Literature DB >> 25961797

Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus.

Haiyan Xu1,2, Chelsea L Gustafson3, Patrick J Sammons3, Sanjoy K Khan1, Nicole C Parsley3, Chidambaram Ramanathan1, Hsiau-Wei Lee3, Andrew C Liu1,2, Carrie L Partch3,4.   

Abstract

The molecular circadian clock in mammals is generated from transcriptional activation by the bHLH-PAS transcription factor CLOCK-BMAL1 and subsequent repression by PERIOD and CRYPTOCHROME (CRY). The mechanism by which CRYs repress CLOCK-BMAL1 to close the negative feedback loop and generate 24-h timing is not known. Here we show that, in mouse fibroblasts, CRY1 competes for binding with coactivators to the intrinsically unstructured C-terminal transactivation domain (TAD) of BMAL1 to establish a functional switch between activation and repression of CLOCK-BMAL1. TAD mutations that alter affinities for co-regulators affect the balance of repression and activation to consequently change the intrinsic circadian period or eliminate cycling altogether. Our results suggest that CRY1 fulfills its role as an essential circadian repressor by sequestering the TAD from coactivators, and they highlight regulation of the BMAL1 TAD as a critical mechanism for establishing circadian timing.

Entities:  

Mesh:

Substances:

Year:  2015        PMID: 25961797      PMCID: PMC4456216          DOI: 10.1038/nsmb.3018

Source DB:  PubMed          Journal:  Nat Struct Mol Biol        ISSN: 1545-9985            Impact factor:   15.369


INTRODUCTION

Mammalian circadian rhythms integrate behavior, physiology and metabolism into daily cycles that are coordinated with the solar day[1]. Circadian timing arises from a genetically encoded oscillator that uses transcriptional feedback loops to generate a self-sustaining clock and control the output of clock-controlled genes with near 24-hour periodicity[2]. At the core of this molecular circadian clock, the heterodimeric basic helix-loop-helix PER-ARNT-SIM (bHLH-PAS) transcription factor CLOCKBMAL1 drives expression of the Period (Per) and Cryptochrome (Cry) genes. PER and CRY proteins form complexes that are posttranslationally modified to control stability and translocation into the nucleus where they repress CLOCKBMAL1-mediated transcription, thereby closing the transcriptional feedback loop[3-5]. However, the mechanisms by which PER and CRY fulfill their roles as negative transcriptional regulators are still not fully understood. In addition to its role in early repressive PER–CRY complexes, CRY1 also interacts directly with CLOCKBMAL1 in vitro[6] and on chromatin later in the circadian cycle[7,8], and it can potently repress CLOCKBMAL1 activity in the absence of PER[9,10]. Therefore, identifying how CRY1 regulates CLOCKBMAL1 will provide valuable insight into its essential role in the molecular circadian clock. Because many factors contribute to robustness of circadian behavior at the organismal level (e.g., intercellular coupling in the suprachiasmatic nucleus and other systemic cues), delineating the biochemical mechanisms needed to establish circadian cycling from in vivo studies has been challenging[11,12,13]. For example, BMAL1 (also known as ARNTL) and its partner CLOCK interact through their N-terminal bHLH and tandem PAS domains[14]; these core bHLH-PAS domains are largely conserved in the paralog BMAL2 (also known as ARNTL2). However, Bmal1–/– mice lack all behavioral and molecular circadian rhythms, establishing its essential role in the molecular circadian clock[15]. While overexpression of Bmal2 in Bmal1–/– mice can partially rescue circadian behavior, paradoxically, it does not restore circadian rhythms in most tissues[16]. Therefore, we still lack a fundamental understanding of how core clock proteins function to generate the transcription-based circadian clocks in mammals. The distinct functions of the two Bmal paralogs offer a heuristic opportunity to uncover properties of CLOCKBMAL1 that are needed to generate circadian oscillations. To define the circadian function of BMAL1, we employed cell-based genetic complementation in Bmal1–/– fibroblasts derived from mice harboring the Per2 transgenic reporter[17]. Domain-based swapping of Bmal1 and Bmal2 revealed the oscillatory function of the BMAL1 C-terminus that functionally distinguishes it from its non-circadian paralog, BMAL2. We found that CRY1 binds to the transactivation domain (TAD) of BMAL paralogs at sites that overlap with binding of the coactivator, CBP (CREB-binding protein) and its homolog, p300. Mutations within the TAD markedly altered affinities for CRY1 and caused large changes in period length. These findings provide new insights into transcriptional regulation by CRY1 and demonstrate that the BMAL1 TAD plays an important role in establishing 24-hour timing.

Only BMAL1 can generate cell-autonomous circadian rhythms

Fibroblasts derived from Bmal1–/– Per2 mice are completely arrhythmic, but circadian rhythms can be restored through genetic complementation of Bmal1 under control of the constitutive UBC promoter[17]. Bmal2 was unable to rescue circadian rhythms in these cells, even when its transcript and protein were expressed to similar levels as Bmal1 ( and ). Moreover, Bmal2 was neither upregulated in Bmal1–/– cells nor upon ectopic expression of Bmal1 (), displaying a lack of paralog compensation that is a common network feature of genes involved in molecular circadian clocks[18]. Compared to high amplitude oscillations of Per2 and Rev-erbα mRNA expression in Bmal1-rescued cells, we observed constitutive expression of Per2 and Rev-erbα in cells expressing Bmal2 but with lower overall mRNA levels, perhaps caused by increased expression of Cry1 in these cells (). Overall, these data demonstrate that E-box-mediated circadian transcription is substantially attenuated in the absence of Bmal1. Therefore, Bmal1 and Bmal2 are not functionally redundant; while Bmal1 is an essential clock component, Bmal2 is not sufficient to support the circadian clock at the cellular level.

BMAL paralogs have similar steady-state activities

To begin to explore differences in the BMAL paralogs, we compared biochemical activities known to be critical for circadian function. Using a mammalian two-hybrid assay, we showed that BMAL2 had a slightly higher intrinsic affinity for CLOCK than BMAL1 (). Steady-state transcription assays showed that CLOCKBMAL2 also activated transcription of the Per1-luciferase (Per1-Luc) reporter to higher levels than CLOCKBMAL1 (), all consistent with previous observations[19,20]. Increased transcriptional activation by BMAL2 may correlate with its higher affinity for CLOCK, as mutations that decrease affinity of BMAL1 for CLOCK lead to decreased transactivation[14]. Moreover, complexes of CLOCK with either BMAL1 or BMAL2 were both capable of further activation by CBP or p300, and repression by CRY1 (). Therefore, even though BMAL2 is unable to support the molecular circadian clock in Bmal1–/– cells, its steady-state activities appear to be comparable to BMAL1. These apparently paradoxical data suggest that a balance of affinities for transcriptional coregulators may be important for establishing the appropriate strength of activation and repression needed to establish circadian oscillations.

The C-terminus of BMAL1 is needed for circadian cycling

To identify specific sequences in BMAL1 that confer circadian function, we generated a series of domain-swapping chimeras by systematically substituting regions of Bmal1 with corresponding sequences from Bmal2 (). To minimize issues with protein misfolding, we used highly conserved or identical sequences at swap junctions () and tested the ability of chimeras to express full-length proteins (). We then examined the ability of the chimeras to restore circadian rhythms in Bmal1–/– Per2 fibroblasts following lentiviral transduction and stable selection. The Bmal1-A2 mutant, harboring substitution of the distal N-terminus of Bmal2 into Bmal1, restored circadian rhythms of the same period () albeit with significantly lower amplitude than wild type Bmal1 () possibly arising from the lack of an NLS in the BMAL2 N-terminus[21]. Chimeras based on swaps of other individual regions within the core bHLH-PAS domains of BMAL2 (i.e., Bmal1-B2, -C2, -D2, -E2 and -F2) were all able to rescue circadian rhythms, albeit with some changes in period (-D2) or amplitude (-D2, -E2) depending on the individual region ( and ). A Bmal1 chimera containing the intact, tandem PAS domains from Bmal2 was also able to rescue circadian rhythms (). By contrast, substitution of the PAS domain core of Bmal1 into Bmal2 (the Bmal2-PAS1 mutant) did not confer the ability to generate rhythms to Bmal2 (). Together, these data demonstrate that the distal N-terminus and bHLH-PAS core domains do not define the distinct ability of BMAL1 to generate circadian rhythms. Next we examined the divergent C-termini, focusing on the H region that encompasses a transcriptional activation domain (TAD) at the distal C-terminus[22], and an upstream G region that contains the intervening sequence after the PAS domains (). Swaps of either the G or H region (Bmal1-G2 and Bmal1-H2) rescued circadian rhythms, but exhibited a significantly shorter period and lower amplitude compared to Bmal1 ( and ). Strikingly, a Bmal1 chimera fused to the entire C-terminus of Bmal2 (Bmal1-G2H2) was unable to restore circadian rhythms of the Per2 reporter () or mRNA expression of clock-controlled genes (). Therefore, the sequence determinants that distinguish the circadian functions of the two BMAL paralogs lie in their divergent and poorly characterized C-termini.

BMAL1 C-terminal TAD determines circadian period

To begin to dissect how the BMAL1 C-terminus regulates circadian function, we focused our attention on the transactivation domain of the H region. The ability of the TAD to interact with both negative[22-25] and positive[26] transcriptional coregulators provides a clear first step towards understanding how the BMAL1 C-terminus may control protein interactions and progression of circadian transcription. We began by confirming that the TAD is both required for transcriptional activation by CLOCKBMAL1[22] and necessary to rescue circadian cycling in Bmal1–/– Per2 fibroblasts (). In our chimera studies, substitution of the Bmal2 TAD (H domain) into Bmal1 gave rise to a circadian period that was more than three hours shorter than wild-type (WT) Bmal1 (). Nearly half of the C-terminal 30 residues in the TAD are divergent between BMAL1 and BMAL2 (), with many in the predicted α-helix (). To identify the sequence determinants that give rise to this dramatic change in period length, we performed site-directed mutagenesis to mutate groups of Bmal1 TAD residues to their corresponding sequences in Bmal2 and tested their ability to rescue circadian rhythms in Bmal1–/– Per2 fibroblasts. Two Bmal1 mutants, E597S A598I A599D and V602A I603F, exhibited significantly shorter period lengths (~22.5 and ~22.0 h, respectively) compared to WT Bmal1 (~23.5 h) (). The effect of these mutations was nearly additive, as the combined Bmal1 mutant (E597S A598I A599D V602A I603F) led to a substantially shorter period length (~20.6 h) (). The Bmal1 V602A I603F mutant may interfere with function of the TAD IxxLL recognition motif (), a helical sequence known to recruit proteins associated with transcriptional regulation such as the KIX domain of CBP or p300 (refs. 27,28). Mutation of the first leucine within the IxxLL motif in the Bmal1 S605N L606Y mutant led to a significantly longer period and higher amplitude cycling compared to Bmal1 (). Therefore, we observed large changes in period length of the molecular circadian clock (~5 h from shortest to longest) upon incorporation of BMAL2 residues into the BMAL1 TAD α-helix. These data suggest that modulation of TAD structure and/or interactions with transcriptional coregulators can fine-tune the balance of activation and repression to control progression of the circadian clock.

The BMAL1 TAD is intrinsically unstructured

Striking changes in circadian period elicited by TAD mutations prompted us to investigate the biochemical basis by which the TAD regulates CLOCKBMAL1 function. The last 30 residues of the TAD are highly conserved between vertebrates and insects that possess a vertebrate-like clock (), in which transcriptional repression is driven by CRY[29]. Aside from the single α-helix, the BMAL1 TAD (residues 579-626) is predicted to be intrinsically disordered, typical of transactivation domains found in other transcription factors[30]. Given the predicted flexibility of this essential domain, we turned to solution NMR spectroscopy to study the TAD. A heteronuclear single quantum coherence (HSQC) spectrum of the 15N-labeled TAD protein backbone displayed the modest chemical shift dispersion expected for a disordered protein. The lack of structure was verified by chemical shift analyses of Cα and Cβ assignments[31,32], which confirmed modest helical propensity localized only to the predicted α-helical region ().

CRY1 and CBP(p300) compete for BMAL1 TAD binding

To examine binding of transcriptional coregulators on the BMAL1 TAD, we used the CRY1 CC peptide representing a monomeric, surface-exposed α-helix on CRY1 needed for CLOCKBMAL1 repression[33], or the isolated CBP(p300) KIX domain, one of several TAD-binding modular domains from CBP and p300 proteins (). Both the CRY1 CC and CBP(p300) KIX domain have been reported to interact with the BMAL1 TAD[24,26]. To identify binding sites on the TAD, we collected 15N HSQC spectra of 15N-labeled TAD alone or in the presence of coregulators. Titration of 15N TAD with either the CRY1 CC, CBP or p300 KIX domains led to chemical shift perturbations at similar residues, confirming their interaction and further demonstrating that their binding sites overlap on the TAD (). Marked differences in the linewidth of 15N TAD crosspeaks occurred upon binding to coregulators, particularly at residues in or near the IxxLL motif (e.g. V602 and S605, ). As other TADs can undergo a coupled folding and binding process to form helical complexes with KIX domains[34], the observed changes in linewidth upon coregulator binding reflect different rates of chemical exchange that could arise from changes in affinity, conformational exchange, or both. Chemical shift mapping revealed that the shared binding sites center on the canonical KIX-binding IxxLL motif within the TAD α-helix, as well as a second cluster of seven residues in the distal C-terminus (). The CRY1 binding sites we identify here agree with previous studies that indicate 1:1 stoichiometry of the complex[23-25]. To determine if CRY1 and p300 could compete for binding to the TAD, we performed a 15N HSQC titration with 15N TAD and CRY1 CC to a 1:1 stoichiometric ratio, and then added an equivalent amount of the p300 KIX domain (). 15N TAD crosspeaks are expected to fall somewhere between the binary 15N TAD–CRY1 or 15N TAD–KIX complexes, representing a population-weighted average of binary complexes present in solution. We found that 15N TAD crosspeaks moved near the 15N TAD–KIX complex (), reporting that the p300 KIX domain can effectively compete CRY1 CC off the TAD in vitro.

Dynamic interactions of TAD with CRY1 and CBP(p300)

To investigate coupling between the TAD α-helix and distal C-terminus, we took advantage of paramagnetic relaxation enhancement (PRE) with manganese, a paramagnetic cation that induces loss of peak intensity when brought into close proximity (~20-25 Å) to NMR-active nuclei. We acquired 15N HSQC spectra of 15N TAD possessing a C-terminal cysteine covalently coupled to EDTA (15N TAD–EDTA) in the presence and absence of chelated Mn2+. Covalent modification of the TAD with EDTA via the added cysteine does not impact complex formation with p300 KIX or CRY1 CC (). We found no evidence that the distal C-terminus interacts appreciably with the α-helix in the free TAD, as Mn2+-dependent broadening was confined to residues proximal to the labeling site (), consistent with localized PRE effects seen in other disordered proteins[35]. To determine if the TAD undergoes dynamic conformational rearrangement upon complex formation, we collected 15N HSQC spectra of the 15N TAD–EDTA ± Mn2+ titrated with either p300 KIX or CRY1 CC (). Quantitative analysis of Mn2+-dependent changes in peak intensity identified regions near the TAD helix that are decreased upon formation of both 15N TAD–p300 KIX () and 15N TAD–CRY1 CC complexes (). We observed a striking, near complete loss of signal intensity at the TAD α-helix upon binding to CRY1 CC (), suggesting that the distal C-terminus is brought into close proximity to the TAD α-helix in a CRY1-dependent manner. A 15N TAD mutant lacking the seven residues at the distal C-terminus lost this CRY1- and Mn2+-dependent broadening of the TAD α-helix (), demonstrating the dependence of the conformational rearrangement on the distal C-terminus. Thus, the BMAL1 TAD is highly dynamic in its interactions with transcriptional coregulators.

TAD mutations alter affinity for CRY1 and CBP(p300)

To explore functional differences in the TADs of BMAL1 and BMAL2, we generated a suite of mutant proteins to quantitatively compare against WT TAD interactions with transcriptional coregulators. Like BMAL1, the BMAL2 TAD (residues 540-579) is intrinsically disordered with a weakly formed α-helix, and it interacts with both p300 KIX and CRY1 CC at the α-helix as well as the C-terminal seven residues (). We focused on two substitution mutants of the BMAL1 TAD α-helix (the short period V602A I603F mutant and long period S605N L606Y mutant) (see ), and two structure-based mutants, the L606A L607A mutant, designed to interfere with the IxxLL motif, and the 619X truncation mutant that removed the C-terminal seven residues. In all cases, mutation-induced backbone chemical shift perturbations localized to the site of mutation, demonstrating that we can selectively perturb either the α-helix or the distal C-terminus (). We determined affinities of the TADs for the CBP KIX domain or CRY1 CC using isothermal titration calorimetry (ITC, ). Due to relatively low heats evolved in the TAD–CRY1 CC ITC experiments, we also determined affinities for CRY1 CC using a fluorescence polarization (FP) assay () and obtained comparable affinities to our ITC data (Table 1). The L606A L607A mutant disrupted interaction with the CBP KIX domain or CRY1 CC under our assay conditions (). We found that the other TADs had relatively similar affinities for the CBP KIX domain while affinities for CRY1 CC varied by an order of magnitude. Notably, the short period V602A I603F mutant decreased affinity for CRY1 CC by about three-fold compared to the WT BMAL1 TAD, while the long period S605N L606Y mutant increased affinity by about three-fold (Table 1). These opposing phenotypes result from substitution of different residues from BMAL2; however, affinity of the intact BMAL2 TAD was similar to BMAL1 (Table 1), suggesting a complicated interplay of sequence context and structural dynamics in recognition of transcriptional coregulators by BMAL paralog TADs. Moreover, truncation of the C-terminal seven residues (619X) decreased affinity for CRY1 CC to an extent similar to the V602A I603F mutation. Collectively, these data suggest that the IxxLL motif in the TAD α-helix is the major binding site for both CRY1 CC and CBP(p300) KIX domains, although the distal C-terminus also makes an important contribution. The preferential effect of mutations on CRY1 binding relative to CBP(p300) suggests that modulating affinity for CRY1 may elicit the changes in circadian periodicity we measured in the mutants.

TAD mutations perturb circadian timekeeping

To test our prediction that BMAL1 TAD interactions play an important role in period determination, we complemented Bmal1–/– Per2 cells with either the C-terminal truncation (619X) or the L606A L607A mutant of Bmal1. Truncation of the C-terminus shortened the intrinsic period by nearly three hours, while the L606A L607A mutant abolished cycling ( and ). Given that these TAD mutations substantially reduce affinity for CRY1 (Table 1), we sought to measure CRY1 repression of CLOCKBMAL1 mutants in Per1-Luc reporter assays. CLOCK–BMAL1 complexes harboring either the L606A L607A or 619X mutation exhibited decreased steady-state activity, although BMAL1 proteins were expressed to similar levels ( and ). Repression by CRY1 was significantly reduced with both mutants, but to a greater extent with the L606A L607A mutant (), consistent with our observation that this mutation leads to a greater reduction in apparent affinity for CRY1 (Table 1).

CRY1 binds to multiple sites on CLOCK–BMAL1

Formation of a stable ternary complex consisting of CLOCK, BMAL1, and CRY1 lies at the heart of CRY1-dependent negative feedback in the clock[6,7,10,36]. Given the modest affinities that we measured for the BMAL1 TAD and isolated CRY1 CC peptide, we reasoned that there are likely other interactions between the CLOCK–BMAL1 complex and CRY1. Mutations that localize in or adjacent to the solvent-exposed HI loop of the CLOCK PAS-B domain (named for its location between the Hβ and Iβ strands of the PAS domain; )[14] also reduce repression by CRY1 (refs. 22,25,37). To determine if mutation of the CLOCK HI loop (Q361P W362R) affects complex formation with CRY1, we performed coimmunoprecipitation assays to examine interaction of CRY1-myc with WT or HI mutant Flag-tagged CLOCK and WT BMAL1. We showed that, while WT CLOCK and BMAL1 coimmunoprecipitated with CRY1-myc, mutation of the CLOCK HI loop rendered CLOCK and BMAL1 unable to stably interact with CRY1-myc ( and ). Taken together, complex formation between CRY1 and CLOCKBMAL1 occurs through interactions with both the BMAL1 C-terminus and CLOCK PAS-B. To explore how the interaction of CRY1 with CLOCK PAS-B impacts regulation of CLOCKBMAL1, we assayed Per1-Luc activity. Transcriptional activation by CLOCK HI–BMAL1 complexes is similar to WT CLOCKBMAL1 (), but repression by CRY1 is significantly reduced (). Strikingly, we found that mutation of the CLOCK PAS-B HI loop in conjunction with BMAL1 L606A L607A or 619X eliminated repression by CRY1 (), even when CRY1 was overexpressed to suprastoichiometric levels relative to CLOCKBMAL1 (). We could not detect a direct interaction between CRY1 CC and 15N CLOCK PAS-B by NMR spectroscopy ( and ), indicating that the CLOCK PAS-B domain mediates interactions with CRY1 through a site distinct from the CRY1 CC α-helix. Therefore, simultaneous disruption of CRY-interacting interfaces on CLOCK PAS-B and the BMAL1 TAD eliminates CRY1 regulation of CLOCKBMAL1, demonstrating the importance of multivalent interactions for CRY1 repression.

DISCUSSION

Our study leveraged the finding that although BMAL1 and its close paralog BMAL2 share similar steady-state biochemical activities, BMAL2 is unable to sustain circadian cycling[15,17], allowing us to discover that the C-terminus of BMAL1 holds the key to generating circadian oscillations by BMAL paralogs. By integrating data from biophysical and cell-based assays, we now identify the important role the BMAL1 TAD plays in the clock and highlight two distinct binding sites on CLOCKBMAL1 that are required for CRY1 function. The first site on the CLOCK PAS-B domain presumably functions as a docking site to localize CRY1 to the complex, and the second site on the BMAL1 TAD controls the circadian activity of CLOCKBMAL1. From the mutations studied here, we find that affinity of the TAD for CRY1 appears to correlate with period; decreasing affinity leads to shorter periods while increasing affinity leads to longer periods (). We find it compelling that substitution of only a few residues within the BMAL1 TAD α-helix can elicit circadian rhythms with shorter or longer than normal periods (), demonstrating that the TAD plays an important role in establishing intrinsic circadian timekeeping. Our observation of opposing period phenotypes encoded by adjacent sequences within the α-helix of the BMAL2 TAD may explain why it is an outlier when comparing CRY1 affinity and period (). Additional studies of BMAL1 and BMAL2 TADs that also take into consideration the G region identified in this study will be needed to understand the biochemical properties of BMAL1 that enable the dynamic interactions with coregulators that underlie generation of self-sustaining circadian rhythms. CRY1 appears to fulfill part of its essential role as a negative regulator by interacting directly with CLOCKBMAL1 to sequester the BMAL1 TAD from coactivators (). Here we examined interactions of the BMAL1 TAD with the CBP(p300) KIX domain as a proxy for coactivator recruitment. We expect that our proposed mechanism for CRY1, linking inhibition to TAD sequestration, will hold true for other coactivators and other domains from CBP(p300) that may interact with the BMAL1 TAD. It is worth noting that the related bHLH-PAS transcription factor HIF (hypoxia-inducible factor) uses both TAD-dependent and -independent modes to recruit transcriptional regulators[38-40], suggesting the potential for additional regulatory mechanisms that control CLOCKBMAL1 activity. In this context, we note that our model is compatible with studies showing that CRY1 may also interact with additional epigenetic regulators to help achieve complete repression in vivo[41]. The CRY1 mechanism we propose here occurs independently of the direct involvement of PER proteins (). Recent studies show that PER2 titrates CRY1 away from direct interactions with CLOCKBMAL1 in vitro and in cells[6,42,43]. Two recent CRY structures provide evidence for a possible CLOCKBMAL1 binding site in the antenna chromophore-binding pocket, distinct from the PER2 binding site centered on the CRY1 CC α-helix[23,44]. Because both PER2 and BMAL1 interact with the CRY1 CC α-helix[23,24,33,44], our data suggest that a timely handoff between early repressive PER2CRY1 complexes[3-5,45] to the late repressive CLOCKBMAL1CRY1 complexes[7,8] may represent a critical control mechanism for the molecular circadian clock. We do not discount the importance of PER2 in regulating the stability and timing of nuclear entry of the PER2CRY1 complexes and resultant temporal progression of circadian transcriptional repression[46,47], or roles that CRY1 may play in the PER2CRY1 complexes[10]. Precedence for regulation of protein function based on competition for mutually exclusive binding sites exists throughout biology[38,48]. Competitive mechanisms can make the conversion between inactive and active states more switch-like instead of graded[49], and switch-like responses that exhibit a high degree of cooperativity amplify rhythms in the molecular circadian clock, preventing them from reaching an equilibrium that terminates oscillation[50]. Furthermore, computational models suggest that tight binding of repressors and activators along with control over protein stoichiometry is key for generation of a robust circadian clock[51]. The remarkable decrease in CRY1 repression we observed upon disruption of the stable CLOCKBMAL1CRY1 complex () illustrates how important ternary complex formation is for repression when CRY is expressed to near stoichiometric levels with the CLOCK–BMAL1 complex in vivo[52]. It is well recognized that changes in clock protein abundance, posttranslational modifications and subcellular localization play critical roles in circadian timekeeping[36]. Our data suggest that conformational dynamics also play a critical role in period determination, as disordered regions can easily coordinate protein interactions with diverse coregulators by coupling folding to binding[34,53]. Modest changes in the intrinsic secondary structure of other TADs affect the thermodynamics of binding to CBP(p300) to influence the temporal basis (i.e., transient or constitutive) of coactivation[54,55]. Therefore, the structural dynamics we observe within the BMAL1 TAD could play an interesting role in setting the timescale of activation and repression to ultimately contribute to circadian timing.

ONLINE METHODS

Lentiviral DNA constructs, preparation and transduction

Bmal1 and UBC promoters were cloned into the pENTR-5’-TOPO vector (Life Technologies) as before[17]. Mouse Bmal1, Bmal2 and various chimeras or mutants were first subcloned to p3xFlag-CMV-10 or -14 vectors to obtain 3xFlag tags at the N- or C-terminus, respectively, and then cloned to the pENTR/D-TOPO vector (Life Technologies). The promoter and cDNA pENTR vectors were recombined with pLV7 destination vector[56] using Clonase (Life Technologies) to generate the lentiviral expression constructs. All constructs were verified by sequencing of the entire open reading frame. Recombinant lentiviral particles were produced by transient transfection in human embryonic kidney HEK293T cells (ATCC) using the calcium-phosphate method as previously described[56,57]. Bmal1–/– Per2 mouse fibroblast cell line was generated in our previous studies[17]. Cells were cultured in DMEM supplemented with 10% FBS and 1x penicillin-streptomycin-glutamine mixture. All cell culture reagents were from HyClone. For infection of Bmal1–/– Per2 fibroblasts, culture medium containing viral particles (~106 viral particles/ml) were harvested at 48 hr post-transfection and used for subsequent infection of cells. Transduced cells were selected with 10 μg/ml blasticidin (InvivoGen) as previously done[17].

Luminescence recording and data analysis

We used a LumiCycle luminometer (Actimetrics) for luminescence recording as previously described[56]. Cells were grown to confluence in 35 mm dishes prior to recording. The recording medium contained 1x DMEM, 25 mM HEPES (pH 7.4), 1% FBS, 1x B-27 and 1 mM luciferin as previously[17]. Three independent clonal lines and 2-3 dishes for each clone were tested to validate phenotypes. Raw luminescence data (counts/sec) as a function of time (days) in culture were analyzed using the LumiCycle Analysis program (version 2.53, Actimetrics) to determine circadian parameters. Due to high transient luminescence upon medium change, the first cycle was excluded from analysis. Briefly, raw data were fitted to a linear baseline, and the baseline-subtracted data were fitted to a damped sine wave, from which period length, goodness of fit, and damping constants were determined. A goodness-of-fit of >80% was usually achieved from samples that showed persistent rhythms. Damping rate is described by the value of 1/damping constant. For amplitude analysis, raw data from days 3-5 were fitted to a linear baseline (polynomial number = 1), and the baseline-subtracted data were fitted to a sine wave, from which amplitude was determined.

Transient transfection and reporter assays

Reporter assays investigating steady-state differences between Bmal1 and Bmal2 function were performed using HEK293T cells in triplicate on 384-well plates. For mammalian two-hybrid assays, 12.5 ng of pGL4P-4xUAS::Luc, 2.5 ng Renilla luciferase (RLuc), 25 ng pACT and 25 ng pBIND plasmids were used in each well as previously described[25]. The Per1-Luc reporter assay was performed as reported elsewhere with minor modifications[25]. For each well, 12.5 ng Per1-Luc reporter, 25 ng pLV7-P(UBC)-mouse Bmal, 25 ng pLV7-P(CAG)-mouse Clock, 25 ng pcDNA-CMV-mouse p300 or Cbp, 25 ng pLV156-P(CMV)-mouse Cry1, and 2.5 ng RLuc were used. When needed, empty vectors were included to make up to 115 ng of total plasmid amount. RLuc was used for reporter normalization. In assays with Cry1, indicated amounts of pLV156-P(CMV)-Cry1 were compensated with empty pLV7 destination vector to a total of 50 ng. Lipofectamine 2000 (Life Technologies) were used with a reverse transfection protocol. Reporter assay was performed 24 hr post transfection using DualGlo luciferin reagent (Promega) and luciferase reporter activity was normalized with Renilla luciferase. To compare expression of Flag-tagged Bmal1 genes, cells were lysed in RIPA buffer containing complete protease and phosphatase inhibitors (Sigma). Immunoblotting was done using the following primary antibodies: mouse anti-Flag antibody (M2) (Sigma cat. # F3165) and goat anti-β actin (C-11) (Santa Cruz Biotechnology cat. # sc-1615), and the following secondary antibodies: anti-mouse IgG-HRP (Santa Cruz Biotechnology cat. # sc-2005) and anti-goat IgG-HRP (Santa Cruz Biotechnology cat. # sc-2020). SuperSignal West Pico substrate (Pierce) was used for chemiluminescent detection on autoradiograph film. For coimmunoprecipitation assays, plasmids were transfected into HEK293T cells in a 35 mm dish using LT-1 transfection reagent (Mirus) with the indicated plasmid ratios: 1.5 μg each pSG5 mouse Flag-Bmal1 and pSG5 mouse His6Flag-Clock, plus 50 ng pcDNA3 mouse Cry1 (no tag; used for anti-Flag IP) or 250 ng pcDNA4 Cry1 (C-terminal Flag, myc, His6-tagged; used for anti-myc IP). Cells were harvested 48 hours later for coimmunoprecipitation with anti-myc (9E10) (distributed by the Developmental Studies Hybridoma Bank at the University of Iowa, IA, cat. # 9E 10-a) or anti-Flag antibody (Sigma). Briefly, cells were lysed on ice for 15 min in 250 μl 50 mM HEPES pH 7.5, 150 mM NaCl, 5% (v/v) glycerol, 0.5% (v/v) NP-40 and EDTA-free protease inhibitors (RPI Biochemicals). Clarified extracts were added to 300 μl lysis buffer containing 1 μg of anti-myc monoclonal antibody plus 15 μl Protein A/G resin (Santa Cruz biotechnology) or 15 μl anti-Flag M2 affinity resin (Sigma cat. #A2220) after retaining 25 μl as the input sample. Tubes were rotated end over end for 4 hours, and resin was washed three times with 400 μl lysis buffer. Proteins were eluted from resin by addition of 30 μl 2X SDS Laemmli buffer and boiled for 3 minutes. Complexes were resolved by 7.5% SDS-PAGE after transfer to nitrocellulose. Proteins were detected by immunoblotting using the following primary antibodies: mouse anti-myc, mouse anti-Flag, rat anti-CRY1 (a gift from A. Sancar)[58], mouse anti-BMAL1 (B-1) (Santa Cruz Biotechnology cat. # sc-365645), or rabbit anti-CLOCK (H-276) (Santa Cruz Biotechnology cat. # sc-25361), and secondary antibodies: anti-mouse IgG-HRP (Sigma cat. # A9917), anti-rabbit IgG-HRP (Sigma cat. # A0545), and anti-rat IgM-HRP (Thermo Fisher cat. # 31476). Clarity reagent (Bio-Rad) was used for chemiluminescent detection on a ChemiDoc XRS+ imager (Bio-Rad). All data shown are representative from three independent experiments. For Per1-Luc reporter gene assays investigating CRY1 repression, plasmids were transfected in duplicate into HEK293T cells in a 48-well plate using LT-1 transfection reagent (Mirus) with the indicated plasmids: 5 ng pGL3 Per1-Luc reporter[59], 100 ng each pSG5 Flag-Bmal1 and pSG5 His6Flag-Clock, and pcDNA3 Cry1 (untagged) in increasing amounts as indicated; empty pcDNA4 vector was used to normalize total plasmid to 800 ng/well. Cells were harvested 30 hours after transfection using Passive Lysis Buffer (NEB) and luciferase activity assayed with Bright-Glo luciferin reagent (Promega). Each reporter assay was repeated at least three independent times. To compare relative expression of CLOCK, BMAL1, and CRY1 proteins, a 12-well plate of HEK293T cells was transfected with 400 ng each pSG5 His6Flag-Clock and Flag-Bmal1 with pcDNA4B Cry1 (C-terminal Flag, myc, His6 epitope tags)[60] as indicated, using empty pcDNA4 vector to normalize plasmid concentration to 1 μg total DNA. Cells were harvested 48 hours later for immunoblotting with anti-Flag antibody, anti-BMAL1 (B-1), and anti-CLOCK (H-276) antibodies. Immunoblot of relative expression in Supplementary Figure 8 shown is representative of two independent experiments. All cell lines used in the study were routinely checked for mycoplasma contamination. Original images of autoradiographs and blots used in this study can be found in Supplementary Data Set 1.

qPCR analysis

Cells were synchronized with 200 nM dexamethasone and the first time point was collected 24 hours later as previously described[17]. Total RNAs were prepared using the RNeasy 96 kit (Qiagen). High-capacity RNA to cDNA kit (Applied Biosystems) was used for reverse transcription, and qPCR was performed using SYBR Green PCR master mix (Thermo Scientific) on an iCycler thermal cycler (BioRad). Transcript levels for each gene were normalized to Gapdh and values were expressed as percentage of expression as indicated.

Expression and purification of recombinant proteins

Proteins were expressed in E. coli Rosetta2 (DE3) cells from a pET22b vector backbone (EMD Millipore). Mouse BMAL1 TAD (residues 579-626), BMAL2 TAD (residues 540-579), and p300 KIX (residues 565-653) domains all possessed an N-terminal TEV-cleavable His6-GST or His6-SUMO tag. Mutations were introduced by site-directed mutagenesis and confirmed by sequencing. The plasmid encoding untagged mouse CBP KIX was a gift from Peter Wright. CBP KIX protein was expressed in Rosetta (DE3) cells overnight at 18°C after IPTG induction and the soluble fraction was purified on Ni-NTA resin as described above using native His residues on CBP KIX. Cells were either grown in LB medium or M9 minimal medium containing 1 g/L 15NH4Cl for uniform 15N labeling as described before[40]; for triple resonance experiments, uniformly 13C, 15N-labeled samples were made using 1 g/L 15NH4Cl and 3g/L 13C-glucose as the sole nitrogen and carbon sources in M9 medium. Protein expression was induced at OD600 ~0.8-1.0 with 0.5 mM IPTG for ~16 h at 18°C. Cells were lysed in buffer containing 50 mM Tris (pH 7.5), 300 mM NaCl and 20 mM imidazole. Affinity purification was carried out with Ni-NTA resin (Qiagen), and eluted protein was buffer exchanged to a low imidazole buffer by desalting column or by diafiltration with an Amicon stirred cell concentrator under nitrogen pressure, followed by proteolysis with TEV protease overnight at 4°C. Cleaved protein was retained from flow-through from an Ni-NTA column and further purified by size exclusion chromatography on Superdex 75 16/600 (GE Life Sciences) in NMR buffer (10 mM MES pH 6.5, 50 mM NaCl). Site-specific labeling of the BMAL1 TAD with the added C-terminal cysteine was performed with S-methanethiosulfonylcysteaminyl-EDTA (MTS-EDTA; Toronto Research Chemicals) as previously indicated[40]. Protein identities and/or covalent labeling were confirmed by ESI-MS on a Micromass ZMD mass spectrometer (Wythenshawe, UK).

Peptide synthesis and purification

The mouse CRY1 CC peptide (residues 470-503, sequence MVNHAEASRLNIERMKQIYQQL SRYRGLGLLASV) or a CC peptide containing an N-terminal cysteine (N-Cys CRY1 CC; residues 471-505, sequence CNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPS) were synthesized on a CEM Liberty1 microwave peptide synthesizer using standard Fmoc chemistry. Amino acids were purchased from NovaBiochem and assembled on Rink-amide-MBHA resin; all other reagents were purchased from Sigma-Aldrich. Fmoc deprotection was achieved using 20% piperidine with 0.1 M hydroxybenzotriazole (HOBt) in dimethylformamide (DMF). Couplings used 5 molar equivalents of Fmoc-amino acid, 5 molar equivalents of Diisopropylcarbodiimide and 10 molar equivalents of HOBt in DMF. Fully synthesized peptide resins were washed with dichloromethane and dried. Cleavage of the peptide from the resin was performed in a trifluoroacetic acid/thioanisole/ethanedithiol/phenol (90:4:4:2) solution for 90 minutes. Peptides were purified by RP-HPLC (Vydac) on preparative C18 columns. Fractions were collected and analyzed by ESI-MS on a Micromass ZMD mass spectrometer to confirm the correct molecular weight. In each case the major peak was found to be the peptide, and fractions that contained the peptide as a major constituent (≥95% purity) were combined and lyophilized.

NMR spectroscopy

NMR experiments were conducted at 25°C on a Varian INOVA 600-MHz spectrometer equipped with 1H, 13C, 15N triple resonance, Z-axis pulsed field gradient probes. All NMR data were processed using NMRPipe and NMRDraw[61]. Chemical shift assignments were made with SPARKY[62] using NMR data obtained from standard 3D triple resonance experiments acquired on 300 μM uniformly 13C,15N labeled TAD protein, including: HNCO, HNCACB, CBCA(CO)NH, H(CCO)NH-TOCSY, (H)C(CO)NH-TOCSY and HCCH-TOCSY spectra. Chemical shifts of mutant TADs were re-assigned by using triple resonance data in NMRViewJ RunAbout or, when warranted from minor chemical shift perturbations, by minimal chemical shift analysis in NMRViewJ[63]. Secondary structure predictions were validated by TALOS+[64] and by comparison to the Chemical Shift Index[31,32]. 15N HSQC titration of 100 μM 15N TAD proteins was done by stepwise addition of CRY1 CC peptide, CBP or p300 KIX domain in 10 mM MES pH 6.5, 50 mM NaCl. Samples were concentrated to 300 μl final volume and adjusted to a final concentration of 10% (v/v) D2O. 15N HSQC titration data were analyzed with NMRViewJ[63] using chemical shift perturbations defined by the equation: ΔδTOT [(Δδ1H)2 = + (χ(Δδ15N)2]½ and normalized with the scaling factor χ = 0.17, established from estimates of atom-specific chemical shift ranges in a protein environment[65]. For PRE NMR experiments, peak intensities from 15N HSQC spectra were determined using the Rate Analysis tool in NMRViewJ to extract normalized peak intensities. Minor broadening at negatively charged residues throughout the TAD is likely due to interaction with trace amounts of unchelated Mn2+, as acquisition of NMR data under moderately higher salt conditions (100 mM vs. 50 mM NaCl) alleviated this non-specific broadening (data not shown).

Isothermal titration calorimetry (ITC)

Proteins were extensively dialyzed at 4°C in 10 mM MES pH 6.5, 50 mM NaCl using 2 kDa molecular weight cutoff filter dialysis tubing (Spectrum Labs) prior to collecting ITC data. CBP KIX was used for analysis of TAD binding by ITC due to increased stability over p300 KIX, which was slightly more prone to precipitation under our ITC experimental conditions. ITC was performed on a MicroCal VP-ITC calorimeter at 25°C with a stir speed of 177 rpm, reference power of 10 μCal/sec and 10 μL injection sizes. Protein ratios for the cell and syringe for the ITC assays (2 or 3 independent ITC experiments were performed for each complex) are as follows: 223 μM CBP KIX titrated into 23 μM BMAL1 TAD (Stoichiometry, N = 0.74), 225 μM CBP KIX titrated into 18 μM BMAL2 TAD (N = 0.70), 223 μM CBP KIX titrated into 18 μM BMAL1 SL/NY (N = 1.06), 223 μM CBP KIX titrated into 22 μM BMAL1 VI/AF (N = 0.82), 252 μM CBP KIX titrated into 29 μM LL/AA TAD (N = not determined), 221 μM CBP KIX titrated into 25 μM 619X TAD (N = 0.78), or 225 μM CRY1 CC titrated into 22 μM BMAL1 TAD (N = 0.68), 220 μM CRY1 CC titrated into 25 μM BMAL2 TAD (N = 0.7), 225 μM CRY1 CC titrated into 18 μM BMAL1 SL/NY (N = 0.90), 225 μM CRY1 CC titrated into 20 μM BMAL1 VI/AF (N = not determined), 230 μM CRY1 CC titrated into 22 μM LL/AA TAD (N = not determined), and 221 μM CBP KIX titrated into 25 μM 619X TAD (N = 0.78). All data were best fit by a one-site binding model using Origin software.

Fluorescence polarization (FP)

The tetramethylrhodamine 5-maleimide fluorophore (Molecular Probes) was reacted with N-Cys CRY1 CC peptide at a 2-5 fold molar excess for 1.5 – 4 hours at 4°C in 25 mM MES, pH 5.0 with 25 mM NaCl and 10 % DMSO. The low pH of the labeling reaction was essential to avoid non-specific attachment of the TMR group to the lysine amide in the CRY CC peptide as determined by mass spectrometry. Fluorescently labeled TMR-CRY1 CC was purified by reverse phase HPLC and electrospray ionization mass spectrometry was used to verify the labeling and assess purity. Samples with greater than 95% purity were lyophilized and reconstituted in 10 mM MES pH 6.5, 50 mM NaCl and stored at −80 °C until needed. Equilibrium binding assays between TMR-CRY1 CC and BMAL TADs were performed in 40 mM Tris, pH 8.0, 150 mM NaCl, 0.05% (v/v) Tween-20, 1 mM DTT at 25°C. Binding was monitored by changes in fluorescence polarization using an Perkin Elmer EnVision 2103 Multilabel plate reader with excitation at 531 nm and emission at 595 nm. 10 nM TMR-CRY1 CC peptide was preincubated with buffer alone or increasing concentrations of BMAL TAD constructs (27 nM-300 μM) for 150 minutes at room temperature in the dark prior to FP analysis. The equilibrium dissociation constant (KD) was calculated by fitting the dose-dependent change in milli-polarization level (Δmp) to a one-site specific binding model in the GraphPad Prism software package, using averaged Δmp values from quadruplicate assays. Data shown are from one representative experiment of three independent assays.
TABLE 1

Dissociation constants for the interaction of BMAL transactivation domains with transcriptional coregulators

CBP KIXCRY1 CC
ITC[*]ITC[*]FP[**]
BMAL12.05 ± 0.116.13 ± 0.826.80 ± 1.00
BMAL1 V603A I604F1.17 ± 0.09nd17.3 ± 0.30
BMAL1 S605N L606Y0.98 ± 1.182.16 ± 0.282.9 ± 1.50
BMAL1 619X4.44 ± 0.2319.67 ± 2.57nd
BMAL1 L606A L607Andndnd
BMAL25.59 ± 0.816.10 ± 1.506.00 ± 0.80

KD from a representative ITC experiment with standard error for fit to one-site binding model (n = 2 or 3)

Mean KD with s.d. (calculated from n = 4 replicates) from a representative FP experiment (n = 3)

nd, no detectable binding under experimental conditions

  65 in total

1.  Mechanism of coupled folding and binding of an intrinsically disordered protein.

Authors:  Kenji Sugase; H Jane Dyson; Peter E Wright
Journal:  Nature       Date:  2007-05-23       Impact factor: 49.962

2.  Modeling transient collapsed states of an unfolded protein to provide insights into early folding events.

Authors:  Daniel J Felitsky; Michael A Lietzow; H Jane Dyson; Peter E Wright
Journal:  Proc Natl Acad Sci U S A       Date:  2008-04-23       Impact factor: 11.205

3.  Structure of tumor suppressor p53 and its intrinsically disordered N-terminal transactivation domain.

Authors:  Mark Wells; Henning Tidow; Trevor J Rutherford; Phineus Markwick; Malene Ringkjobing Jensen; Efstratios Mylonas; Dmitri I Svergun; Martin Blackledge; Alan R Fersht
Journal:  Proc Natl Acad Sci U S A       Date:  2008-04-07       Impact factor: 11.205

4.  Insect cryptochromes: gene duplication and loss define diverse ways to construct insect circadian clocks.

Authors:  Quan Yuan; Danielle Metterville; Adriana D Briscoe; Steven M Reppert
Journal:  Mol Biol Evol       Date:  2007-01-22       Impact factor: 16.240

5.  PERIOD1-associated proteins modulate the negative limb of the mammalian circadian oscillator.

Authors:  Steven A Brown; Juergen Ripperger; Sebastian Kadener; Fabienne Fleury-Olela; Francis Vilbois; Michael Rosbash; Ueli Schibler
Journal:  Science       Date:  2005-04-29       Impact factor: 47.728

6.  Circadian function in patients with advanced non-small-cell lung cancer.

Authors:  R D Levin; M A Daehler; J F Grutsch; J Quiton; C G Lis; C Peterson; D Gupta; K Watson; D Layer; S Huff-Adams; B Desai; P Sharma; M Wallam; M Delioukina; P Ball; M Bryant; M Ashford; D Copeland; M Ohmori; P A Wood; W J M Hrushesky
Journal:  Br J Cancer       Date:  2005-11-28       Impact factor: 7.640

Review 7.  Emerging models for the molecular basis of mammalian circadian timing.

Authors:  Chelsea L Gustafson; Carrie L Partch
Journal:  Biochemistry       Date:  2014-12-30       Impact factor: 3.162

8.  Intercellular coupling confers robustness against mutations in the SCN circadian clock network.

Authors:  Andrew C Liu; David K Welsh; Caroline H Ko; Hien G Tran; Eric E Zhang; Aaron A Priest; Ethan D Buhr; Oded Singer; Kirsten Meeker; Inder M Verma; Francis J Doyle; Joseph S Takahashi; Steve A Kay
Journal:  Cell       Date:  2007-05-04       Impact factor: 41.582

9.  Redundant function of REV-ERBalpha and beta and non-essential role for Bmal1 cycling in transcriptional regulation of intracellular circadian rhythms.

Authors:  Andrew C Liu; Hien G Tran; Eric E Zhang; Aaron A Priest; David K Welsh; Steve A Kay
Journal:  PLoS Genet       Date:  2008-02-29       Impact factor: 5.917

10.  Dual modes of CLOCK:BMAL1 inhibition mediated by Cryptochrome and Period proteins in the mammalian circadian clock.

Authors:  Rui Ye; Cristopher P Selby; Yi-Ying Chiou; Irem Ozkan-Dagliyan; Shobhan Gaddameedhi; Aziz Sancar
Journal:  Genes Dev       Date:  2014-09-15       Impact factor: 11.361

View more
  68 in total

1.  Formation of a repressive complex in the mammalian circadian clock is mediated by the secondary pocket of CRY1.

Authors:  Alicia K Michael; Jennifer L Fribourgh; Yogarany Chelliah; Colby R Sandate; Greg L Hura; Dina Schneidman-Duhovny; Sarvind M Tripathi; Joseph S Takahashi; Carrie L Partch
Journal:  Proc Natl Acad Sci U S A       Date:  2017-01-31       Impact factor: 11.205

Review 2.  Periodicity, repression, and the molecular architecture of the mammalian circadian clock.

Authors:  Clark Rosensweig; Carla B Green
Journal:  Eur J Neurosci       Date:  2018-12-08       Impact factor: 3.386

3.  Grab the wiggly tail: new insights into the dynamics of circadian clocks.

Authors:  Ka Yi Hui; Jürgen A Ripperger
Journal:  Nat Struct Mol Biol       Date:  2015-06       Impact factor: 15.369

4.  Regulating behavior with the flip of a translational switch.

Authors:  Efraín Ceh-Pavia; Carrie L Partch
Journal:  Proc Natl Acad Sci U S A       Date:  2018-12-13       Impact factor: 11.205

5.  A Slow Conformational Switch in the BMAL1 Transactivation Domain Modulates Circadian Rhythms.

Authors:  Chelsea L Gustafson; Nicole C Parsley; Hande Asimgil; Hsiau-Wei Lee; Christopher Ahlbach; Alicia K Michael; Haiyan Xu; Owen L Williams; Tara L Davis; Andrew C Liu; Carrie L Partch
Journal:  Mol Cell       Date:  2017-05-11       Impact factor: 17.970

6.  Circadian repressors CRY1 and CRY2 broadly interact with nuclear receptors and modulate transcriptional activity.

Authors:  Anna Kriebs; Sabine D Jordan; Erin Soto; Emma Henriksson; Colby R Sandate; Megan E Vaughan; Alanna B Chan; Drew Duglan; Stephanie J Papp; Anne-Laure Huber; Megan E Afetian; Ruth T Yu; Xuan Zhao; Michael Downes; Ronald M Evans; Katja A Lamia
Journal:  Proc Natl Acad Sci U S A       Date:  2017-07-27       Impact factor: 11.205

Review 7.  Animal Cryptochromes: Divergent Roles in Light Perception, Circadian Timekeeping and Beyond.

Authors:  Alicia K Michael; Jennifer L Fribourgh; Russell N Van Gelder; Carrie L Partch
Journal:  Photochem Photobiol       Date:  2017-01-18       Impact factor: 3.421

8.  Vertebrate-like CRYPTOCHROME 2 from monarch regulates circadian transcription via independent repression of CLOCK and BMAL1 activity.

Authors:  Ying Zhang; Matthew J Markert; Shayna C Groves; Paul E Hardin; Christine Merlin
Journal:  Proc Natl Acad Sci U S A       Date:  2017-08-22       Impact factor: 11.205

9.  Molecular mechanism of the repressive phase of the mammalian circadian clock.

Authors:  Xuemei Cao; Yanyan Yang; Christopher P Selby; Zhenxing Liu; Aziz Sancar
Journal:  Proc Natl Acad Sci U S A       Date:  2020-12-21       Impact factor: 11.205

10.  The circadian gene Arntl2 on distal mouse chromosome 6 controls thymocyte apoptosis.

Authors:  Basile Lebailly; Francina Langa; Christian Boitard; Philip Avner; Ute Christine Rogner
Journal:  Mamm Genome       Date:  2016-09-26       Impact factor: 2.957

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.