complex community derived from an extreme environment, in this case the Hot Lake unicyanobacterial consortia ( Cole ). We identified five candidates that were strongly predicted by the combination of our models to be MDRs. Given that the positive predictive value of the combined method is nearly 30% it is likely that one or two of these predictions is a true positive. Further research is needed to be able to predict specific drug substrate specificities for MDRs and other transporters. We believe that the method we describe, MDRpred, will complement well the other commonly used sequence annotation methods and that it provides a unique set of predictions about potential novel MDRs. Furthermore, the PILGram approach to identification of functional patterns in unaligned sequences has applications in a large number of other problematic protein groups where function is conserved over sequence.

Data and Software availability

Software access

A publication describing the PILGram software is currently in preparation (Gosink & Bruillard, manuscript in preparation) but the software is available upon request from the authors.

Latest source code

Code implementing the MDRpred algorithm as described is available on Github ( http://github.com/biodataganache/MDRpred).

Source code as at the time of publication

https://github.com/F1000Research/MDRpred/releases/tag/V2.0

Archived source code as at the time of publication

http://dx.doi.org/10.5281/zenodo.17514

Software license

Apache License v2.0 Prediction of multi-drug resistance transporters dataset doi: 10.6084/m9.figshare.1415804 ( McDermott ). It's good to go, my critiques have been adequately addressed . I have read this submission. I believe that I have an appropriate level of expertise to confirm that it is of an acceptable scientific standard. Much improved, and much clearer how the PILGram regex's are being generated and used. I have read this submission. I believe that I have an appropriate level of expertise to confirm that it is of an acceptable scientific standard. Given the growing problem of antibiotic resistance across bacterial pathogens, Multi Drug Resistant (MDR) transporters are an intrinsically important group of bacterial proteins. However, unlike other resistance protein families where precise characterization is possible (i.e. B-lactamases), and while we can often "see" MDR transporters in bacterial genomes due to sequence similarity, it is nearly impossible at the present time to accurately annotate what antibiotic substrates these transporters act on. As genome sequences pile up, and whole genome sequences begin to be used to predict drug resistances/sensitivities in clinical settings, the it becomes increasingly important to accurately describe the roles of MDR transporter complexes. The article from McDermott et al. focuses on using grammar based alignment free approaches in order to predict and classify MDR protein complexes, and develops a program called PILGram for this purpose. The authors do a good job of describing the problem they are addressing throughout the introduction, and giving examples of the utility of grammar based approaches to an audience that is likely not well versed in these analyses. Realistically, the results are not exceptional. The model does a great job of predicting ser/thr phosphatase patterns, but current approaches using similarity based searches do a pretty good job as well. The model does slightly worse than conventional methods with the prediction of zinc-fingers, likely because of their unstructured nature, but taking the consensus using grammar based approaches is still on par with other widely used methods. The authors don't improve on predictions for these two classes with grammar based methods, but they provide a good demonstration that such models can work on par with conventional analyses. I think it's important to develop both sequence based and sequence independent approaches and that these go hand in hand rather than act in a mutually exclusive way. The rubber meets the road when the authors try to predict novel MDR classes, and the results are not great. While numerically, the data seems to show that PILGram is able to be trained to identify MDR transporters with levels of accuracy above randomness, it misses a lot. On the other hand, so do conventional analyses, which is what makes this an interesting problem to tackle. Moreover, the authors use a metagenomic dataset (nicely done by the way, I wasn't expecting that) to try and predict novel MDR transporters. The data do suggest that PILGram can pick up  something of a signal within these metagenomes compared to a soil sample, which is encouraging. However, I'm left with a bit of an unenthusiastic taste in my mouth when I see the table of "high confidence novel transporter proteins" and 3 of the 5 are annotated as some kind of transporters, and the other two are FtsH and a related protein. The authors do point out that it's likely that at least one of these is a true positive (my guess, it's not either of the last two), but it would be good in the discussion if the authors could further flesh out what differentiates the data that PILGram is giving you from simply looking through the annotations for "transporter" proteins given that 3 of 5 are likely transporting something based on the JGI annotation. Said more plainly, it would be good if the authors could describe what PILGram is telling them about the first three genes in table 4 that the annotations don't. I think this would really wrap the story up better. My overall impression is that this is a solid paper, albeit without really exceptional results. However, utilization of these sequence alignment independent grammar models and pipelines and descriptions for how they behave on real world data is a step forward and therefore worthy of being published. The data is solid, and the authors do a good job of describing the limitations. We need anything and everything possible to be able to predict MDR proteins given the large amounts of genome data that are going to be piling up. PILGram will only get better with larger training sets. Slight side note...I'm wondering whether glc-1 from C.elegans should be included in the training set for the "Prediction of multi-drug resistance transporters dataset" table. Seems weird to me given that these are bacterial proteins. I have read this submission. I believe that I have an appropriate level of expertise to confirm that it is of an acceptable scientific standard, however I have significant reservations, as outlined above. We thank both the reviewers for their insightful and very helpful comments. We have revised the manuscript according to the reviewers’ suggestions and feel that it is substantially improved in terms of clarity and potential for reproducibility. Importantly, we have provided more complete data, results, and code that we employ in the paper. Dr. Baltrus points out that two of the high-confidence predictions made by the method are annotated as non-transporter proteins. This issue arises from the fact that a preliminary screen was done on the metagenome to identify transporters (in the ‘Identification of novel MDR transporter candidates from environmental microbiomes’) using Pfam families. As explained in the paper this is necessary because MDRpred was trained only on transporter proteins and so may give spurious results when applied to non-transporters. However, it looks like the FtsH sequence was erroneously included as a transporter- probably because it has an ABC-associated ATPase domain. The other protein, listed as a “Bacterial cell division membrane protein”, has a membrane domain associated with O-antigen, but this appears to be involved in synthesis of O-antigen and not transport. These Pfam families have both been removed from our list for transporters, which is now provided as a data file. Table 4 (now Table 6) has been updated by removing these two predictions and a complete set of higher-confidence predictions is now included as Supplemental Data file. Dr. Baltrus also asked for clarification of what MDRpred would be giving beyond examining annotations for “transporter” proteins. The value of MDRpred is that it will predict which transporter proteins are capable of transporting a specific class of substrates, antibiotic drug compounds. As we point out in the text this is a broad class of compounds and is often incompletely defined for individual well-studied transporters. However, out method is able to accurately classify MDR transporters relative to other transporters that do not transport drug compounds. Even in the case of the first and third predictions (annotated as arabinose and lipid transporters, respectively) the specific annotations are based on best matches by Pfam or BLAST, and may not accurately represent the substrates that are actually transported depending on how close the matches are. We now include an extended discussion of the interpretation of the list of proteins found in Table 4 (now Table 6) in the Results section. Glc-1, a glutamate gated transporter, can confer drug resistance in C. elegans, though it appears that it does not transport drugs itself. We’ve removed it from the training set. Implement a linguistic-based approach that allows the identification of functional patterns from groups of functionally related proteins that does not require alignment of the proteins The method uses regular-expressions that are generated using a parse-tree that is modified via a genetic algorithm, and fitness is scored by accuracy using training data. Able to find discriminative patterns for serine-threonine phosphatases, zinc fingers, and multi-drug resistance (MDR) transporters Predict MDR transporters in a bacterial community from "Hot Lake" as a potential pool for novel MDR transporters that could be transferred to current bacteria as novel source of antibiotic resistance PILGram is able to identify and separate based on the binding region responsible for substrate specificity From this version of the manuscript (v1), the claims are justified. Regular expressions are a linguistic construct, the authors are able to reproduce previously defined regexes without prior alignment using the PILGram method, and classify zinc fingers and MDRs by counting the number of regexes matching a particular sequence, resulting in the MDRPred method. This method, MDRPred was then applied to a newly sequenced bacterial community and possibly novel MDR transporters identified. In addition, from the text, the generation and validation of the regexes was done in a statistically rigorous way, with half of the data used for training and half of the data used for testing / validation / calculation of metrics. This is nice to see in this kind of paper, as it has become the exception rather than the rule. Although I think the general claims can be justified from the text, there are some areas of concern that I think should be addressed in a subsequent version of the manuscript. These reservations fall under these major areas, ordered in what I consider most important to least important: data availability for reproducibility actual MDRPred code actual id's for positive and negative examples Weak "substrate specificity" claim lack of description in the text leading to either lack of clarity or possible misunderstandings PILGram details Physiochemical Properties and TMR Elaboration of clustering Supplemental Table 1 Describing REGEXE's language implying other methods are not "linguistic" Each of these reservations are further detailed below. Not all of the code / data necessary to reproduce the results are currently provided. While acknowledging that the primary algorithm (PILGram) is currently awaiting publication and that this is **not** the place to describe the particulars of that software, I think there are still steps to be taken to improve the reproducibililty of **this** publication by providing more of the data. It should be noted that when the PILGram algorithm is published, this publication should be updated with references and links to make it easier for others to find. That being said, this is a publication about a **method**, and although the particulars of the **method** are well described, there is no accompanying code, scripts, even psuedocode supplied so that the reader might make use of the **method** themselves, either on the provided supplementary FASTA files, or on their own sequences. I searched github for the term "mdrpred", and also for the lead authors' name and twitter username to no avail. The need for an actual script or executable (preferably open source) is increased after reading the description of including PP-PRE and TMR-PRE, and calculating their matches, as this section is a little unclear as to how exactly that calculation is performed with no example (see comment below). In addition to the code, other data that should be included are: UniProt entries for positive and negative examples for serine-threonine phosphatases and zinc fingers genome accession and gene annotations from the metagenome analysed list of metagenome accessions annotated as MDR's using MDRPred Date of download of PROSITE data. prosite.dat on Mar 17, 2015 shows 198 positive matches for PS00125, and I'm assuming 2018 (hard to tell from file) positive matches for PS00028, versus 166 and 1997 sequences mentioned in the text. Text files of the regexes generated by PILGram in each case This is mentioned in the abstract, and 2 times in the introduction. The wording in the abstract implies that the method is able to delineate substrate specificity, i.e. that the method can generate regexes that are specific for different substrates. However, the one result implies rather that the regexes identify the region responsible for substrate specificity (which is really neat). These seem to be two different things in my mind, and I think either the claim in the abstract and introduction should be dropped or clarified, especially given that there is only one example provided. Finally, the claim is further weakened in the current text because the word **substrate** is missing from the paragraph discussing the evidence for substrate specificity (Results, Drug resistance transporters, Functional motifs identified, last paragraph in that section, no mention of "substrate", just specificity). More so than the "substrate specificty" claim, I think the authors would do well to place more emphasis on the fact that *all* of this work is done on sets of sequences **without alignment** first! It might just be me, but this was to me one of the most important things in the paper (and something I will probably make use of in my own research), that did not seem to be highlighted enough. PILGram Algorithmic Details Again I acknowledge that this is not the place to detail the full inner-workings of the PILGram algorithm, and the example in the text for BMI is useful. However, most genetic algorithms have a defined chromosome length defining the solution. I would have expected an analogous situation for PILGram, in that one would have to define the **length** of the regular expression. This does not appear to be the case here, given the variety of reg-ex's noted for Zinc fingers and MDRs. As far as I can tell, this is likely due to the way that individual trees can be recombined, but it is not clear from the text how different length regexes result. Clarification of how different length regexes result would be useful. Physiochemical Properties and TMR I think I understand why the physiochemical properties (PP) and transmembrane region (TMR) score were included for the MDRPred, however there is currently no discussion of their inclusion or justification in the text. From the current description of them, it is also difficult to imagine how something matches the PP-PRE and TMR-PRE, including the PP and TMR scores as part of the match. Therefore I recommend: Having a better description of the PP and TMR scores in Methods Justification for the inclusion of PP-PRE and TMR-PRE in MDRPred. Currently the only justification is "Because we believed ...". I would hazard a guess that the accuracy drops precipitously without them, but there is nothing in the text currently describing why they are needed. Giving examples of how some PPs are different for different AAs Example of calculation of PP score and TMR score for a regex match Example of full match for a derived PP-PRE or TMR-PRE Elaboration of clustering In the Results, "Functional motifs identified", a description of clustering the generated models is provided. The current description is ambiguous. I think what was done was a vector of length 71 (corresponding to the number of training sequences) was generated for each model, with a 1 indicating a match to the model, and 0 indicating no match to the model. These 36 vectors (one for each model) were subsequently clustered using hierarchical clustering. No description of what distance metric was used to calculate the distance between the model vectors, nor which hierachical clustering method was used is provided. In the R stats package, there are: two variations of Ward's minimum variance method, the complete linkage method, the single linkage method, median, and centroid. The software, version, and algorithm reference should be provided for completeness. Supplemental Figure 4 should have the clusters indicated on the figure (boxes or something). Supplemental Table 1 I believe supplemental table 1 could benefit from including: a description of what each column is beyond the title (for example, what is the difference between RESmall and RE??) a description of the PP that are included (it appears there are only 11 that end up being used) an indication of which are PRE, PP-PRE, and TMR-PRE Describing REGEXE's I use regular expressions regularly, but even still I found it difficult to follow the regular expressions listed in the text without looking to a reference. A short description, even in the supplemental materials of general features of the regexes would be useful. For example, the fact that [ABC] means one of either A or B or C at that position, that {3, 8} means either 3 or 8 letters between the previous and the next thing, and that [^ABC] means none of either A or B or C. Further, having examples of what portion of a sequence is matched, especially for the serine-threonine case where the sequence interval in general overlaps between the PROSITE pattern and the PILGram derived pattern. But also having examples for the Zinc finger showing the attributes shown, or describing what part of the regex encodes which features would help a lot. Language implying other methods are not linguistic In its current form, the abstract reads: "In this paper we describe a linguistic approach to identify ..." This implies that regular expressions in PROSITE and hidden markov models are not "linguistic" approaches. However, in the text, describing regular expressions used by PROSITE as the simplest form of grammar (regular grammars), and Hidden Markov models as a type of regular grammar (Introduction, paragraph 3). If these are grammars, then that implies they are linguistic approaches. In fact, from the description in the manuscript, PILGram generates regular expressions that in some cases are very similar to those used by PROSITE. It seems currently unclear as to how generating regular expressions using PILGram is a "linguistic" approach, but aligning and finding common features (as in PROSITE or HMMs) is not. I understand that PILGram is able to generate discriminative regexes without alignment first, and that is very useful (as exemplified by this manuscript), but from the current description that does not make it "linguistic". I admit I may be missing something in reading the current text in this area, as I am not a linguist. Methods: under PILGram, first sentence, a reference is missing to SIEVE. Methods: PILGram example, example grammar, spaces around symbols would greatly improve the readability In Results: actually identify the **core** of the PROSITE reg-ex that PILGram is able to capture, noting that PILGram drops the first and last AA in the PROSITE one, and adds **Q** to the set of alternatives compared to PROSITE. Results: paragraph 2 says "Supplemental Table 1", but I believe this should be "Supplemental Figure 1". Results: "We found that applying logistic regression to combine these seven models provided a similar performance as the voting method, but underperformed the logistic regression on the complete set of models." **how much** did it underperform, curious minds want to know?? Methods: hot lake peptide data, the wording implies single bacterium genome, however, the **Results** makes it clear that a metagenome is being used. One of these two sections should be modified to clarify whether it was a single genome or a metagenome. In addition, if these sequences have been submitted, accession numbers should be provided. I have read this submission. I believe that I have an appropriate level of expertise to confirm that it is of an acceptable scientific standard, however I have significant reservations, as outlined above. We thank both the reviewers for their insightful and very helpful comments. We have revised the manuscript according to the reviewers’ suggestions and feel that it is substantially improved in terms of clarity and potential for reproducibility. Importantly, we have provided more complete data, results, and code that we employ in the paper. Dr. Flight had a number of points grouped by subject matter so I’ve addressed each of them below using the same organization. Data and code availability Dr. Flight’s points are very good. We now include the requested datasets in the manuscript and reference them appropriately (see below for details). We have put a script and associated files on Github that represents the MDRpred algorithm as an open source project at: https://github.com/biodataganache/MDRpred The following data files have been added to the manuscript: UniProt ids and sequences have been included for both positive and negative examples for the PS00125 and PS00028 PROSITE patterns. Genome accessions and links to genome annotations for all sequenced genomes in the metagenome used have been provided. Sequence bins (that is, sequences that are specific to a species that hasn’t been sequenced as an axenic culture) are currently being deposited in GenBank and the manuscript will be updated when accession numbers are available. A full list of high-confidence MDR predictions from the metagenome and their annotations are provided. The original PROSITE data records used in our analysis are provided. These both have been updated in PROSITE since our analysis and the numbers of sequences changed then. The lists regular expressions associated with each problem (the two PROSITE patterns and the MDR task) are now provided as text files. As soon as the PILGram code is released we will update the manuscript with a link to the software and citation for the publication. Weak substrate specificity claim We have updated the manuscript in several places (Introduction, Results, and Discussion) to clarify our claim of substrate specificity. MDRpred predicts substrate specificity at a broader class level, essentially drug-type compound or not. We have included text to explain this distinction and also updated our discussion of specificity in the Results section to make clear that we mean substrate specificity at this broad level. We have also added stronger language about the lack of need for sequence alignment for our method to work, which we agree is one of the major points in the paper. PILGram Algorithmic details In the Methods section we include a paragraph describing how the genetic algorithm operates on parse trees. It is indeed the case that the length of the regular expression is not fixed because genetic algorithm recombinations occur on these trees. We believe that this, combined with the other clarifications of the method now included in the revision, should adequately resolve this confusion. Physiochemical Properties and TMR To address Dr. Flight’s comments we have greatly expanded our description of how the physicochemical properties and TMR scoring and grammars work. Also we have examined the contribution of models arising from each of these grammars to the overall method performance. Interestingly, we found that models from each grammar displayed very similar performance independently and each contributed to the final combined performance. We now provide examples of matches and of how the scores are calculated for different sequences and for different physicochemical properties. This was a good suggestion and we believe that the manuscript is really strengthened with these revisions. Elaboration of clustering The details of the clustering approach are now described in a new Methods subsection, “ Pattern clustering”. Supplemental Table 1 Supplemental Table 1 now includes column descriptions, descriptions for the PPs that were included, and a column indicating the source of each pattern (PRE, TMR-PRE, or PP-PRE). Describing REGEXE’s We have added a subsection to the Methods titled, “Regular Expressions”, which summarizes interpretation of the regular expressions found in the manuscript. We have also added examples for the PROSITE patterns showing which portions of sequences were matched by the PILGram-generated patterns as new Tables 2 and 4 the Results section. The full alignment files are now provided as supplemental data files. Language implying other methods are not linguistic Dr. Flight’s point is well-taken. It was not our intent to imply that other approaches, like those we mention (HMMs and PROSITE), are not derived from linguistics. We have revised the text throughout to make clear that other currently used bioinformatics methods are also derived from linguistics. Simple improvements All addressed.
SymbolsExample useDescription
..Matches any single residue
[XYZ][AFGHL]Matches any single residue that is contained in the brackets
[^XYZ][^KR]Matches any single residue that is not contained in the brackets
[X-Y][A-E]Indicates a range of residues in alphabetical order
^^MSTMatches the start (N-terminus) of the sequence
$FGH$Matches the end (C-terminus) of the sequence
X*A*Matches zero or more of the preceding element
X+K+Matches one or more of the preceding element
X?C?Matches zero or one of the preceding element
X{Y}L{20}Matches the indicated number of the preceding element
X{Y,Z}R{2,4}Matches preceding element Y or Z times
Columns are as follows
OrderThe order the pattern was generated (no significance)
PPIf the pattern includes physiochemical properties this column indicates which property was used. NA indicates no PP was used.
RESmallA canonical regular expression generated by PILGram (non- canonical expressions are in column labeled RE)
AccuracyThe cross-validated accuracy of this pattern
ClusterThe cluster assignment from clustering patterns based on which examples were matched
ClusterNameA descriptive name for the cluster
Grammar The original grammar used for generation of the pattern. Note that TMR-PRE will result in similar patterns as PRE because it simply biases the search space at the outset
REThe original regular expression generated by PILGram. This is functionally equivalent to the RESmall, but frequently contains redundant character sets.
PPs included
_ChargeD1100Distribution of positively charged amino acids [KR]
_HydrophobicityD3100Distribution of hydrophobic amino acids [CLVIMFW]
_NormalizedVDWVD2001Distribution of medium-sized amino acids [NVEQIL]
_NormalizedVDWVT13Transitions between small and large amino acids [GASTPD] <->[MHKFRYW]
_PolarityD3100Distribution of highly polar amino acids [KMHFRYW]
_PolarizabilityT12Transition between low and medium polarizable amino acids [GASDT]<->[CPNVEQIL]
_SecondaryStrD1075Distribution of amino acids that tend to form alpha helices [EALMQKRH]
_SecondaryStrT13Transition between helical and coil amino acids [EALMQKRH]<->[GNPSD]
_SolventAccessibilityD1100Distribution of amino acids that tend to be buried [ALFCGIVW]
_SolventAccessibilityD3075Distribution of amino acids that tend to be intermediate between buried and exposed [MPSTHY]
_SolventAccessibilityT12Transition between buried and exposed amino acids [ALFCGIVW]<->[RKQEND]
  32 in total

1.  The Pfam protein families database.

Authors:  A Bateman; E Birney; R Durbin; S R Eddy; K L Howe; E L Sonnhammer
Journal:  Nucleic Acids Res       Date:  2000-01-01       Impact factor: 16.971

Review 2.  Computational prediction of type III and IV secreted effectors in gram-negative bacteria.

Authors:  Jason E McDermott; Abigail Corrigan; Elena Peterson; Christopher Oehmen; George Niemann; Eric D Cambronne; Danna Sharp; Joshua N Adkins; Ram Samudrala; Fred Heffron
Journal:  Infect Immun       Date:  2010-10-25       Impact factor: 3.441

3.  IMG ER: a system for microbial genome annotation expert review and curation.

Authors:  Victor M Markowitz; Konstantinos Mavromatis; Natalia N Ivanova; I-Min A Chen; Ken Chu; Nikos C Kyrpides
Journal:  Bioinformatics       Date:  2009-06-27       Impact factor: 6.937

Review 4.  Molecular mechanisms of antibiotic resistance.

Authors:  Jessica M A Blair; Mark A Webber; Alison J Baylay; David O Ogbolu; Laura J V Piddock
Journal:  Nat Rev Microbiol       Date:  2014-12-01       Impact factor: 60.633

5.  Probabilistic grammatical model for helix-helix contact site classification.

Authors:  Witold Dyrka; Jean-Christophe Nebel; Malgorzata Kotulska
Journal:  Algorithms Mol Biol       Date:  2013-12-18       Impact factor: 1.405

6.  Prediction of protein folding class using global description of amino acid sequence.

Authors:  I Dubchak; I Muchnik; S R Holbrook; S H Kim
Journal:  Proc Natl Acad Sci U S A       Date:  1995-09-12       Impact factor: 11.205

Review 7.  Multidrug resistance in bacteria.

Authors:  Hiroshi Nikaido
Journal:  Annu Rev Biochem       Date:  2009       Impact factor: 23.643

8.  Prodigal: prokaryotic gene recognition and translation initiation site identification.

Authors:  Doug Hyatt; Gwo-Liang Chen; Philip F Locascio; Miriam L Land; Frank W Larimer; Loren J Hauser
Journal:  BMC Bioinformatics       Date:  2010-03-08       Impact factor: 3.169

9.  Accurate prediction of secreted substrates and identification of a conserved putative secretion signal for type III secretion systems.

Authors:  Ram Samudrala; Fred Heffron; Jason E McDermott
Journal:  PLoS Pathog       Date:  2009-04-24       Impact factor: 6.823

10.  Trimmomatic: a flexible trimmer for Illumina sequence data.

Authors:  Anthony M Bolger; Marc Lohse; Bjoern Usadel
Journal:  Bioinformatics       Date:  2014-04-01       Impact factor: 6.937

View more
  2 in total

1.  Prediction of multi-drug resistance transporters using a novel sequence analysis method.

Authors:  Jason E McDermott; Paul Bruillard; Christopher C Overall; Luke Gosink; Stephen R Lindemann
Journal:  F1000Res       Date:  2015-03-09

2.  Prediction of bacterial E3 ubiquitin ligase effectors using reduced amino acid peptide fingerprinting.

Authors:  Jason E McDermott; John R Cort; Ernesto S Nakayasu; Jonathan N Pruneda; Christopher Overall; Joshua N Adkins
Journal:  PeerJ       Date:  2019-06-07       Impact factor: 2.984

  2 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.