The oil palm SHELL gene controls oil yield and encodes a homologue of SEEDSTICK.

A key event in the domestication and breeding of the oil palm Elaeis guineensis was loss of the thick coconut-like shell surrounding the kernel. Modern E. guineensis has three fruit forms, dura (thick-shelled), pisifera (shell-less) and tenera (thin-shelled), a hybrid between dura and pisifera. The pisifera palm is usually female-sterile. The tenera palm yields far more oil than dura, and is the basis for commercial palm oil production in all of southeast Asia. Here we describe the mapping and identification of the SHELL gene responsible for the different fruit forms. Using homozygosity mapping by sequencing, we found two independent mutations in the DNA-binding domain of a homologue of the MADS-box gene SEEDSTICK (STK, also known as AGAMOUS-LIKE 11), which controls ovule identity and seed development in Arabidopsis. The SHELL gene is responsible for the tenera phenotype in both cultivated and wild palms from sub-Saharan Africa, and our findings provide a genetic explanation for the single gene hybrid vigour (or heterosis) attributed to SHELL, via heterodimerization. This gene mutation explains the single most important economic trait in oil palm, and has implications for the competing interests of global edible oil production, biofuels and rainforest conservation.

Oil palm fruits (drupes) are derived from three fused carpels and consist of epicarp, mesocarp and endocarp tissues surrounding one or more kernels. Hybrids (tenera) between dura and pisifera (Fig. 1) have a distinct fiber ring, derived from the endocarp, that surrounds the coconut-like shell of the oil palm seed[7]. The Shell gene responsible for this phenotype has co-dominant monogenic inheritance, first reported in the Belgian Congo in the 1940’s[7]. However, tenera fruit forms were recognized and exploited in Africa well before then[2,8]. Given the central role played by the Shell gene, oil palm breeding utilizes reciprocal recurrent selection of maternal (dura) and paternal (pisifera) pools[4]. The Deli dura population, direct descendants of the four original African palms planted in Bogor Botanical Garden, Indonesia (1848), has excellent combining ability with the AVROS (Algemene Vereniging van Rubberplanters ter Oostkust van Sumatra) and other pisifera parental palms. AVROS pisifera palms were derived from the famous “Djongo” palm from Congo, but more recently several different accessions of dura and tenera have also been sourced from Africa[4]. Tenera palms are thought to have been selected by pre-colonial cultures in West Africa due to their higher oil yields, and are the basis for modern oil palm breeding[4].

Figure 1

Fruit forms of the African oil palm Elaeis guineensis

a, Dura (Sh/Sh) fruit forms have a thick lignified shell surrounding the kernel, which is absent in pisifera (sh/sh). F1 hybrid palms (Sh/sh) have an intermediate fruit form (tenera) which is much higher yielding than either parent in terms of mesocarp oil. b, Dura, tenera and pisifera fruit stained for lignin (red) with phloroglucinol.

The Shell gene lies 4.7 cM and 9.8 cM away from the closest molecular markers[9-11] but has proven extremely challenging to identify given the large genome, long generation times and difficulty of phenotyping in experimental populations of oil palm, which are widely distributed among different plantations (Methods). We employed a two-tiered approach to identify the Shell gene, taking advantage of the recently completed oil palm genome sequence[12]. First, 240 F1 progeny, derived by controlled self-pollination of the Nigerian tenera accession T128 and grown over two decades in plantations throughout Malaysia, were scored for fruit form phenotype[13]. In addition to 200 RFLP and SSR markers, the progeny were genotyped for 4,451 SNP markers derived from the oil palm genome sequence[12] by the Infinium iSelect® Assay (Illumina). A genetic map with 16 linkage groups was constructed, and the Shell gene locus was placed in T128 Linkage Group 7 (Supplementary Fig. 1), consistent with prior studies (Methods), and mapped by sequence similarity to a 3.4 Mb assembly Scaffold 43 (p3-sc00043) at the end of Chromosome 2[12]. A tiling path of BAC contigs corresponding to Scaffold 43 was selected from a high-information content physical map of pisifera and sequenced[12]. Further SNP assays were designed from an improved assembly, and additional genotypes incorporated into the map. In a review of single marker data, recombinant breakpoints were identified indicating the gene lay in a 450kb interval (Methods).

Next, we employed homozygosity mapping using the AVROS pedigree (Fig. 2a) and whole genome re-sequencing (Methods Summary). In this technique, candidate genes appear as regions with low diversity in homozygous inbred individuals[14,15]. Fourteen individual pisifera palm genomes were sequenced at 20× genomic coverage and 29 additional pisifera palms were sequenced as a pool (pool 1) at 40× coverage (Illumina HISEQ 2000). SNPs were called throughout the genome, and those in Scaffold 43 were scored for homozygosity. The resulting homozygosity plot had a local minimum of 200 Kb (centered on 400,000 bp in p3-sc00043, Fig. 2b). This 200 Kb region contained about 30 annotated genes, only five of which were fully homozygous, and only one of which lay in the genetic interval containing Shell (Fig. 2c). This gene encodes a homologue of SEEDSTICK (STK), which is responsible for ovule and seed development in Arabidopsis[16,17] (Fig. 2c; Supplementary Fig. 2).

Figure 2

Homozygosity mapping of the shell trait

a, AVROS pedigree palms heterozygous (tenera, pink) and homozygous (pisifera, blue and green) for Shell are indicated, linked to parents and progeny planted over 5 decades. Individually sequenced palms are indicated (green). Three additional pisifera palms from this extended pedigree were also individually sequenced (not shown). The remaining pisifera palms were sequenced as a pool. b, The Shell locus was mapped onto scaffold p3-sc00043 (3.4Mb) and SNP density was plotted along the scaffold (upper panel). Markers surrounding Shell are plotted against the % of pisifera palms with the SNP haplotype in the Nigerian T128 F1 mapping population. Shell was mapped between flanking markers, denoted by blue diamonds, at 400 Kb and 1 Mb. A local diversity minimum of 200 Kb was found within this interval (inset). c, Genes (green) and transposons (red) are indicated as boxes. The local diversity minimum contained 4 homozygous genes (boxed), only one of which (Shell) was located between the flanking markers in panel b.

PCR amplicon sequencing (Methods) identified allelic differences between Shell in Deli dura (ShDeliDura), and in the AVROS (shAVROS) and T128 (shMPOB) pisifera haplotypes derived from Congo and Nigeria, respectively (Fig. 3). A nucleotide substitution in shMPOB results in a leucine to proline amino acid change in the conserved DNA binding and dimerization domain, while a substitution in shAVROS results in a lysine to asparagine amino acid change only two amino acids removed (Fig. 3). In related proteins, this highly conserved lysine residue is involved in nuclear localization, and in direct DNA binding[18,19], while the substitution by a proline only two amino acid residues N-terminal to this position would disrupt the alpha helix that is involved in MADS dimerization and DNA binding[19]. Analysis of an additional 336 palms was used to validate these alleles within established phenotyping norms (Methods). These included four pisifera palms from introgression trials of shMPOB into tenera carrying the shAVROS allele. Sequencing confirmed that these four palms were heteroallelic, indicating that the two alleles failed to complement, and confirming the identity of the gene (Methods). To further explore segregation in E. guineensis populations, Shell Exon 1 sequence was generated from a diversity panel of 379 palms representing nine distinct wild oil palm populations collected from Angola[4], Madagascar[4], Nigeria[3] and Tanzania[4], and a subset of a 110,000-accession seed bank collected over the past five decades[4] (Methods). We found that all palms evaluated carried either the ShDeliDura, shAVROS or shMPOB alleles in exon 1 (Fig. 3, Supplementary Fig. 3).

Figure 3

Sequence diversity of Shell

Multiple sequence alignment of Arabidopsis STK (AEE82818.1) and SHP1 (P29381.1) proteins, rice protein OsMADS13 (AAF13594.1), poplar predicted protein (XP_002327282.1), grape MADS-box protein 5 (XP_002281890.1), tomato TAGL1 (AAM33101.2) and peach SHATTERPROOF-like (ABG75908.1) (Out Groups), E. oleifera, E. guineensis and exemplars of Deli dura (Oil Palm – Dura Allele) and pisifera from T128 – Nigerian and AVROS – Congo (Oil Palm – Pisifera Allele). The pisifera fruit form is caused by two disruptive SNPs that affect a highly conserved amino acid motif in the MADS-box DNA binding and dimerization domain. Gene names (out group examples) or sample identifiers (oil palm examples) are in parentheses.

Analysis of 10,916,126 RNA-seq reads from 22 different libraries[12] revealed only 159 reads matching Shell, all of which were found in just four libraries: from whole florets one day after anthesis, kernels 10 and 15 weeks, and mesocarp 15 weeks after anthesis (WAA). In situ hybridization was performed on fruits between 1 and 5 WAA (Fig. 4), at the earliest stages of shell formation[3,20]. Uniform but weak hybridization signals were detected in the mesocarp of both the thick-shelled (dura) and shell-less (pisifera) fruit forms (Fig. 4a & c), but very strong signals were detected in the outer layers of the developing kernel in only the dura type (Fig. 4a), consistent with the function of Shell. The oil palm shell is heavily lignified (Fig. 1b), derived from the endocarp, and surrounds the kernel (or pit). It is not found in pisifera palms which are often female sterile.

Figure 4

Expression of Shell in early oil palm fruit

Longitudinal sections of 1 WAA Dura fruit (a, b) and cross sections of 5 WAA pisifera fruit (c, d) were hybridized to a pool of two unique Shell locked nucleic acid (LNA) probes (a, c) or to a scrambled sequence LNA negative control probe (b, d). Colorimetric in situ hybridization probe detection is blue and all sections were counterstained red. The scale bar (0.8 mm) shown in panel b applies to all four panels. Structural hallmarks of fruits are indicated by labeled arrows in panels a and c.

The function and expression of the Shell gene is conserved in higher plants[16]. In Arabidopsis, SHATTERPROOF (SHP) and STK are Type II MADS-box proteins of the C and D class, respectively, and form a network of transcription factors that control differentiation of the ovule, seed and lignified endocarp[21]. In tomato, SHP homologues control fleshy fruit expansion in the endocarp[22] while in peaches, which are also drupes, homologues of both genes have been implicated in lignified split-pit formation[23,24]. In rice, the Shell orthologue is OsMADS13 (Supplementary Fig. 4), a homologue of STK[25] and SHP[26] that controls ovule identity, so that mutants are female sterile[27]. STK and SHP bind to DNA as heteromultimers with SEPALLATA (SEP) MADS box proteins, including OsMADS24 in rice[16], and the highly conserved MADS domain is involved in both DNA binding and in dimerization[18,19]. We postulated that the mutations we detected in Shell could account for the remarkable single gene heterosis exhibited in tenera palms[7] if they disrupted heterodimerization, as well as DNA binding[16,18]. In yeast 2 hybrid assays, we found that only the dura allelic form of Shell, but neither of the pisifera alleles, interacted as a heterodimer with OsMADS24. Furthermore, the dura form of Shell homodimerized with itself and with the pisifera forms but the pisifera forms did not homodimerize with each other (Table 1, Supplementary Figure 5 and Supplementary Table 1). If productive heterodimers compete with non-productive homodimers in heterozygotes, this would neatly account for hybrid vigor according to theoretical models[28]. Overdominance at a single locus accounts for similarly remarkable increases in hybrid yield in tomato[29].

Table 1

Pisifera fruit form mutations disrupt the interaction of SHELL and OsMADS24

Binding Domain Fusion	Activation Domain Fusion	Interaction
ShDeliDura	ShDeliDura	+
ShMPOB	ShDeliDura	+
ShAVROS	ShDeliDura	+
OsMADS24	OsMADS24	−
OsMADS24	ShDeliDura	+
OsMADS24	ShMPOB	−
OsMADS24	ShAVROS	−

Symbols: +, dimerization detected in yeast two-hybrid assay. −, no interaction detected. Experiments were performed as described (Methods). Complete datasets are provided in Supplementary Figure 5 and Supplementary Table 1.

The unraveling of the genetic basis for the shell-less phenotype paves the way for designing molecular strategies for genotyping trees that breed true for the phenotype, and modulating Shell activity for desired fruit forms. A marker for Shell could be used by seed producers to reduce or eliminate dura contamination, and to distinguish the dura, tenera and pisifera plants in the nursery long before they are field planted – the advantage here being that they could be planted separately based on the shell trait. This is useful as the pisifera palms have vigorous vegetative growth, and planting them in high density encourages male inflorescence development and pollen production[4,30]. As foreseen by the breeder A. Devuyst in the Belgian Congo (in the same year that the structure of DNA was solved)[2], accurate genotyping for enhanced oil yields will optimize and ultimately reduce the acreage devoted to oil palm plantations, providing an opportunity for conservation and restoration of dwindling rainforest reserves[6].

Methods

Plant Materials and Germplasm Collection

Oil palm germplasm materials used in this study were collected through bilateral agreements between Malaysia and the countries of origin and were in accordance with the Convention on Biological Diversity (CBD) 1992. The reference Deli dura palm was MPOB 0.212/70, the reference pisifera palm was MPOB 0.182/77, and the reference E.oleifera palm was MPOB 0.211/2460. The mapping family used for generating the genetic linkage map was derived from controlled self pollination of the high iodine value (IV, a measure of level of unsaturation) virescens tenera palm, T128 (Accession number: MPOB 371), from MPOB's Nigerian germplasm collection[13]. A total of 241 palms was originally planted from 1993 to 1997 at several locations in Malaysia, namely the MPOB-UKM Research Station Bangi at Selangor, MPOB Ulu Paka Research Station at Terengganu, MPOB Keratong Research Station at Johore, MPOB Lahad Datu Research Station at Sabah, United Plantations at Perak and FELDA Research Station at Pahang. Of the 241 palms, 240 were still available for marker analysis. The palm T128 is relevant to the breeding programme as it has outstanding attributes in terms of oil yield, fatty acid composition and low height increment. It has been crossed with at least six dura, eight tenera and three pisifera palms for progeny testing and widening the genetic base. A collection of 379 palms (287 dura, 86 tenera and 6 pisifera scored fruit types) from Angola, Congo, Madagascar, Nigeria and Tanzania were taken from the diversity panel maintained by MPOB, and screened for new alleles as described. Unopened leaf samples (spear leaves) were collected from individual palms and immediately frozen under liquid nitrogen and then stored at −80°C until DNA preparation. DNA was extracted and purified from the leaf samples as previously described[31].

Whole genome sequencing and assembly

An AVROS pisifera palm was sequenced to high coverage[12] on the 454 XL next generation sequencing platform (454/ Roche). Sequence reads were generated from DNA fragment libraries and from a complex series of linker libraries where read ends span fragment sizes ranging from 0.75 Kb to >30 Kb. Sequence reads were assembled with the Newbler assembler (Roche 454, Bradford, CT) producing a reference sequence of the oil palm genome[12]. Scaffolds from the reference assembly containing markers genetically mapped in the shell interval were identified. A BAC physical map was constructed from a 10-fold BAC library constructed from the same AVROS pisifera used to generate the reference sequence. BAC end sequences were also generated from each BAC in the library using standard Sanger sequencing on the 3730 sequencing platform (Life Technologies). BAC end sequences were assembled into the reference genome with the Newbler assembler. A minimum tiling path of BAC clones spanning the SHELL interval was selected, and BAC clones in the tiling path were sequenced in pools to high coverage with 454 XL technology. The BAC pool sequences were assembled and merged with the original 454 whole genome shotgun sequence data and all BAC end sequences. Improved scaffold coverage and scaffold length spanning the shell interval was produced.

Genetic mapping

241 progeny palms were derived from self-pollination of the Nigerian tenera palm T128[4], of which 240 palms were available throughout the study. Two palms could not be phenotyped accurately while 124 tenera, 46 pisifera and 68 dura, palms were phenotyped with high confidence at the time of genetic map construction. All 240 progeny were scored for 4451 SNP markers using the Infinium iSelect® Assay (Illumina), as well as three RFLP markers[32] four SSR markers[3] and 193 additional SSR markers developed from the oil palm genome sequence[12]. The linkage map was then constructed using JoinMap v4[33]. The genotype data was formatted as required for mapping according to an F2 population. Markers showing a segregation profile of 1:2:1 for the phenotypes were used in the map construction.

Two sets of the genotype data were then created, whereby one set is the converse of the other to account for phase differences in the T128 selfed F2 population. Markers that exhibited severe distortion (p < 0.0001) and markers having more than 10% missing data were excluded. Both sets of genotype data were then grouped at a recombination frequency of ≤ 0.2. Eighteen nodes were selected to create 18 initial groups for calculating the linkage groups. The linkages were calculated and loci ordered based on the maximum likelihood algorithm. None of the markers showed severe distortion (p < 0.0001). The few distorted markers observed were significant at p < 0.05 – 0.1. These markers were removed from further analysis when necessary. Markers exhibiting nearest neighbour stress (N.N. Stress) value > 2 (cM) were identified and excluded from the analysis. Markers contributing to insufficient linkages were also determined and removed. The T128 co-dominant map constructed consisted of 16 groups[9], and shell was placed on linkage group 7, within the expected region (Supplementary Figure 1).

The SNP markers surrounding shell were subsequently mapped by sequence similarity to a 3.4Mb assembly Scaffold 43 (p3-sc00043). A tiling path of BAC contigs corresponding to Scaffold 43 was selected from a high-information content physical map of pisifera and sequenced[12]. An additional 50 SNP assays were designed from an improved assembly corresponding to Scaffold 43 (p5-Scaffold 60). Thirty additional SNP markers were also designed from the scaffolds p3-sc00191, p3-sc00203 and p3-sc02216, which were also associated with markers on linkage Group 7, and reassembled as p5-sc00263. These 80 SNP markers (designated as SNPE) were genotyped in the T128 selfed population using the Sequenom MassArray® iPlex platform and 63 were polymorphic giving a final co-dominant genetic linkage map consisting of 818 markers [719 SNP (inclusive of SNPE), 96 SSR, 2 RFLP markers and shell] in 16 linkage groups. Shell remained in linkage group 7, together with the 63 SNPE markers developed from the selected scaffolds. The final size of linkage group 7 is ~182 cM with an average of 1.2 cM between two adjacent markers (Supplementary Figure 1).

Single marker mapping was employed to determine the recombination breakpoints surrounding shell in each individual palm. To obtain a genetic interval containing shell, palms with multiple breakpoints in the region and/or inconsistent haplotypes were discarded in case of mis-genotyping. Markers flanking shell were selected using these conservative criteria and found to lie 450 Kb apart on scaffold p3-Sc0043 (Fig. 2b & c).

Fruit form phenotyping

Oil palm trees were grown to maturity in open plantations, making accurate phenotyping of fruit form for some samples difficult due to variation in fertility, yield and environment. Several fruits were harvested from each palm, and shell thickness and fruit form was determined using established criteria[3]. To assess the accuracy of the fruit form phenotypic data used in the study, we reviewed 460 phenotype calls which were made between 2003 and 2012. In this period, up to three independent attempts were made to visually determine the fruit form phenotypes of 340 palms, 241 of which were from the T-128 selfed population used to map shell, and 99 from a different population for which re-phenotyping data were available. In the data, ambiguous calls were made 26 times (or 5.7% of total phenotype determinations) where breeders were unsure of the fruit form phenotype.

Homozygosity mapping

A total of 43 individual pisifera palms from the AVROS pedigree (originating from Congo) were sourced from MPOB, Sime Darby and Kulim plantations. 14 of the AVROS pisifera palms were independently sequenced while the DNA from the remaining 29 palms were pooled for sequencing (Pool 1). Whole genome shotgun sequence data was generated on the HISEQ 2000 (Illumina). Individual trees and pools of trees were sequenced to 20 and 40 fold raw sequence coverage, respectively. Individual reads were mapped to sequence scaffolds from the pisifera reference genome assembly, and highest probability SNPs were located on scaffold 43 of the pisifera Build 3 (p3_sc00043). In each of the 14 genome sequences, SNPs were summed over 10kb windows along the scaffold and plotted against map location. This scaffold was computationally annotated for genes by comparing to public databases for the A. thaliana and rice genomes using the NCBI BLAST similarity searching tool. The genes with the highest homozygosity within the predicted interval from the genetic map were screened for putative function and for nucleic and amino acid changes between the pisifera and dura lines, as well as for amino acid differences in other species.

Validation and genotyping

DNA sequencing of the eight exons of the SHP1 gene was carried out for all palms of the mapping family as well as the AVROS pisifera palms used in homozygosity mapping. One of the 14 sequenced pisifera palms (TP10) proved to be heterozygous for the shAVROS and shMPOB haplotypes, due to contamination in a breeding trial, and was not used for the homozygosity analysis. PCR primers were designed based on the reference pisifera genome sequence to amplify the entirety of SHP1 exon 1. SHP1-specific primer sequences were TTGCTTTTAATTTTGCTTGAATACC (forward primer upstream of exon 1) and TTTGGATCAGGGATAAAAGGGAAGC (reverse primer downstream of exon 1). Primer sequences were confirmed to be unique in the reference pisifera genome, and to avoid any identified polymorphic nucleotides. A 5’ M13 forward sequence tag (GTTTTCCCAGTCACGACGTTGTA) was added to the Exon 1 forward PCR primer. A 5’ M13 reverse sequence tag (AGGAAACAGCTATGACCAT) was added to the Exon 1 reverse primer. SHP1 exon 1 was amplified from genomic DNA and PCR amplification was performed using 20 ng of purified genomic DNA under standard PCR amplification conditions. Amplicons were treated with exonuclease I and shrimp alkaline phosphatase to remove unincorporated primers and deoxynucleotides. An aliquot of each amplicon was sequenced using M13 forward as primer on an ABI 3730 instrument using standard conditions. Each amplicon was sequenced twice in the forward direction. An aliquot of each amplicon was additionally sequenced using M13 reverse as primer. Each amplicon was sequenced twice in the reverse direction. All sequencing data was aligned to the reference pisifera genome sequence. Data were analyzed to determine the genotype at each of the two SNP positions identified to be associated with the pisifera fruit form. We sequenced SHP Exon 1 from 336 individual palms from the T-128 mapping population, the samples used to construct homozygosity maps, and a collection of palms in crosses with advanced lines (100 pisifera, 148 tenera, 86 dura and 2 with ambiguous phenotype). 323 (96.7%) had SHP genotypes concordant with their phenotype, and 11 (3.3%) had discordant phenotypes, reflecting the accuracy of phenotyping in the plantation (see above). SHP exon 1 was also sequenced from all 4 pisifera palms derived from TxT crosses between sh and sh (Felda AA and MPOB 0.305), and proved to be heteroallelic as predicted. An additional 3 pisifera palms were also found to be heteroallelic, including TP10 which was sequenced completely and proved to be a contaminant in the AVROS pedigree (see above). The other 2 heteroallelic palms were likely similarly contaminated.

A second attempt was made to phenotype and re-sequence the 11 apparently discordant trees, enabling the re-evaluation of 9 trees for fruit type. The second phenotype call of 1 palm was concordant with the genotype prediction, while the second phenotype calls of 7 palms were ambiguous, and 1 palm retained the original phenotype. This palm was re-genotyped and proved to have a consistent genotype. It is plausible that the 9 palms remaining (or 2.7% of the genotyped population) had been misphenotyped originally, given that fruit form phenotyping error is believed to be in excess of 5% (see above), highlighting the need for a molecular assay which more accurately predicts fruit form. This assumption was confirmed in 6 of the 9 palms for which haplotypes were available, as haplotypes were consistent with genotype not phenotype, ruling out recombination as an explanation for discrepancy. The map expansion immediately around the shell gene is similarly explained by mis-phenotyped palms. That is, the 4 SNP markers closest to shell surround the SHP gene, but all have 9/238 “recombinants” including 6 of the 9 mis-phenotyped palms.

In situ Hybridization. 5 micron (µm) sections of tissues were mounted on Superfrost slides, dried overnight, and baked at 60°C. Sections were deparaffinized in xylene, immersed in 100% ethanol and dried. The sections received light treatment with protease. Two locked nucleic acid (LNA) probes to the target mRNA were designed and supplied by Exiqon (5’-DIG-ATTAACAAGCAGCGACATACTT and 5’-DIG-TTGATGGTGTGAATAGTGTTGT). A Scramble-miR negative control LNA probe was also provided by Exiqon (5’-DIG-GTGTAACACGTCTATACGCCCA). Optimized probe cocktail solution in Exiqon hybridization buffer was placed on the tissue sections. The sections were covered with polypropylene coverslips and heated to 60°C for 5 minutes followed by hybridization at 37°C overnight. Sections were washed in high stringency solution (0.2× SSC with 2% bovine serum albumin) at 60°C for 10 minutes. The LNA probes were detected using alkaline phosphatase conjugate (NBT/BCIP, blue precipitate). Sections were counterstained with Nuclear Fast Red. Sections were rinsed and mounted with coverslips. Aperio scans of the slides were made and images were extracted with ImageScope software.

Yeast two-hybrid assays

The coding sequences for oil palm Sh and rice OsMADS24 were synthesized as two ~300 bp gBlocks each that overlapped by 30 bp (Integrated DNA Technologies). Gibson assembly of the two fragments was performed using kit manufacturer’s protocols (NEB). EcoRI and BamHI sites were added to the gBlock sequences for simple ligation into MatchMaker Gold Yeast Two-Hybrid vectors. Each sequence was cloned into both the binding domain vector, pGBKT7, and the activation domain vector, pGADT7. Shell sequences encoded amino acids 2 to 175, including the entire MADS-box, I and K domains. The C domain was excluded from yeast two-hybrid constructs to avoid auto-activation of selection genes in the yeast two-hybrid system. The ShDeliDura peptide sequence encoded by the vectors was: GRGKIEIKRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSIRSTIDRYKKACANSSNSGATIEINSQQYYQQESAKLRHQIQILQNANRHLMGEALSTLTVKELKQLENRLERGITRIRSKKHELLFAEIEYMQKREVELQNDNMYLRAKIAEN. The ShMPOB peptide sequence encoded by the vectors was identical to the above sequence, with the exception that the underlined leucine residue (L) was converted to proline (P). The ShAVROS peptide sequence encoded by the vectors was identical to the above sequence, with the exception that the underlined lysine residue (K) was converted to asparagine (N). OsMADS24 sequences encoded amino acids 2 to 177, including the entire MADS-box, I and K domains, but excluding the C domain. The OsMADS24 sequence encoded by the vectors was: GRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGQSMTRTLERYQKFSYGGPDTAIQNKENELVQSSRNEYLKLKARVENLQRTQRNLLGEDLGTLGIKELEQLEKQLDSSLRHIRSTRTQHMLDQLTDLQRREQMLCEANKCLRRKLEES. Auto-activation control tests were performed by transforming each fusion vector into yeast alone, and each vector showed no auto-activation of selection reporter genes. Co-transformations were performed for all 16 pairwise combinations of BD and AD vectors and scored for growth on SD-Leu-Trp, SD-Lue-Trp-His, SD-Leu-Trp-His-Ade and X-gal media plates. Positive interactions were scored as blue co-tranformants (on X-gal plate) that were able to grow on SD-Lue-Trp-His and SD-Leu-Trp-His-Ade selection plates (Supplementary Fig. 5).