Sepsis is characterized by a dysregulated host-pathogen response, leading to high cytokine levels, excessive coagulation and failure to eradicate invasive bacteria. Novel therapeutic strategies that address crucial pathogenetic steps during infection are urgently needed. Here, we describe novel bioactive roles and therapeutic anti-infective potential of the peptide EDC34, derived from the C-terminus of tissue factor pathway inhibitor-2 (TFPI-2). This peptide exerted direct bactericidal effects and boosted activation of the classical complement pathway including formation of antimicrobial C3a, but inhibited bacteria-induced activation of the contact system. Correspondingly, in mouse models of severe Escherichia coli and Pseudomonas aeruginosa infection, treatment with EDC34 reduced bacterial levels and lung damage. In combination with the antibiotic ceftazidime, the peptide significantly prolonged survival and reduced mortality in mice. The peptide's boosting effect on bacterial clearance paired with its inhibiting effect on excessive coagulation makes it a promising therapeutic candidate for invasive Gram-negative infections.
Sepsis is characterized by a dysregulated host-pathogen response, leading to high cytokine levels, excessive coagulation and failure to eradicate invasive bacteria. Novel therapeutic strategies that address crucial pathogenetic steps during infection are urgently needed. Here, we describe novel bioactive roles and therapeutic anti-infective potential of the peptide EDC34, derived from the C-terminus of tissue factor pathway inhibitor-2 (TFPI-2). This peptide exerted direct bactericidal effects and boosted activation of the classical complement pathway including formation of antimicrobial C3a, but inhibited bacteria-induced activation of the contact system. Correspondingly, in mouse models of severe Escherichia coli and Pseudomonasaeruginosa infection, treatment with EDC34 reduced bacterial levels and lung damage. In combination with the antibiotic ceftazidime, the peptide significantly prolonged survival and reduced mortality in mice. The peptide's boosting effect on bacterial clearance paired with its inhibiting effect on excessive coagulation makes it a promising therapeutic candidate for invasive Gram-negative infections.
Sepsis is a major cause of death in the western world, with mortality ranging between 30 and 70% [1]. The disease is characterized by an excessive and dysregulated immune and coagulation response to microbial infections, leading to capillary leakage, lung damage, and finally multiple organ failure [2], [3], [4]. Several clinical trials targeting coagulation as well as pro-inflammatory responses have been conducted, including administration of activated protein C [5], [6], antibodies against TNF-α [7], [8], [9], interleukin-1 receptor antagonists [10], [11], interleukin-6 antagonists [12], anti-endotoxin antibodies [12], PAF receptor antagonists [13], antithrombin III [14], [15], [16] and other agents [17], [18], [19], [20]. Even though animal experiments showed promising results, all drug candidates tested so far have failed to show clinical efficiency. Consequently, today's treatment for sepsis is largely based on antibiotics in combination with supportive measures, illustrating the need for new therapeutic approaches.Antimicrobial peptides constitute one group of compounds, which have recently attracted attention as new anti-infectives. Due to their preferential interactions with prokaryotic and fungal membranes, these peptides provide a rapid and broad-spectrum response towards both Gram-negative and Gram-positive bacteria, as well as fungi [21], [22], [23], [24]. Antimicrobial peptides also mediate diverse immunomodulatory roles, including anti-inflammatory effects as well as stimulation of chemotaxis, chemokine production, wound healing and angiogenesis [25], [26], [27], motivating the term host defense peptides (HDP). The molecular diversity of HDPs has provided a wide range of structures of potential interest for the anti-infective field. For example, immunomodulatory peptides such as IDRs (Innate Defense Regulator) selectively protect against bacterial infection by chemokine induction and neutrophil recruitment, while reducing pro-inflammatory cytokine responses [26], [27]. Further, the lactoferrin-derived peptide hLF1-11 differentiates monocytes, which enhances clearance of pathogens, a feature currently utilized in the development of therapies for infections in immunosuppressed patients [28]. Additionally, C-terminal peptides of humanthrombin, exerting anti-inflammatory, anti-coagulative and antimicrobial effects, are effective in ameliorating LPS-induced shock and Pseudomonassepsis in experimental settings in animals [29], [30], [31], further exemplifying that endogenous HDPs may have therapeutic potential.The present work is based on the finding that the highly positively charged C-terminus of tissue factor pathway inhibitor-2 (TFPI-2) encodes for antimicrobial activity [32]. Previous data demonstrated that C-terminal TFPI-2 fragments are released in human wounds, and can be generated by neutrophil elastase in vitro. A direct antimicrobial effect of a prototypic 34 amino acids long C-terminal TFPI-2 peptide, EDC34 was furthermore demonstrated in vitro
[32]. In this work, utilizing various in vitro and in vivo models aimed at characterizing effects on complement, coagulation, and bacterial clearance, we demonstrate a therapeutic potential of the peptide for the treatment of Gram-negative infections.
Results
The C-terminal TFPI-2 peptide EDC34 is antimicrobial and its effect enhanced in plasma and blood
Initial experiments utilizing E. coli and P. aeruginosa isolates demonstrated that EDC34 displayed significant antibacterial activity in physiological buffer, and enhanced activity in the presence of human plasma (
and ). Heat inactivation of human plasma abolished this potentiating effect. A control peptide (DAA14) derived from the N-terminal part of TFPI-2 did not show any antimicrobial effects in buffer or plasma (data not shown). In contrast, the cathelicidin LL-37 was partially inhibited by the addition of native as well as heat-inactivated plasma (), which was compatible with previous observations showing that the peptide's activity is compromised in presence of plasma due to protein binding [33]. Thus, these data suggested that the antibacterial effect of EDC34 is dependent on additional bactericidal systems in normal plasma, such as complement. As described for LL-37, it was observed that EDC34 showed reduced antibacterial activity in heat-inactivated plasma, particularly against the E. coli strains 25922, 49.1 and 47.1 when compared to buffer (
and ), possibly related to scavenging effects of plasma proteins. In human whole blood, EDC34 demonstrated potent antimicrobial effects against various E. coli and P. aeruginosa isolates at doses as low as 0.3 µM, except for P. aeruginosa PA01, which was killed at 3 µM (). Notably, 10–100 times higher doses were required for LL-37 mediated killing (). Kinetic studies in the presence of plasma demonstrated that the bacterial killing mediated via EDC34 (3 µM) occurred within 10–20 min for E. coli, and 40–60 min for P. aeruginosa (). Contrary to results for a complement-susceptible E. coli strain (
, left panel), no EDC34-mediated enhancement of bacterial killing was observed for the E. coli O18:K1 strain, previously shown to be resistant to complement-mediated lysis [34] (
, right panel). Next, antibacterial and hemolytic effects of EDC34 were simultaneously analyzed in human blood. Consistent with the complement-dependent action of EDC34, this peptide was active against Gram-negative E. coli and P. aeruginosa in whole blood, while exhibiting little or no effects against Gram-positive S. aureus and S. pyogenes AP1 (
, left panel). No significant increase in hemolysis was observed at peptide doses up to 120 µM (
, right panel). Next, the fact that the humanEDC34 sequence differs from the related murine sequence prompted us to compare the effects of humanEDC34 with those of the related peptide of murine origin (DAC31), derived from a corresponding C-terminal region of murineTFPI-2 (). Both peptides exerted similar antimicrobial effects in buffer as well as in human and mouse plasma (
). Taken together, the data imply that bacterial killing by EDC34 in plasma and blood is enhanced by the presence of an intact complement system.
Figure 1
Antimicrobial activities of EDC34.
(A) Antibacterial effects of EDC34 at the indicated concentrations were studied in viable count assays, using the bacteria E. coli ATCC 25922 (complement sensitive) and E. coli O18:K1 (complement-resistant). Analyses were performed in 10 mM Tris, 0.15 M NaCl, pH 7.4 (Buffer) or buffer containing 20% citrate plasma (CP) or heat-inactivated citrate plasma (HCP). Mean with SD is shown (n = 3). (B) Antimicrobial and hemolytic effects of EDC34 against the indicated bacteria in whole blood (n = 3, mean±SEM is presented). (C) Antimicrobial effects of EDC34 and DAC31, a mouse derived TFPI-2 C-terminal peptide against E. coli in human or mouse citrate plasma (n = 3, mean±SEM is presented).
Antimicrobial activities of EDC34.
(A) Antibacterial effects of EDC34 at the indicated concentrations were studied in viable count assays, using the bacteria E. coli ATCC 25922 (complement sensitive) and E. coli O18:K1 (complement-resistant). Analyses were performed in 10 mM Tris, 0.15 M NaCl, pH 7.4 (Buffer) or buffer containing 20% citrate plasma (CP) or heat-inactivated citrate plasma (HCP). Mean with SD is shown (n = 3). (B) Antimicrobial and hemolytic effects of EDC34 against the indicated bacteria in whole blood (n = 3, mean±SEM is presented). (C) Antimicrobial effects of EDC34 and DAC31, a mouse derived TFPI-2 C-terminal peptide against E. coli in human or mousecitrate plasma (n = 3, mean±SEM is presented).
EDC34 induces complement activation at bacterial surfaces
In order to study the complement boosting effect of EDC34 further, western blot and FACS analyses were used. EDC34 enhanced binding of C1q to E. coli (
), and increased the formation of the membrane attack complex (MAC), as evidenced by increased binding of C9 and related high molecular weight compounds (
). A significant generation of C3a was also observed after addition of EDC34 (
and ). After subjecting P. aeruginosa to plasma, in contrast to the results with E. coli above, an activation of complement by the bacteria per se was observed (
and ). Nevertheless, quantification of C1q after addition of EDC34 detected an increase of this molecule in association with P. aeruginosa (
and ). Additionally, fragments corresponding to bacterial-bound C3a, as well as peptides of higher molecular weight containing the C-terminal epitope of C3a, were detected, particularly after addition of EDC34 (
). Electron microscopy studies on fibrin slough from a patient with a chronic wound infected by P. aeruginosa were furthermore performed to explore a possible co-localization between the C-terminal TFPI-2 region and C3a in vivo. Using immunogold-labeled antibodies against the C-terminal part of TFPI-2 and against C3a, the evaluation of 50 bacterial profiles indeed showed that ∼70% of C-terminal TFPI-2 peptide epitopes were closely associated with C3a (
). Taken together, these results indicate that EDC34 promotes complement activation in response to E. coli and P. aeruginosa.
Figure 2
EDC34 enhances the binding of complement proteins to bacteria.
(A) E. coli ATCC 25922 and P. aeruginosa PA01 bacteria were incubated 30–60 min with citrate plasma alone (Control) or supplemented with EDC34 (at 3 µM) at 37°C. The bacterial cells and supernatants were collected and proteins were detected by immunoblotting with antibodies recognizing C1q or C5b-9. CP, citrate plasma; S, supernatant or unbound bacteria; P, pellet or material bound to bacterial cells. (B), as in figure 2A, but antibodies against C3a were used. (C) Quantification of deposition of complement components on bacteria by flow cytometry, left panel, comparison of the mean proportion of bacteria positive for C1q/C3a binding in citrate plasma and in plasma supplemented with EDC34. Right panel, comparative degree of C1q and C3a binding to E. coli and P. aeruginosa strains, expressed as means of the fluorescence index (FI; proportion of bacteria positive for C1q/C3a multiplied by the mean intensity of C1q/C3a binding). (n = 4, mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test). (D) TFPI-2 and C3a binding to bacteria in fibrin slough collected from an infected chronic wound were visualized by using gold-labeled antibodies of different sizes, specific for the C-terminus of TFPI-2 (20 nm) and C3a (10 nm), respectively. Insert shows a higher magnification.
EDC34 enhances the binding of complement proteins to bacteria.
(A) E. coli ATCC 25922 and P. aeruginosa PA01 bacteria were incubated 30–60 min with citrate plasma alone (Control) or supplemented with EDC34 (at 3 µM) at 37°C. The bacterial cells and supernatants were collected and proteins were detected by immunoblotting with antibodies recognizing C1q or C5b-9. CP, citrate plasma; S, supernatant or unbound bacteria; P, pellet or material bound to bacterial cells. (B), as in figure 2A, but antibodies against C3a were used. (C) Quantification of deposition of complement components on bacteria by flow cytometry, left panel, comparison of the mean proportion of bacteria positive for C1q/C3a binding in citrate plasma and in plasma supplemented with EDC34. Right panel, comparative degree of C1q and C3a binding to E. coli and P. aeruginosa strains, expressed as means of the fluorescence index (FI; proportion of bacteria positive for C1q/C3a multiplied by the mean intensity of C1q/C3a binding). (n = 4, mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test). (D) TFPI-2 and C3a binding to bacteria in fibrin slough collected from an infected chronic wound were visualized by using gold-labeled antibodies of different sizes, specific for the C-terminus of TFPI-2 (20 nm) and C3a (10 nm), respectively. Insert shows a higher magnification.
EDC34 inhibits the intrinsic pathway of coagulation
TFPI-2 inhibits TF-VII-mediated coagulation and affects factor XIa and plasma kallikrein [35], [36], effects which are thought to be mediated by the Kunitz-type domains of TFPI-2 [37]. However, no evidence has so far been presented that the C-terminal region of TFPI-2 may influence coagulation. Clotting assays using humancitrate plasma revealed that EDC34 interfered with the intrinsic pathway of coagulation, as illustrated by a dose-dependent prolongation of the activated partial thromboplastin time (aPTT) (
). At 50 µM, the increase in aPTT was about 4-fold in human plasma (
) and 20-fold in mouse plasma (
). In contrast, the other parts of the coagulation system, such as the extrinsic pathway of coagulation, monitored by measuring the prothrombin time (PT), and thrombin-induced fibrin-network formation (thrombin clotting time; TCT), were not affected or to a lower extent at doses of 20–50 µM (
, and data not shown). The activation of the intrinsic system takes place at negatively charged surfaces, such as kaolin or bacteria, and involves activation of FXII, which then leads to the activation of plasma kallikrein (PK) and FXI [38]. Analysis of PK activity at the surface of kaolin showed that EDC34, but not the control peptide from the N-terminal region of TFPI-2 (DAA14), was able to block the PK activity (
). In order to determine whether EDC34 inhibits PK activity also on bacterial surfaces, P. aeruginosa and E. coli bacteria, sensitive to the peptide in plasma and blood, were chosen for further studies. Bacteria were pre-incubated with EDC34, followed by incubation with plasma, and the effect of EDC34 and the control peptide recorded by measuring the PK activity. The results showed that only EDC34 was able to inhibit PK activation (
). Since high molecular weight kininogen (HMWK) is a substrate for PK [38], western blots were utilized to assess possible degradation of HMWK in plasma. Compatible with the results of the PK assay, EDC34 blocked the degradation of HMWK (
). PK-cleaved HMWK releases bradykinin (BK), a potent pro-inflammatory mediator [38], and corresponding to the above, EDC34 also significantly inhibited the generation of bradykinin (
). The N-terminal TFPI-2 control peptide DAA14 neither inhibited PK activation nor bradykinin generation (
). These results show that EDC34 mainly inhibits activation of the intrinsic pathway of coagulation, leading to reduced HMWK degradation and bradykinin release.
Figure 3
EDC34 inhibits contact activation at negatively charged surfaces.
(A) Effect of EDC34 on the contact system was assessed by measuring the aPTT in human citrate plasma. The control peptide DAA14 was used at 50 µM. (B) Measurement of effects of EDC34 (50 µM) and DAA14 (50 µM) on the extrinsic (PT) and common pathway (TCT) of coagulation. (C) Measurement of aPTT, PT and TCT clotting times of mouse citrate plasma in absence (Control) or presence of 50 µM EDC34. (D) Plasma kallikrein activity induced by negatively charged kaolin in human citrate plasma in absence (Control) or presence of EDC34 (50 µM) or DAA14 (50 µM), was determined by a chromogenic substrate assay. Data are presented as mean±SEM relative to control without peptides (n = 4; One-Way ANOVA Bonferroni's Multiple Comparison Test). (E) Plasma kallikrein activity in human citrate plasma induced by the indicated bacteria in absence (Control) or presence of the peptides EDC34 (50 µM) or DAA14 (50 µM) was measured by a chromogenic substrate assay. Data are presented as mean±SEM relative to control without peptides (n = 5). (F) Western blot analysis of HK and HK degradation products: 1, No peptide; 2, EDC34; 3, DAA14. (G) Bradykinin release in human citrate plasma incubated with kaolin in absence (Control) or presence of EDC34 (50 µM) or DAA14 (50 µM) (n = 3, mean±SEM is presented; One-Way ANOVA Bonferroni's Multiple Comparison Test).
EDC34 inhibits contact activation at negatively charged surfaces.
(A) Effect of EDC34 on the contact system was assessed by measuring the aPTT in humancitrate plasma. The control peptide DAA14 was used at 50 µM. (B) Measurement of effects of EDC34 (50 µM) and DAA14 (50 µM) on the extrinsic (PT) and common pathway (TCT) of coagulation. (C) Measurement of aPTT, PT and TCT clotting times of mousecitrate plasma in absence (Control) or presence of 50 µM EDC34. (D) Plasma kallikrein activity induced by negatively charged kaolin in humancitrate plasma in absence (Control) or presence of EDC34 (50 µM) or DAA14 (50 µM), was determined by a chromogenic substrate assay. Data are presented as mean±SEM relative to control without peptides (n = 4; One-Way ANOVA Bonferroni's Multiple Comparison Test). (E) Plasma kallikrein activity in humancitrate plasma induced by the indicated bacteria in absence (Control) or presence of the peptidesEDC34 (50 µM) or DAA14 (50 µM) was measured by a chromogenic substrate assay. Data are presented as mean±SEM relative to control without peptides (n = 5). (F) Western blot analysis of HK and HK degradation products: 1, No peptide; 2, EDC34; 3, DAA14. (G) Bradykinin release in humancitrate plasma incubated with kaolin in absence (Control) or presence of EDC34 (50 µM) or DAA14 (50 µM) (n = 3, mean±SEM is presented; One-Way ANOVA Bonferroni's Multiple Comparison Test).
EDC34 modulates coagulation in vivo but does not inhibit LPS-induced cytokine responses in vitro or in vivo
To assess possible anti-coagulative effects in vivo, 12 mg/kg of LPS was injected into the mice followed by intraperitoneal administration (i. p.) of 0.5 mg of EDC34 after 30 min. Measurements of whole blood clotting, aPTT, PT, and TCT at 4 h and 8 h after LPS challenge clearly demonstrated an anti-coagulant effect of EDC34 in this model (
). This effect was confirmed by determining thrombin-antithrombin complexes (TAT) in mouse plasma 8 h after LPS injection. TAT complexes were reduced in EDC34-treated animals (
). Previous studies have demonstrated that EDC34 binds LPS similarly to LL-37, compatible with its direct antibacterial effects on bacteria [32]. To test whether LPS-binding confers any anti-inflammatory effects to EDC34, mouse macrophages were stimulated with LPS in presence or absence of EDC34. GKY25, a thrombin-derived LPS-binding and anti-inflammatory peptide, was used as positive control [29], [31]. In contrast to GKY25, which blocked the LPS response at 1–5 µM, EDC34 did not exert any endotoxin-blocking effects, even at significantly higher concentrations (). Previously published work showed that GKY25 (at 0.5 mg) significantly improved survival as well as inhibited cytokine responses in a mouse model of endotoxin shock [29], [31]. In contrast, and corresponding to the absence of anti-inflammatory effects in vitro, the same dose (0.5 mg) of EDC34, when administrated i. p. 30 minutes after endotoxin exposure, was not able to block IL-6, MCP-1, and TNF-α responses, although it affected the production of the anti-inflammatory IL-10 at an early time point (
), and reduced IFN-γ after 8 h. Thus, these results show that EDC34 largely modulates coagulation during LPS-induced shock in vivo.
Figure 4
EDC34 is anti-coagulative, but not anti-inflammatory during LPS-shock.
C57BL/6 mice were injected i. p. with 5 mg/kg E. coli LPS O111:B4 and treated after a period of 30 min with buffer (Buffer) or EDC34 (0.5 mg, i. p.). Mice were sacrificed 4 and 8 h after LPS injection and (A) clotting times of whole blood (WB) or in citrate plasma (aPTT, PT, TCT), (n = 9/group, mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test), (B) Thrombin-antithrombin complexes (TAT) (n = 8/group, mean±SEM is presented; One-Way ANOVA Bonferroni's Multiple Comparison Test) and (C) cytokines were determined (in C, * indicates below detection level) (Control; n = 8, Buffer and EDC34; n = 9/group, mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test).
EDC34 is anti-coagulative, but not anti-inflammatory during LPS-shock.
C57BL/6 mice were injected i. p. with 5 mg/kg E. coliLPSO111:B4 and treated after a period of 30 min with buffer (Buffer) or EDC34 (0.5 mg, i. p.). Mice were sacrificed 4 and 8 h after LPS injection and (A) clotting times of whole blood (WB) or in citrate plasma (aPTT, PT, TCT), (n = 9/group, mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test), (B) Thrombin-antithrombin complexes (TAT) (n = 8/group, mean±SEM is presented; One-Way ANOVA Bonferroni's Multiple Comparison Test) and (C) cytokines were determined (in C, * indicates below detection level) (Control; n = 8, Buffer and EDC34; n = 9/group, mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test).
EDC34 is antimicrobial and anti-coagulative in an Escherichia coli animal infection model
Taken together, the above data provided a rationale for using the human peptide EDC34 in murine Gram-negative infection models. Hence, mice were infected i. p. with E. coli, followed by i) immediate i. p. treatment with EDC34, ii) delayed i. p. treatment with the peptide given after 1 h, or iii) s. c. treatment after 1 h, in order to separate peptide and bacteria, and minimize direct peptide effects during i. p. administration. Notably, in these models, immediate as well as delayed EDC34 treatment administered i. p. or s. c. yielded significant improvements in survival when compared to controls (
). Although all treated mice displayed a significant weight loss, it was observed that the i. p. treated animals recovered faster (
). The i. p. model using immediate treatment was selected in order to evaluate peptide effects in greater detail. Mice were infected i. p. with E. coli, followed by treatment with EDC34. Two hours post-infection, a significant reduction of bacterial levels in the peritoneal cavity was detected only in peptide-treated animals (
). To assess the importance of complement activation for the observed antibacterial effects of EDC34 in vivo, C3a levels were measured in peritoneal fluid and plasma (). In peritoneal fluid, treatment with EDC34 indeed yielded increased C3a levels, in particular after 2 hours post-infection (). These results were compatible with the observed reduction of bacterial counts in the peritoneum of these EDC34-treated animals (
). Concomitantly, C3a levels in plasma of peptide-treated animals were reduced, reflecting the local boosting effect of EDC34 at the site of infection leading to overall reduced bacterial levels and hence, relatively less complement activation systemically (). The importance of an intact complement system was further demonstrated in experiments employing pretreatment with cobra venom factor (CVF), used in order to deplete animals of complement factors [39] before infection and peptide treatment. In this infection model, the antibacterial effect of EDC34 was significantly compromised in CVF-treated mice when compared to control mice (). Taken together, these experiments are compatible with the previous in vitro experiments presented in Figure 2, and firmly demonstrate that EDC34 mediates its antibacterial effect in vivo by boosting of complement activation. Having shown this, a second set of in vivo experiments with E. coli, aimed at studying peptide effects on bacterial dissemination, cytokines, and coagulation parameters after 2, 4, and 8 h post-infection were performed. The results showed that treatment with EDC34 yielded significantly lower bacterial levels in the spleen, kidney, liver and blood when compared to the controls (
). Notably, infected mice showed a reduced clotting capacity and exhibited prolonged aPTT and PT times, along with an increase in TAT complexes in their plasma. Treatment with EDC34 however, resulted in an improved clotting function, as evidenced by reduced coagulation times (
) and TAT complex formation (
). These data implied that the peptide, by enhancing bacterial clearance and blocking bacteria-induced coagulation, reduced the excessive consumption of coagulation factors in this animal model, thus improving hemostasis function. It is of note that time-dependent cytokine responses were detected also in EDC34 treated animals, although at lower levels when compared with non-treated infected animals. (
). However, this reduction of cytokine responses was not unexpected, since the bacterial levels were reduced 10–100 times by EDC34 (
). Hence, the lower, but retained cytokine response was compatible with the noted absence of significant anti-inflammatory effects of EDC34 in the LPS-shock model above (
).
Figure 5
EDC34 is antimicrobial and anti-coagulative in an E. coli infection model in vivo.
BALB/c mice were injected (i. p.) with E. coli DH5-α (2×108 cfu) and treated with EDC34 (0.5 mg) as indicated in A and B. (A) Survival is presented (E. coli infection; n = 13, treatment with EDC34 i.p., or sc; n = 8, Log-rank Mantel-Cox test) and (B) weight was determined daily. As only one animal survived in the untreated group (after day 2), the weight curve for untreated mice is not shown (EDC34-ip. 0 h vs. EDC34-sc. 1 h (***); EDC34-ip. 0 h vs. EDC34-ip. 1 h (*); and EDC34-sc. 1 h vs. EDC34-ip. 1 h (ns), mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test). (C–G) BALB/c mice were injected (i. p.) with E. coli DH5-α (1.5×108 cfu) and immediately treated with EDC34 (0.5 mg, i. p.). The following parameters were determined: (C) Cfu in peritoneal wash fluid (n = 15/group, mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test), (D) cfu in blood and indicated organs (n = 9/group, mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test), (E) aPTT and PT in citrate plasma (n = 9/group, mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test), (F) TAT complexes (8 h post-infection, n = 8/group, mean±SEM is presented; One-Way ANOVA Bonferroni's Multiple Comparison Test), and (G) cytokines (Control, 0 h; n = 7, E. coli and EDC34 treatment; n = 9/group, mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test).
EDC34 is antimicrobial and anti-coagulative in an E. coli infection model in vivo.
BALB/c mice were injected (i. p.) with E. coli DH5-α (2×108 cfu) and treated with EDC34 (0.5 mg) as indicated in A and B. (A) Survival is presented (E. coli infection; n = 13, treatment with EDC34 i.p., or sc; n = 8, Log-rank Mantel-Cox test) and (B) weight was determined daily. As only one animal survived in the untreated group (after day 2), the weight curve for untreated mice is not shown (EDC34-ip. 0 h vs. EDC34-sc. 1 h (***); EDC34-ip. 0 h vs. EDC34-ip. 1 h (*); and EDC34-sc. 1 h vs. EDC34-ip. 1 h (ns), mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test). (C–G) BALB/c mice were injected (i. p.) with E. coli DH5-α (1.5×108 cfu) and immediately treated with EDC34 (0.5 mg, i. p.). The following parameters were determined: (C) Cfu in peritoneal wash fluid (n = 15/group, mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test), (D) cfu in blood and indicated organs (n = 9/group, mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test), (E) aPTT and PT in citrate plasma (n = 9/group, mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test), (F) TAT complexes (8 h post-infection, n = 8/group, mean±SEM is presented; One-Way ANOVA Bonferroni's Multiple Comparison Test), and (G) cytokines (Control, 0 h; n = 7, E. coli and EDC34 treatment; n = 9/group, mean±SEM is presented; Two-Way ANOVA Bonferroni's Multiple Comparison Test).
Treatment with EDC34 improves outcome in experimental P. aeruginosa sepsis
To further investigate the functions of EDC34 in a mouse model of Pseudomonas-induced sepsis, two strains of P. aeruginosa, PA01 and 15159 (the latter a clinical isolate), were used. The bacteria were injected i. p., and the peptide was immediately administered either by i. p. injection (1×1) or s. c., either 1 h (1×1) or 1 and 7 h (1×2) after bacterial injection. EDC34 yielded significant improvements in survival after immediate treatment (
), but failed to improve survival after delayed treatment (not shown). Corresponding to the survival results, a reduced number of bacteria was observed in spleen, kidney, and liver compared to control mice, for both strains, after immediate treatment with EDC34 (
). Delayed treatment s. c. yielded no significant reduction of bacterial levels. However, and compatible with the peptide's anti-coagulative actions in vitro and in vivo, scanning electron microscopy (SEM) analyses of the lungs from mice infected with P. aeruginosa PAO1 showed that EDC34, irrespective of administration route, reduced fibrin deposition and pulmonary leakage of proteins and red blood cells (
).
Figure 6
Effects of EDC34 in a P. aeruginosa infection model.
(A) C57BL/6 mice were injected (i. p.) with P. aeruginosa PAO1 or 15159 followed by i. p. injection of EDC34 (0.5 mg) or buffer only (n = 9/group; log-rank Mantel-Cox test). (B) C57BL/6 mice were injected i. p. with P. aeruginosa PA01 or 15159 bacteria and treated immediately after inoculation with 0.5 mg of EDC34 injected i. p. or s. c. at 1 h (1×1) or 1 and 7 h (1×2) after bacterial infection. (For P. aeruginosa PA01 infection model, control; n = 18, i. p. 1×1; n = 9, s. c. 1×1; n = 13, s. c. 1×2; n = 8; One-Way ANOVA Bonferroni's Multiple Comparison Test) (For P. aeruginosa 15159 infection model n = 8/group, mean±SEM is presented). Cfu were determined 12 h post-infection. (C) Animal lungs of P. aeruginosa PA01 infected animals (see B for details) were analyzed by scanning electron microscopy 12 h post-infection (n = 3, and a representative lung section is shown). Percentage of fibrin deposition is indicated. (D) C57BL/6 mice were injected i. p. with P. aeruginosa 15159, followed by s. c. treatment after 1.5 h with buffer (Buffer), ceftazidime (AB) (300 mg/kg) or EDC34 (0.5 mg) or a combination of ceftazidime (300 mg/kg) and EDC34 (0.5 mg). The injections were repeated 4.5 h after bacterial injection. Survival was determined for 7 days (n = 10/group, P = 0.0002; log-rank Mantel-Cox test). (E–J) C57BL/6 mice were injected i. p. with P. aeruginosa 15159, followed by s. c. treatment after 1.5 h with ceftazidime (AB) (300 mg/kg) or EDC34 (0.5 mg) or a combination of ceftazidime (300 mg/kg) and EDC34 (0.5 mg). The injections were repeated 4.5 h post-infection. (E) Bacterial cfu were determined 10 h post-infection (Buffer; n = 10, ceftazidime (AB); n = 13, combination (AB+EDC34); n = 12). (F) Thrombin-antithrombin complexes in plasma were analyzed from a separate in vivo experiment. Mean±SEM is presented and compared by Mann-Whitney U-test (Control; n = 3, Buffer; n = 22, EDC34; n = 18). (G) Platelets were analyzed in blood from animals of the above experiment. (H) From the above experiment, lungs of the animals were collected 10 h post-infection and analyzed by SEM (n = 3, and a representative lung section is shown). Percentage of fibrin deposition is indicated. (I) A representative lung section, stained with hematoxylin and eosin, taken 10 h post-infection is shown. For scoring and statistics of a larger set of samples, see Supplementary Fig. S6. (J) Cytokines were analyzed in blood from the above experiment.
Effects of EDC34 in a P. aeruginosa infection model.
(A) C57BL/6 mice were injected (i. p.) with P. aeruginosa PAO1 or 15159 followed by i. p. injection of EDC34 (0.5 mg) or buffer only (n = 9/group; log-rank Mantel-Cox test). (B) C57BL/6 mice were injected i. p. with P. aeruginosa PA01 or 15159 bacteria and treated immediately after inoculation with 0.5 mg of EDC34 injected i. p. or s. c. at 1 h (1×1) or 1 and 7 h (1×2) after bacterial infection. (For P. aeruginosa PA01 infection model, control; n = 18, i. p. 1×1; n = 9, s. c. 1×1; n = 13, s. c. 1×2; n = 8; One-Way ANOVA Bonferroni's Multiple Comparison Test) (For P. aeruginosa 15159 infection model n = 8/group, mean±SEM is presented). Cfu were determined 12 h post-infection. (C) Animal lungs of P. aeruginosa PA01 infected animals (see B for details) were analyzed by scanning electron microscopy 12 h post-infection (n = 3, and a representative lung section is shown). Percentage of fibrin deposition is indicated. (D) C57BL/6 mice were injected i. p. with P. aeruginosa 15159, followed by s. c. treatment after 1.5 h with buffer (Buffer), ceftazidime (AB) (300 mg/kg) or EDC34 (0.5 mg) or a combination of ceftazidime (300 mg/kg) and EDC34 (0.5 mg). The injections were repeated 4.5 h after bacterial injection. Survival was determined for 7 days (n = 10/group, P = 0.0002; log-rank Mantel-Cox test). (E–J) C57BL/6 mice were injected i. p. with P. aeruginosa 15159, followed by s. c. treatment after 1.5 h with ceftazidime (AB) (300 mg/kg) or EDC34 (0.5 mg) or a combination of ceftazidime (300 mg/kg) and EDC34 (0.5 mg). The injections were repeated 4.5 h post-infection. (E) Bacterial cfu were determined 10 h post-infection (Buffer; n = 10, ceftazidime (AB); n = 13, combination (AB+EDC34); n = 12). (F) Thrombin-antithrombin complexes in plasma were analyzed from a separate in vivo experiment. Mean±SEM is presented and compared by Mann-Whitney U-test (Control; n = 3, Buffer; n = 22, EDC34; n = 18). (G) Platelets were analyzed in blood from animals of the above experiment. (H) From the above experiment, lungs of the animals were collected 10 h post-infection and analyzed by SEM (n = 3, and a representative lung section is shown). Percentage of fibrin deposition is indicated. (I) A representative lung section, stained with hematoxylin and eosin, taken 10 h post-infection is shown. For scoring and statistics of a larger set of samples, see Supplementary Fig. S6. (J) Cytokines were analyzed in blood from the above experiment.
Effects of EDC34 in combination with ceftazidime during Pseudomonas aeruginosa infection
Although EDC34 lowered initial bacterial levels after i. p. administration, the peptide did not completely eradicate bacteria in the above infection models, particularly noted for the clinical isolate. The activation of the intrinsic coagulation system by bacteria underlies the excessive coagulation and bradykinin-induced vascular leakage, and is therefore of interest to target during P. aeruginosa infection. Since antibiotics do not inhibit these bacterial effects on coagulation, we decided to explore the multiple effects of EDC34 in combination with ceftazidime, an antibiotic often used in Gram-negative infections. In an infection model mimicking a potential clinical situation, bacteria were injected i. p., followed by treatment 90 min and 4.5 h after bacterial challenge with either ceftazidime (300 mg/kg) or EDC34 (0.5 mg s. c.) alone, or the antibiotic in combination with EDC34 (doses as above). In contrast to animals treated with ceftazidime alone, the combination treatment significantly improved survival of the animals (
). In contrast, the peptide alone did not increase survival in this model (not shown). Further, bacterial levels were monitored in the spleen, kidney, and liver. Ceftazidime-treated animals had 100-fold less bacterial levels, which were further slightly reduced after addition of EDC34 (
), while EDC34 alone did not significantly reduce bacteria. Nevertheless, in spite of similar bacterial levels (
), the generation of TAT complexes was reduced in EDC34-treated mice compared to controls (
), and thrombocyte levels were increased after peptide treatment. This increase in thrombocytes was also noted in combination with the antibiotic, indicating a reduced activation of the coagulation system due to peptide treatment (
). This observation was supported by reduced fibrin deposition and pulmonary leakage of protein and red blood cells in the lungs of animals treated with EDC34 alone, or in combination with ceftazidime as judged by SEM (
) and confirmed by histochemistry and scoring of lung damage (
and ). It was noted that animals treated with ceftazidime alone showed lung damage changes, involving reduction of alveolar space, increased cell infiltration and wall thickness, and formation of thrombi, similar to those observed in infected untreated animals (
and ). EDC34 did not significantly reduce cytokine levels when given alone. Nevertheless, cytokine levels were reduced after treatment with the antibiotic as well as with the combination with EDC34 (
). EDC34 at a total dose of 2 mg did not significantly affect coagulation (aPTT, PT, TCT), thrombocytes, and cytokines after 12 h when administrated into healthy mice ().
Discussion
The development of novel anti-infective treatments has been largely addressing the bacteria itself, or the subsequent dysregulated host response, while efforts to control the dysregulated host response have so far failed. Therefore, there is a need for new therapies that address new targets in the complex interplay between microbes and the host. HDPs with multiple roles, such as those here defined for the TFPI-2-derived EDC34, targeting both bacteria and coagulative mechanisms, should therefore be of therapeutic interest. The main objective in this work was to clarify bioactive effects of EDC34 in vitro, and to what extent these can be utilized in anti-infective therapy in vivo. Challenging in this perspective was the fact that the in vitro effects, as observed in isolated experimental systems, were not independent of each other in vivo. For example, reduced bacterial levels could also be linked to concomitant reductions in pro-inflammatory cytokines in vivo. In such cases, an attempt was made to reduce complexity, and to study isolated factors or events, such as the peptide's anti-inflammatory effects in vitro in relation to LPS-stimulation of macrophages, or in vivo, in relation to endotoxin shock. In other cases, we highlight unique and peptide-dependent effects, such as abolished fibrin deposition irrespective of bacterial load and antibiotic usage in the animal models, clearly linking the anti-coagulative effects in vitro including blocking of bacteria-induced kallikrein activation and bradykinin release, to those observed in vivo. Furthermore, interference by EDC34 with the coagulation system in vivo was demonstrated not only by reduced fibrin deposition but also evidenced by reduced TAT levels, along with increased thrombocyte levels. This is of importance, since sepsis- and coagulation-related acute lung injury is considered to be a critical feature compromising the clinical outcome during sepsis [40], [41], [42]. In response to LPS challenge, the coagulation cascade is activated, leading to an excessive activation of the coagulation system, followed by consumption of coagulation factors in the blood resulting in prolonged clotting times [43]. In line with this, LPS-injected mice showed a reduced clotting capacity and exhibited prolonged aPTT and PT times in their plasma (
). Treatment with EDC34 however, resulted in a partially normalized clotting function, as evidenced by reduced coagulation times (
). Hence, these data showed that the peptide, by blocking coagulation as shown in Figure 3, reduced the excessive consumption of coagulation factors in this animal model. Also of importance, was the observation that no signs of bleeding or prolongation of coagulation was noted in animals treated with EDC34 only (). This should be of value, since other agents tested in the clinic, such as activated protein C, mainly affect the extrinsic or primary pathway of coagulation, and thus, may increase the risk of bleeding complications [5], [6]. As mentioned above, EDC34 did not present any significant anti-endotoxin effects in vitro or in vivo, in spite of its binding to LPS [32]. Such absence of direct anti-inflammatory effects may be advantageous, particularly in situations where an anti-coagulative action is of importance, while maintaining a normal LPS immune response.The complement system is crucial for bacterial clearance, indicating that strategies based on manipulating complement activation and thus bacterial clearance, may be of therapeutic interest. It is therefore notable that EDC34 boosts complement activation rapidly ex vivo in relation to the Gram-negative E. coli and P. aeruginosa. Thus, E. coli did not significantly induce activation of the classical complement pathway in absence of EDC34 in plasma in vitro, and the boosting effects were dependent on EDC34-binding to the bacteria. Although EDC34 was active against Gram-positive S. aureus in low salt buffer conditions [32], the results in human blood, where EDC34 was particularly active against E. coli and P. aeruginosa, further underscores the importance of the peptide's dependence of an active complement system for its actions in the in vivo models. Notably, EDC34-mediated formation of C3a, an anaphylatoxin exerting antimicrobial effects [44], was increased not only in vitro, but also locally at the site of infection in the animal E. coli infection model. In this context, it was interesting to note that although C3a was increased intraperitoneally, the overall levels of C3a in blood of the animals were reduced after peptide treatment. At a first sight, this may appear paradoxical, however, it is not unexpected when considering the significant reduction of bacteria systemically in peptide-treated animals. Also relevant in this context is that analyses of levels of C3 in E. coli infected animals showed that the total levels of this complement factor were unaffected after treatment i. p. with EDC34 (not shown), indicating that the modulation takes place locally, and that the total levels of C3 may buffer a potential local, initial consumption of the protein in this particular animal model. Furthermore, animals with a compromised complement function due to CVF treatment [39] did not exhibit a boosting of E. coli clearance by EDC34 in vivo. These results were compatible with the in vitro studies using heat-inactivated (hence complement-inactivated) plasma (
), elegantly demonstrating the importance of an intact complement system for the action of EDC34 in vitro and in vivo.From a biological perspective, it remains to be investigated whether TFPI-2 adds to host defense in vivo. Although these studies are currently initiated and TFPI-2−/− mice have been generated and are currently validated and characterized, this work is clearly beyond the scope of this present work aimed at utilizing the TFPI-2 peptide as a therapeutic molecule. Nevertheless, it is notable that emerging evidence suggests an involvement of TFPI-2 in host defense. Thus, in vitro, stimulation of human endothelial cells with inflammatory mediators such as LPS, and TNF-α significantly increases TFPI-2 expression [45]. Analogously, in vivo in a murine model, TFPI-2 expression is dramatically upregulated in the liver and in the lungs during LPS stimulation [46], [47]. These data, together with previous findings on release of C-terminal fragments by neutrophil elastase and their presence in human wounds [32], and as shown herein, particularly in association with bacteria (
), suggest that TFPI-2 fragments may exert physiological roles during infection.From a clinical perspective infections with Gram-negative bacteria such as E. coli and P. aeruginosa contribute to morbidity and mortality during abdominal surgery, peritoneal dialysis, burn wounds or in immunocompromized patients [48], [49], [50], [51]. An initial phase of effective bacterial clearance is crucial for patient outcome, and therefore, approaches based on substitution with EDC34 in combination with antibiotics may be of therapeutic interest. In order to verify such possibilities, experimental models are crucial, and it is notable that EDC34 exerted similar antibacterial effects in mouse and in human plasma, which should facilitate further development of experimental models incorporating readouts involving lung and organ damage.From a toxicological perspective, many HDPs cause side effects involving damage to eukaryotic cell membranes. It is therefore notably that EDC34 did not show toxicity at therapeutic doses in vitro
[32], that the peptides complement boosting activity was only recorded in presence of, and in relation to, bacteria, and that EDC34 was well tolerated in non-infected animals, neither significantly affecting coagulation parameters nor thrombocyte and cytokine levels ().In summary, the effects of EDC34, involving blocking of contact activation, and bacterial killing directly or by boosting of complement activation, while maintaining a functional cytokine response (), represents a potential new approach for boosting bacterial clearance while inhibiting the deleterious effects of excessive pro-coagulative responses during infection with Gram-negative bacteria.
Materials and Methods
Ethics statement
The use of human blood was approved by the Ethics Committee at Lund University, Lund, Sweden (Permit Number: 657-2008). Written informed consent was obtained from the donors. The animal experiments were conducted according to national guidelines (Swedish Animal Welfare Act SFS 1988:534) and were approved by the Laboratory Animal Ethics Committee of Malmö/Lund, Sweden (Permit Numbers: M228-10, M252-11)
Peptides
The peptidesEDC34 (EDCKRACAKALKKKKKMPKLRFASRIRKIRKKQF), DAC31 (DACHRACVKGWKKPKRWKIGDFLPRFWKHLS) and DAA14 (DAAQEPTGNNAEIC) were synthesized by Biopeptide Co., San Diego, CA, whereas LL-37 ([LL-37, 37 aa]) was obtained from Innovagen AB, Lund, Sweden. The purity (>95%) of these peptides was confirmed by mass spectral analysis (MALDI-ToF Voyager).
Microorganisms
The bacterial isolates E. coli DH5α, E. coli ATCC 25922, P. aeruginosa ATCC 27853, Staphylococcus aureus ATCC 29213 and S. pyogenes AP1 were obtained from the American Type Culture Collection. The P. aeruginosa strain PA01 was a generous gift from Dr. B. Iglewski (University of Rochester). E. coli O18:K1 was a kind gift from Dr. C. van 't Veer (University of Amsterdam). The clinical isolates E. coli 49.1, E. coli 47.1 and P. aeruginosa 15159 were obtained from the Department of Bacteriology, Lund University Hospital, Sweden.
Animals
Animals were housed under standard conditions of light and temperature and had free access to standard laboratory chow and water. The animals were purchased from Charles River or the animal facility at Lund University.
Viable count analysis (VCA)
E. coli, S. aureus and S. pyogenes AP1 strains were grown to mid-exponential phase in Todd-Hewitt (TH) broth. P. aeruginosa strains were grown in TH broth overnight. Bacteria were washed and diluted in 10 mM Tris, pH 7.4, containing 0.15 M NaCl, either alone or with 20% normal or heat-inactivated citrate-plasma or 50% citrate blood. Fifty µl bacteria (2×106 cfu/ml) were incubated at 37°C for 2 h with the C-terminal TFPI-2 derived peptide EDC34, LL-37 or DAC31 at the indicated concentrations. Serial dilutions of the incubation mixture were plated on TH agar, followed by incubation at 37°C overnight and cfu determination.
Hemolysis
Humancitrate blood was diluted (1∶1) with PBS prior to addition of 2×108 cfu/ml bacteria. The mixture was incubated with end-over-end rotation for 1 h at 37°C in the presence of peptides (60 and 120 µM). Two percent Triton X-100 (Sigma-Aldrich) served as positive control. The samples were then centrifuged at 800×g for 10 min and the supernatant was transferred to a 96-well microtiter plate. Hemoglobin release was determined by measuring the absorbance at 540 nm and is expressed as % of Triton X-100 induced hemolysis.
Flow cytometry analysis
Bacteria (1–2×109 cfu) were incubated for 30 min or 1 h at 37°C with human plasma alone or supplemented with TAMRA-labeled EDC34 (at 3 µM). Samples were then prepared for FACS analysis as previously described [52]. For visualization of the complement proteins, rabbit polyclonal antibodies against either LGE27, a C-terminal epitope of humanC3a, or rabbit polyclonal antibodies against C1q (both at 1∶100) in combination with a secondary goat anti rabbit IgG FITC-labeled antibody (1∶500, Sigma) were used. Flow cytometry analysis (Becton-Dickinson, Franklin Lakes, NJ) was performed using a FACS Calibur flow cytometry system. The bacterial population was selected by gating with appropriate settings of forward scatter (FSC) and sideward scatter (SSC). Controls without primary antibodies were included. Total positive cells present and fluorescence index (FI) (positive cells present multiplied with mean) are presented in the figures.
SDS-PAGE and immunoblotting
Humancitrate plasma was supplemented with bacteria (1–2×109 cfu) and incubated alone or with EDC34 at 3 µM for 30 min or 1 h at 37°C, centrifuged and supernatants and the bacterial cells were collected. The pull down assay, to extract bound proteins from the bacteria was performed as described previously [52], except two additional wash steps with acetone prior to sample separation by SDS page using 16.5% Tris-tricine gels (C.B.S Scientific) under reducing conditions. Proteins and peptides were transferred to nitrocellulose membranes (Hybond-C), blocked by 3% (w/v) skimmed milk, washed, and incubated with rabbit polyclonal antibodies against the C-terminal part of C3a (LGE27 antibodies) (1∶1000), rabbit polyclonal antibodies to C1q (1∶1000) (Dako) or rabbit polyclonal antibodies to C5b-9 (1∶1000) (Abcam, England). The proteins were detected by using HRP-conjugated secondary antibodies (1∶2000) (Dako) and an enhanced chemiluminesent substrate (LumiGLO) developing system (Upstate cell signaling solutions).
Clotting assays
All clotting times were analyzed using a coagulometer (Amelung, Lemgo, Germany). For determination of prothrombin time (PT, thromboplastin reagent (Trinity Biotech)) and thrombin clotting time (TCT, Thrombin reagent (Technoclone)), 50 µl of fresh citrate plasma, together with indicated concentrations of EDC34 or DAA14 were pre-warmed for 60 sec at 37°C before clot formation was initiated by adding 50 µl clotting reagent. To record the activated partial thromboplastin time (aPTT), 50 µl of a kaolin-containing solution (Dapttin, Technoclone) was added to the plasma-peptide mix and incubated for 200 sec before clot formation was initiated by adding 50 µl of 30 mM fresh CaCl2 solution. To determine the blood clotting time, 50 µl of citrated blood were pre-warmed to 37°C for 60 sec, before 50 µl of 30 mM fresh CaCl2 were added to initiate coagulation. Thrombin/antithrombin complexes (TATc) were determined in mousecitrate-plasma by ELISA (USCN Life Sciences Inc.).
Chromogenic substrate assay
Bacteria were grown in TH broth to mid-exponential phase (OD620∼0.5), washed twice in 50 mM Tris/HCl, pH 7.4 and resuspended in 50 mM Tris/HCl, pH 7.4+50 µM ZnCl2 to a final concentration of 2×109 cfu/ml. Hundred microliter of bacteria were incubated with 10 µl of EDC34/DAA14 or buffer for 60 sec before the addition of 100 µl humancitrate plasma. Samples were incubated for 35 min at 37°C on rotation followed by centrifugation. The bacterial pellets were washed once in 50 mM Tris/HCl, pH 7.4 and resuspended in 100 µl 50 mM Tris/HCl, pH 7.4+50 µM ZnCl2 buffer containing 2 mM of the chromogenic substrate S-2302 (Chromogenix). Samples were incubated for 30–60 min at 37°C, centrifuged and the absorbance was measured at 405 nm in the bacterial supernatants. In other experiments 100 µl of Dapttin (Technoclone) were incubated with 10 µl of EDC34/DAA14 for 60 sec prior to the addition of humancitrate plasma. Samples were incubated for 3 min at RT, centrifuged and the pellet was washed twice in 50 mM Tris/HCl, pH 7.4 before suspension in 100 µl 50 mM Tris/HCl, pH 7.4+50 µM ZnCl2 buffer containing 2 mM of the chromogenic substrate S-2302. After 30 min incubation at RT samples were centrifuged and the absorbance of the supernatant was determined (A405 nm). Samples containing 50 mM Tris/HCl, pH 7.4 instead of citrate plasma served as negative controls.
Detection of HK degradation
Bacteria and Dapttin samples were prepared as described in the chromogenic substrate assay. Samples were incubated for 15 min at RT, with shaking. Dapttin samples were centrifuged at 10.000 rpm for 2 min and supernatants were stored at −20°C. Bacterial samples were washed twice in 50 mM Tris/HCl, pH 7.4 and resuspended in 55 µl 50 mM Tris/HCl, pH 7.4+50 µM ZnCl2 buffer followed by 15 min incubation at RT before centrifugation at 10.000 rpm for 2 min and storage of supernatants at −20°C. Samples were separated by SDS page and analyzed by western blot using antibodies against HK and its degradation products as previously described [53].
Bradykinin assay
Humancitrate plasma was incubated with 50 µM of EDC34 or DAA14 for 2 min at RT before the addition of Dapttin and incubation for 2 min at 37°C. Samples were kept on ice, diluted with deproteinising buffer (1∶5), centrifuged (at 4°C) and the pellet was mixed with equal amounts of assay buffer. Samples with H2O instead of peptide served as positive controls. All buffers were provided together with the ELISA kit used to quantify the released bradykinin according to manufactures instructions (Markit-M-Bradykinin Kit; DS Pharma Biomedical co.Ltd).
LPS animal model
Male C57BL/6 mice (8 weeks) were i. p. injected with 5 mg/kg of E. coli O111:B4LPS (Sigma). Thirty minutes after LPS challenge mice were treated with 0.5 mg EDC34 (i. p.). For analysis of cytokines and coagulation parameters, mice were sacrificed 4 and 8 h post-LPS injection and the blood was collected by cardiac puncture.
E. coli infection model
E. coli DH5-α bacteria were grown to mid-exponential phase (OD620∼0.5), harvested, washed in PBS and diluted in the same buffer to 2×109 cfu/ml. Hundred fifty microliter of the bacterial suspension was injected intraperitoneally (i. p.) into male BALB/c mice immediately followed by 0.5 mg EDC34 or PBS. Mice were sacrificed 0.5, 2, 4 and 8 h post-infection to evaluate cfu, cytokines, coagulation parameters, blood counts and histology of the lungs. In another set of experiments mice were treated with 0.5 mg EDC34 injected i. p., immediately, or after 1 h, or subcutaneously 1 h post-infection. The animal status and weight was followed daily for up to 7 days. Mice sacrificed before day 7, according to predefined endpoint criteria, were counted as non-survivors. In another experiment, male BALB/c mice were depleted of complement factors by i. p. injection of 4.8 U of cobra venom factor (CVF) (Quidel) [39]. After 16 h mice were infected with E. coli DH5-α (i. p.) and immediately treated with 0.5 mg EDC34 or PBS. Mice were sacrificed 6 h post-infection and cfu were evaluated in spleen and liver, respectively.
P. aeruginosa infection model
P. aeruginosa 15159 or P. aeruginosa PA01 bacteria were grown to mid-exponential phase (OD620∼0.5), harvested, washed in PBS, diluted in the same buffer to 2×109 cfu/ml, and kept on ice until injection. Hundred microliter of the bacterial suspension was injected (i. p.) into male C57BL/6 mice. EDC34 (0.5 mg) or buffer alone was administered i. p. immediately after bacterial injection, or s. c. either as one dose after 1 h, or two doses at 1 h and 7 h. In another experiment, mice were treated twice s. c with a combination of 300 mg/kg ceftazidime and 0.5 mg of EDC34, 1.5 h and 4.5 h after bacterial infection. Data from three independent experiments were pooled. The survival data were obtained by following the animals daily up to 7 days monitoring status and weight. Mice reaching the predefined endpoint-criteria were sacrificed and counted as non-survivors.
Histochemistry
For histological evaluation of lungs derived from the in vivo P. aeruginosa infection model, tissues were collected at indicated time points, fixed in 4% formaldehyde for 24 h, embedded in paraffin, sectioned and stained with hematoxylin and eosin. Assessment of differences in alveolar space, cell infiltration, thickness of alveolar septa (cell wall thickness) and thrombi (Figure S6) was performed by scoring of at least five view fields per section by three blinded independent observers (score 1–4; where 1 indicates no change, 2 minor, 3 medium, and 4 significant change).
Electron microscopy
For transmission electron microscopy analysis of the presence of TFPI-2 fragments in vivo, fibrin slough from a patient with a chronic venous ulcer (CWS) was fixed and processed as previously described [52]. For immunostaining [52], rabbit polyclonal antibodies against the C-terminal of TFPI-2 (CAKALKKKKKMPKLRFASRIRKIRKKQF) alone, or in combination with rabbit polyclonal antibodies against the C-terminal part of C3a (LGE27 antibodies) (1 µg/ml) (Innovagen AB) were utilized. Controls without primary antibodies were also included. For simultaneous detection of TFPI-2 and C3a, 1 µg/ml EM rabbit anti-goat IgG 20 nm Au (BBI) and 1 µg/ml EM goat anti-rabbit IgG 10 nm Au (BBI) were used. All samples were examined with a Jeol JEM 1230 electron microscope operated at 80 kV accelerating voltage. Images were recorded with a Gatan Multiscan 791 charge-coupled device camera. For scanning electron microscopy, lungs were collected at 12 h after injection of bacteria and fixed in 2.5% (v/v) glutaraldehyde in 0.15 M sodium cacodylate buffer, pH 7.4, overnight at room temperature and further treated as described previously [31]. Specimens were examined in a JEOL JSM-350 scanning electron microscope. To quantify pulmonary lesions, lung samples from 30 different fields covering an entire lung section were made, and the percentage of fibrin deposits and fields exhibiting hemorrhage were determined.
Cytokine assay
The cytokines IL-6, IL-10, MCP-1, IFN-γ, and TNF-α were measured in mouse plasma using the Cytometric bead array; MouseInflammation Kit (Becton Dickinson AB) according to the manufacturer's instructions.
Blood cell counts
The number of platelets in mouse blood anti-coagulated with EDTA was determined using the VetScan HM5 (TrioLab).
Statistical analysis
Values are shown as mean with SEM. For statistical evaluation of two experimental groups the Mann-Whitney U-test was used and for comparison of survival curves the log-rank test. To compare more than two groups One-Way or Two-Way ANOVA with Bonferoni post-test were used. Viable count data are presented as mean with SD. All statistical evaluations were performed using the GraphPad Prism software 5.0. with *p-<0.05, **<0.01 and ***p<0.001 and ns = not significant.Antimicrobial activities of EDC34 and LL-37. (A–B) Antibacterial effects of EDC34 and LL-37 against (A) E. coli or (B) P. aeruginosa strains in viable count assays performed in 10 mM Tris, 0.15 M NaCl, pH 7.4 (Buffer), or in 10 mM Tris, 0.15 M NaCl, pH 7.4, containing 20% humancitrate plasma (CP), or heat-inactivated humancitrate plasma (HCP). (C–D) Antimicrobial activity in human blood. Bacteria were incubated with EDC34 or LL-37 in 50% humancitrate blood (diluted in PBS) and the number of cfu was determined. (n = 3, mean±SD presented).(TIF)Click here for additional data file.Kinetics of bacterial killing by EDC34 and LL-37. (A–B) Viable count assays of indicated E. coli (A) or Pseudomonas (B) isolates were subjected to EDC34 or LL-37 at 3 µM in 10 mM Tris, 0.15 M NaCl, pH 7.4, containing 20% humancitrate plasma (CP). Mean with SD is shown (n = 3).(TIF)Click here for additional data file.EDC34 enhances the binding of complement proteins to bacteria. Examples of flow cytometry histograms of C1q/C3a binding to E. coli and P. aeruginosa in citrate plasma in absence (Control) or presence of EDC34.(TIF)Click here for additional data file.EDC34 does not inhibit inflammatory responses
. Mouse macrophages were stimulated with 10 ng/ml E. coliLPS with or without increasing concentrations EDC34 or GKY25. Nitric oxide release was determined by using the Griess reaction in cell supernatants after 20 h. Data are shown as mean±SEM (n = 3).(TIF)Click here for additional data file.Role of complement on EDC34 mediated killing
. (A–B) Male Balb/c mice were infected with E. coli DH5-α bacteria (i. p.) followed by immediate treatment with 0.5 mg EDC34 (i. p.). C3a was determined in (A) peritoneal fluid (Non-infected mice (Control); n = 8, EDC34; n = 6, E. coli infection (E. coli); n = 13, treatment with EDC34; n = 13) and (B) plasma (Non-infected mice (Control); n = 10, EDC34; n = 6, E. coli infection (E. coli); n = 15, treatment with EDC34; n = 15; Two-Way ANOVA Bonferroni's Multiple Comparison Test) at the indicated time points. (C) In a separate experiment, a group of Balb/c mice were pre-treated with cobra venom factor (CVF) 16 h prior to infection with E. coli DH5-α bacteria (E. coli), and treatment with EDC34 as above. After 2 h post-infection cfu were determined in spleen and liver (E. coli; n = 4, EDC34; n = 5, CVF+ E. coli; n = 6, and CVF+E. coli+EDC34; n = 6).(TIF)Click here for additional data file.Histology score. C57BL/6 mice were infected (i. p.) with P. aeruginosa bacteria (2×109 cfu/ml) and s. c. treated with either the antibiotic ceftazidime (AB) (300 mg/kg), EDC34 (0.5 mg) or a combination of both 1.5 h and 4.5 h post-infection. Mice were sacrificed 10 h post-infection. Histology scores of hematoxylin-eosin stained lung sections, according to the indicated criteria are shown. Values are presented as mean ± SEM (Control; n = 5, P. aeruginosa infection, treatment of infection with EDC34, ceftazidime (AB) or a combination of both (AB+EDC34); n = 10 for all groups; Two-Way ANOVA Bonferroni's Multiple Comparison Test).(TIF)Click here for additional data file.effects of EDC34 alone. (A–B) 1 mg of EDC34 was administered i. p. two times (0 and 1.5 h) into healthy male C57BL/6 mice. Mice were sacrificed 12 h after the first injection and (A) clotting times, (B) cytokines were evaluated. Mean±SEM is presented (Control; n = 3, EDC34; n = 6, nonparametric Mann-Whitney t-test, ns; not significant).(TIF)Click here for additional data file.Proposed actions of the peptide EDC34 during Gram-negative bacterial infection.(TIF)Click here for additional data file.C3a assay.(DOCX)Click here for additional data file.Nitrite assay.(DOCX)Click here for additional data file.C-terminal sequences of human and mouseTFPI-2.(DOCX)Click here for additional data file.
Authors: S M Opal; C J Fisher; J F Dhainaut; J L Vincent; R Brase; S F Lowry; J C Sadoff; G J Slotman; H Levy; R A Balk; M P Shelly; J P Pribble; J F LaBrecque; J Lookabaugh; H Donovan; H Dubin; R Baughman; J Norman; E DeMaria; K Matzel; E Abraham; M Seneff Journal: Crit Care Med Date: 1997-07 Impact factor: 7.598
Authors: Joseph S Solomkin; John E Mazuski; John S Bradley; Keith A Rodvold; Ellie J C Goldstein; Ellen J Baron; Patrick J O'Neill; Anthony W Chow; E Patchen Dellinger; Soumitra R Eachempati; Sherwood Gorbach; Mary Hilfiker; Addison K May; Avery B Nathens; Robert G Sawyer; John G Bartlett Journal: Clin Infect Dis Date: 2010-01-15 Impact factor: 9.079
Authors: Anastasia Nijnik; Laurence Madera; Shuhua Ma; Matthew Waldbrook; Melissa R Elliott; Donna M Easton; Matthew L Mayer; Sarah C Mullaly; Jason Kindrachuk; Håvard Jenssen; Robert E W Hancock Journal: J Immunol Date: 2010-01-27 Impact factor: 5.422
Authors: Florry E van den Boogaard; Cornelis van 't Veer; Joris J T H Roelofs; Joost C M Meijers; Marcus J Schultz; George J Broze; Tom van der Poll Journal: Thromb Haemost Date: 2015-04-02 Impact factor: 5.249
Authors: Florry E van den Boogaard; Jorrit J Hofstra; Cornelis van 't Veer; Marcel M Levi; Joris J T H Roelofs; Tom van der Poll; Marcus J Schultz Journal: PLoS One Date: 2015-05-18 Impact factor: 3.240
Authors: Finja C Hansen; Ann-Charlotte Strömdahl; Matthias Mörgelin; Artur Schmidtchen; Mariena J A van der Plas Journal: Front Immunol Date: 2017-07-21 Impact factor: 7.561
Authors: Mariena J A van der Plas; Ravi K V Bhongir; Sven Kjellström; Helena Siller; Gopinath Kasetty; Matthias Mörgelin; Artur Schmidtchen Journal: Nat Commun Date: 2016-05-16 Impact factor: 14.919
Authors: Praveen Papareddy; Gopinath Kasetty; Saud Alyafei; Emanuel Smeds; Outi M H Salo-Ahen; Stefan R Hansson; Arne Egesten; Heiko Herwald Journal: Virulence Date: 2018-12-31 Impact factor: 5.882