Literature DB >> 23049988

Mapping the laminin receptor binding domains of Neisseria meningitidis PorA and Haemophilus influenzae OmpP2.

Noha M Abouseada1, Mahde Saleh A Assafi, Jafar Mahdavi, Neil J Oldfield, Lee M Wheldon, Karl G Wooldridge, Dlawer A A Ala'Aldeen.   

Abstract

Neisseria meningitidis, Haemophilus influenzae and Streptococcus pneumoniae are major bacterial agents of meningitis. They each bind the 37/67-kDa laminin receptor (LamR) via the surface protein adhesins: meningococcal PilQ and PorA, H. influenzae OmpP2 and pneumococcal CbpA. We have previously reported that a surface-exposed loop of the R2 domain of CbpA mediates LamR-binding. Here we have identified the LamR-binding regions of PorA and OmpP2. Using truncated recombinant proteins we show that binding is dependent on amino acids 171-240 and 91-99 of PorA and OmpP2, respectively, which are predicted to localize to the fourth and second surface-exposed loops, respectively, of these proteins. Synthetic peptides corresponding to the loops bound LamR and could block LamR-binding to bacterial ligands in a dose dependant manner. Meningococci expressing PorA lacking the apex of loop 4 and H. influenzae expressing OmpP2 lacking the apex of loop 2 showed significantly reduced LamR binding. Since both loops are hyper-variable, our data may suggest a molecular basis for the range of LamR-binding capabilities previously reported among different meningococcal and H. influenzae strains.

Entities:  

Mesh:

Substances:

Year:  2012        PMID: 23049988      PMCID: PMC3457995          DOI: 10.1371/journal.pone.0046233

Source DB:  PubMed          Journal:  PLoS One        ISSN: 1932-6203            Impact factor:   3.240


Introduction

Invasive disease caused by Neisseria meningitidis (meningococcus), Haemophilus influenzae and Streptococcus pneumoniae (pneumococcus) remains an important cause of morbidity and mortality worldwide, despite the use of antibiotics and the introduction of effective conjugate polysaccharide vaccines that target some disease-associated serogroups [1]. However, there is no currently licensed vaccine effective against serogroup B meningococcus, the dominant serogroup in much of the developed world [2]. Similarly, there are no vaccines against non-type B H. influenzae and the vaccines available against pneumococcus only provide protection against a limited subset of the plethora of recognized serogroups [1]. The human 37/67-kDa laminin receptor (LamR) is a highly conserved, multi-functional protein [3]. The relationship between the 37-kDa and 67-kDa forms is not completely understood, but the former is thought to mature into one or more homo or heterodimeric 67-kDa forms [4], [5], [6]. LamR was initially identified as a cell surface receptor for the extracellular matrix molecule laminin [7], [8], [9]. LamR is important for cell adhesion to the basement membrane and is also implicated in tumour cell metastasis [10]. LamR has additional roles in intracellular signaling [11], ribosomal activity [12] and cell viability [13]. LamR can also migrate to the nucleus where it can bind the histones H2A, H2B and H4, although the significance of this is not known [14]. Various neurotropic bacteria and viruses use LamR as a receptor to bind host microvascular endothelial cells. Viruses including Sindbis [15], dengue [16], adeno-associated [17], tick-borne encephalitis [18] and Venezuelan equine encephalitis viruses [19] bind LamR. The cytotoxic necrotizing factor toxin (CNF1) of Escherichia coli [20] and the cellular prion protein PrP [21] also interact with LamR. Recently we showed that binding to LamR is a common mechanism employed by S. pneumoniae, N. meningitidis and H. influenzae to adhere to human brain microvascular endothelial cells [22]. The bacterial ligands responsible for LamR binding were identified as pneumococcal CbpA, meningococcal PilQ and PorA and H. influenzae OmpP2 [22]. All are abundant, multi-functional proteins with surface-exposed loop structures. In particular, meningococcal PorA and H. influenzae OmpP2 share many characteristics, despite showing limited sequence similarity. Both are homo-trimeric outer membrane porins with amphipathic β-barrel structures forming sixteen membrane-spanning β-strands separating more variable sequences forming eight surface exposed loops [23], [24]. In the case of OmpP2, most sequence variability occurs in the second, fourth, fifth and eighth loops (known as variable regions 1, 2, 3 and 4, respectively) [25], [26], whereas in PorA most variation occurs in the first, fourth and fifth loops (variable regions 1, 2 and 3, respectively) [27], [28]. Indeed sequence variability of PorA is the basis of the meningococcal subtyping strategy [29], [30], [31]. As immunodominant antigens and targets for serum bactericidal antibodies, PorA and OmpP2 have been studied as potential vaccine targets [32], [33]. However, bactericidal antibodies elicited by such vaccines predominately target the variable extra-cellular loops [23], [27], [34]. Therefore, generating an immune response against one antigen does not generally confer protection against strains with heterologous antigens. Previously, we showed that the highly conserved surface-exposed loop (residues 391EPRNEEK397) linking the second and third anti-parallel α-helices of the R2 domain of pneumococcal CbpA mediated LamR-binding [22]. Here, using recombinant derivatives of PorA and OmpP2, synthetic peptides corresponding to their extracellular loops, and bacterial strains expressing LamR ligands in which specific extracellular loops were deleted, we identify the fourth and second extra-cellular loops of PorA and OmpP2, respectively, as the LamR-binding domains of these proteins.

Results

Amino acids 171–240 of recombinant PorA exhibit LamR-binding activity

To identify the regions of N. meningitidis MC58 PorA that elicit LamR binding activity, recombinant PorA (minus the 19 amino acid cleavable N-terminal signal peptide; PorA20–392) and three sub-fragments of PorA (PorA20–170, PorA20–258 and PorA20–332; Fig. 1A) were expressed and purified. LamR-binding activity of PorA20–170 was significantly reduced compared to PorA20–392 in ELISA assays (Fig. 1B). This suggested that the LamR-binding region was localized between amino acids 171–258. The sub-fragments PorA95–170 and PorA150–258 (Fig. 1A) were subsequently tested in ELISA assays; binding of PorA150–258 was not significantly different from PorA20–392 (Fig. 1C). As expected, PorA95–170 showed significantly reduced LamR-binding when compared to PorA20–392.
Figure 1

Amino acids 171–240 of recombinant PorA exhibit LamR-binding activity.

(A) Schematic showing the recombinant derivatives of N. meningitidis MC58 PorA utilized in this study and a summary of their respective LamR-binding activities. L1–L8 denotes the eight extra-cellular loops based on the model of van der Ley et al. [23]. (B) Binding of LamR to the solid phase antigens PorA20–392, PorA20–170, PorA20–258 and PorA20–332. (C) Binding of LamR to PorA20–392, PorA95–170 and PorA150–258. (D) Binding of LamR to PorA20–392, PorAΔ58–94, PorAΔ125–149 and PorAΔ169–240. Data shown in each panel are means from three independent experiments; in each experiment each sample was tested in triplicate. ** p<0.01 compared to binding with matching PorA20–392 samples. Error bars indicate SEM.

Amino acids 171–240 of recombinant PorA exhibit LamR-binding activity.

(A) Schematic showing the recombinant derivatives of N. meningitidis MC58 PorA utilized in this study and a summary of their respective LamR-binding activities. L1–L8 denotes the eight extra-cellular loops based on the model of van der Ley et al. [23]. (B) Binding of LamR to the solid phase antigens PorA20–392, PorA20–170, PorA20–258 and PorA20–332. (C) Binding of LamR to PorA20–392, PorA95–170 and PorA150–258. (D) Binding of LamR to PorA20–392, PorAΔ58–94, PorAΔ125–149 and PorAΔ169–240. Data shown in each panel are means from three independent experiments; in each experiment each sample was tested in triplicate. ** p<0.01 compared to binding with matching PorA20–392 samples. Error bars indicate SEM. Next, derivatives of PorA20–392 were expressed in which the residues spanning loop 4 were removed (PorAΔ169–240). This derivative showed significantly less LamR-binding activity than PorA20–392 (Fig. 1D). In contrast, control PorA derivatives lacking parts of loops 1 (PorAΔ58–94) or 3 (PorAΔ125–149) exhibited similar LamR binding to PorA20–392, providing additional confirmation that these regions are not required for optimal LamR binding (Fig. 1D). Taken together these results indicated that the LamR-binding domain of MC58 PorA lies within amino acids 171–240 and was likely localized to the fourth extra-cellular loop which comprises amino acids 185–218.

Amino acids 91–99 of recombinant OmpP2 exhibit LamR-binding activity

In a similar approach to that used to identify the LamR-binding region of N. meningitidis MC58 PorA, recombinant H. influenzae Rd KW20 OmpP2 (minus the first 23 N-terminal amino acids; OmpP224–359) and two sub-fragments (OmpP224–225 and OmpP2224–359; Fig. 2A) were expressed and purified. Of the two sub-fragments, OmpP2224–359 showed significantly less LamR-binding compared to OmpP224–359 (Fig. 2B). This suggested that the LamR-binding region was localized between amino acids 24–224.
Figure 2

Amino acids 91–99 of recombinant OmpP2 exhibit LamR-binding activity.

(A) Schematic showing the recombinant derivatives of H. influenzae Rd KW20 OmpP2 utilized in this study and a summary of their respective LamR-binding activities. L1–L8 denotes the eight extra-cellular loops based on the model of Srikumar et al. [24]. (B) Binding of LamR to the solid phase antigens OmpP224–359, OmpP224–225 OmpP2224–359. (C) Binding of LamR to OmpP224–359, OmpP2Δ45–61, OmpP2Δ91–99, OmpP2Δ125–151 and OmpP2Δ177–195. Data shown in each panel are means from three independent experiments; in each experiment each sample was tested in triplicate. ** p<0.01 compared to binding with matching OmpP224–359 samples. Error bars indicate SEM.

Amino acids 91–99 of recombinant OmpP2 exhibit LamR-binding activity.

(A) Schematic showing the recombinant derivatives of H. influenzae Rd KW20 OmpP2 utilized in this study and a summary of their respective LamR-binding activities. L1–L8 denotes the eight extra-cellular loops based on the model of Srikumar et al. [24]. (B) Binding of LamR to the solid phase antigens OmpP224–359, OmpP224–225 OmpP2224–359. (C) Binding of LamR to OmpP224–359, OmpP2Δ45–61, OmpP2Δ91–99, OmpP2Δ125–151 and OmpP2Δ177–195. Data shown in each panel are means from three independent experiments; in each experiment each sample was tested in triplicate. ** p<0.01 compared to binding with matching OmpP224–359 samples. Error bars indicate SEM. We hypothesized that the LamR-binding activity was localized to one of the extra-cellular loops of OmpP2 between amino acids 24–224; four derivatives of OmpP224–359 were expressed and purified in which the residues spanning the apical regions of loops 1, 2, 3 or 4 were removed. The derivative lacking loop 2 (OmpP2Δ91–99) showed significantly less LamR binding activity compared to OmpP224–359 (Fig. 2C), whilst the other derivatives lacking loops 1, 3 or 4 showed no significant reductions in binding. These results indicated that the LamR-binding domain of OmpP2 lies within amino acids 91–99, corresponding to the apical region of the second extra-cellular loop, which comprises amino acids 88–102.

Synthetic peptides corresponding to PorA loop 4 and OmpP2 loop 2 bind LamR and block ligand-LamR binding

Further characterization of the PorA and OmpP2 LamR-binding domains was undertaken using synthetic peptides. Several peptides were synthesized (Table 1): one corresponding to the 9-amino acid apical region of OmpP2 loop 2 (residues 91–99); another corresponding to the 34-amino acids of PorA loop 4 (residues 185–218), which we hypothesized was responsible for PorA-LamR binding; and a third corresponding to PorA loop 1 (residues 31–70) for use as a non-LamR binding control peptide. In addition, scrambled peptides based on OmpP2 loop 2 and PorA loop 4 were also synthesized. Each peptide included additional terminal cysteine residues; under oxidizing conditions cysteine sulfhydryl groups spontaneously form disulfide bonds, thus allowing the peptides to circularize and more closely mimic the native loop structures. PorA loop 1 and the two scrambled peptides (PorA loop 4scr and OmpP2 loop 2scr) bound less than either OmpP2 loop 2 or PorA loop 4 to LamR (Fig. 3A). Furthermore, PorA loop 4, but not PorA loop 1 could block the binding of soluble LamR to the solid-phase ligand PorA20–392 in a dose-dependent manner (Fig. 3B).
Table 1

Synthetic peptides used in this study.

Peptide namePeptide sequence
OmpP2 loop 2 CASENGSDNFC a
OmpP2 loop 2scr CSNGFEDNSAC a
PorA loop 4 CPIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGSC a
PorA loop 4scr CNSNGATGKNPPVVTLKKSVYQSNYTAPYANTILPC a
PorA loop 1 CVEGRNYQLQLTEAQAANGGASGQVKVTKVTKAKSRIRTKIC a
L4_1 PIQNSKSAYT
L4_2 AYTPAYYTKN
L4_3 TKNTNNNLTL
L4_4 LTLVPAVVG
L4_5 PAVVGKPGS

Peptide sequence includes terminal cysteine residues to facilitate disulfide bond formation.

Figure 3

PorA loop 4 and OmpP2 loop 2 peptides bind LamR.

(A) Binding of LamR to OmpP2 loop 2 (labeled L2), OmpP2 loop 2scr (L2scr), PorA loop 4 (L4), PorA loop 4scr (L4scr) or PorA loop 1 (L1) coated ELISA plates. Results shown are means of triplicate wells from a representative example from two independent experiments. (B) Binding of DIG-labeled LamR to PorA20–392 in the presence of 0.5, 10, 50 or 100 µg of peptide corresponding to PorA loop 4 (L4) or loop 1 (L1). The binding of LamR to PorA20–392 in the absence of peptide served as a negative control for inhibition. * p<0.05 compared to binding in the absence of peptide. ** p<0.01 compared to binding in the absence of peptide. Data shown are means from three independent experiments; in each experiment each sample was tested in triplicate. Error bars indicate SEM.

PorA loop 4 and OmpP2 loop 2 peptides bind LamR.

(A) Binding of LamR to OmpP2 loop 2 (labeled L2), OmpP2 loop 2scr (L2scr), PorA loop 4 (L4), PorA loop 4scr (L4scr) or PorA loop 1 (L1) coated ELISA plates. Results shown are means of triplicate wells from a representative example from two independent experiments. (B) Binding of DIG-labeled LamR to PorA20–392 in the presence of 0.5, 10, 50 or 100 µg of peptide corresponding to PorA loop 4 (L4) or loop 1 (L1). The binding of LamR to PorA20–392 in the absence of peptide served as a negative control for inhibition. * p<0.05 compared to binding in the absence of peptide. ** p<0.01 compared to binding in the absence of peptide. Data shown are means from three independent experiments; in each experiment each sample was tested in triplicate. Error bars indicate SEM. Peptide sequence includes terminal cysteine residues to facilitate disulfide bond formation.

Loop 4 residues 192–208 are required for optimal LamR-binding

Experiments were undertaken to further define the region within the 34-amino acid PorA loop 4 required for optimal LamR binding. Five overlapping peptides (L4_1 to L4_5) were synthesized spanning loop 4 (Table 1 & Fig. 4A). The peptides were immobilized in microtitre wells and DIG-labeled LamR added. After washing, bound LamR was detected and quantified (Fig. 4B). As expected, the control non-LamR binding control peptide (loop 1) showed significantly less binding to LamR compared to whole loop 4. Two of the shorter loop 4 peptides (L4_4 and L4_5) showed significantly reduced LamR-binding compared to whole loop 4 (p<0.05), whilst L4_1 showed reduced binding, albeit it not reaching statistical significance (p = 0.069). The highest LamR-binding was exhibited by L4_2 and also L4_3, which correspond to the most apical part of loop 4 and together span PorA192–208 suggesting that the key residue(s) mediating LamR-binding are localized in this region.
Figure 4

LamR binding activity of PorA loop 4 peptides.

(A) Schematic showing the sequence of the overlapping loop 4 peptides (L4_1 to L4_5) and alignment to the MC58 PorA loop 4 sequence (L4). (B) ELISA data showing the binding of LamR to immobilized loop 1 and loop 4 synthetic peptides. Data shown are means from at least three independent experiments; in each experiment each sample was tested in triplicate. * p<0.05 compared to binding of LamR to whole loop 4 (L4). Error bars indicate SEM.

LamR binding activity of PorA loop 4 peptides.

(A) Schematic showing the sequence of the overlapping loop 4 peptides (L4_1 to L4_5) and alignment to the MC58 PorA loop 4 sequence (L4). (B) ELISA data showing the binding of LamR to immobilized loop 1 and loop 4 synthetic peptides. Data shown are means from at least three independent experiments; in each experiment each sample was tested in triplicate. * p<0.05 compared to binding of LamR to whole loop 4 (L4). Error bars indicate SEM.

Deletion of N. meningitidis PorA loop 4 or H. influenzae OmpP2 loop 2 reduces LamR-binding

To determine whether the LamR-binding activity of PorA loop 4 observed using synthetic peptides and recombinant sub-fragments reflect the ability of the protein in situ in the bacterial cell to mediate binding to LamR, a derivative of the N. meningitidis strain MC58 was constructed in which the central 14 amino acids of PorA loop 4 were deleted (MC58PorAΔ197–210). We have previously shown that meningococci have two LamR-binding ligands: PorA and PilQ, and that in the presence of PilQ, deletion of PorA has relatively little effect on observable LamR-binding [22]. Therefore, we introduced a pilQ mutation into the MC58PorAΔ197–210 genetic background to create MC58PorAΔ197–210ΔpilQ to enable us to specifically address the effect of loop 4 truncation on PorA-mediated LamR-binding. Truncating loop 4 did not interfere with expression of PorA or the ability of the protein to correctly localize to the meningococcal outer membrane. Immunoblots of cell fractions confirmed the presence of PorAΔ197–210 at similar levels to wild-type PorA in meningococcal outer membrane-enriched sub-cellular fractions (Fig. 5A). In addition, a mouse monoclonal antibody directed against loop 1 bound to the surface of strains expressing wild-type PorA or PorAΔ197–210 at similar levels as observed by confocal microscopy, but not in strains where porA had been inactivated (Fig. 6). LamR-binding exhibited by MC58PorAΔ197–210ΔpilQ was significantly reduced and similar to the control strain lacking PorA and PilQ (Fig. 7A), thus confirming that the apical region of loop 4 determines PorA-mediated LamR binding by N. meningitidis MC58.
Figure 5

Immunoblots confirm the presence of truncated porins in outer membrane-enriched sub-cellular fractions.

Inner and outer membrane fractions (labeled IM and OM, respectively) of MC58 wild-type, MC58PorAΔ197–210ΔpilQ (labeled Δ197–210) and MC58ΔporAΔpilQ double mutant (labeled ΔPP) (A) or H. influenzae Rd KW20 wild-type, OmpP2Δ91–99 and ΔompP2 (B) were probed with anti-PorA monoclonal antibody or rabbit polyclonal anti-OmpP2, respectively.

Figure 6

Deletion of loop 4 does not affect insertion of PorA into the meningococcal outer membrane.

Immuno-fluorescent images of (A) MC58 wild-type, (B) MC58PorAΔ197–210ΔpilQ or (C) MC58ΔporAΔpilQ. Intact cells of N. meningitidis were probed with FM1-43 membrane stain (upper panels) and anti-meningococcal serosubtype P1.7 monoclonal antibody (centre panels). Merged images (lower panels) depict co-localization of FM1-43 (green) and anti-meningococcal serosubtype P1.7 monoclonal antibody (red), in yellow. Phase images (bottom panels) verify the presence of immuno-targets. Insets shown are at 2.5× field magnification. Scale bar: 5 µm.

Figure 7

Deletion of PorA loop 4 or OmpP2 loop 2 significantly reduces bacterial LamR-binding.

Binding of (A) N. meningitidis MC58, MC58PorAΔ197–210ΔpilQ and MC58ΔporAΔpilQ or (B) H. influenzae Rd KW20, RdOmpP2Δ91–99 or RdΔompP2 to LamR. Specific binding of digoxigenin-labeled bacteria to LamR-coated ELISA plates was determined by subtracting the absorbance in BSA-coated wells from that in LamR-coated wells. Data shown in each panel are means from three independent experiments; in each experiment each sample was tested in triplicate. ** p<0.01 compared to wild-type. Error bars indicate SEM.

Immunoblots confirm the presence of truncated porins in outer membrane-enriched sub-cellular fractions.

Inner and outer membrane fractions (labeled IM and OM, respectively) of MC58 wild-type, MC58PorAΔ197–210ΔpilQ (labeled Δ197–210) and MC58ΔporAΔpilQ double mutant (labeled ΔPP) (A) or H. influenzae Rd KW20 wild-type, OmpP2Δ91–99 and ΔompP2 (B) were probed with anti-PorA monoclonal antibody or rabbit polyclonal anti-OmpP2, respectively.

Deletion of loop 4 does not affect insertion of PorA into the meningococcal outer membrane.

Immuno-fluorescent images of (A) MC58 wild-type, (B) MC58PorAΔ197–210ΔpilQ or (C) MC58ΔporAΔpilQ. Intact cells of N. meningitidis were probed with FM1-43 membrane stain (upper panels) and anti-meningococcal serosubtype P1.7 monoclonal antibody (centre panels). Merged images (lower panels) depict co-localization of FM1-43 (green) and anti-meningococcal serosubtype P1.7 monoclonal antibody (red), in yellow. Phase images (bottom panels) verify the presence of immuno-targets. Insets shown are at 2.5× field magnification. Scale bar: 5 µm.

Deletion of PorA loop 4 or OmpP2 loop 2 significantly reduces bacterial LamR-binding.

Binding of (A) N. meningitidis MC58, MC58PorAΔ197–210ΔpilQ and MC58ΔporAΔpilQ or (B) H. influenzae Rd KW20, RdOmpP2Δ91–99 or RdΔompP2 to LamR. Specific binding of digoxigenin-labeled bacteria to LamR-coated ELISA plates was determined by subtracting the absorbance in BSA-coated wells from that in LamR-coated wells. Data shown in each panel are means from three independent experiments; in each experiment each sample was tested in triplicate. ** p<0.01 compared to wild-type. Error bars indicate SEM. Similarly, we constructed a H. influenzae Rd KW20 derivative in which the amino acids 91–99 were deleted (RdOmpP2Δ91–99). Again, prior to determining the LamR-binding potential of this strain, we first confirmed that truncating loop 2 did not interfere with expression of OmpP2 or the ability of the protein to correctly localize to the H. influenzae outer membrane (Fig. 5B). LamR-binding by RdOmpP2Δ91–99 was significantly reduced compared to the wild-type (p<0.01), albeit the reduction in LamR-binding was not as great as that observed for the control strain lacking OmpP2 (Fig. 7B), perhaps indicating that additional residues of OmpP2 may play a role in optimizing LamR-binding. Control strains with an antibiotic cassette inserted at the porA or ompP2 locus, but no modification to either the porA or ompP2 coding sequence, showed no significant reduction in LamR-binding, thus confirming the direct effect of removing or truncating porA or ompP2 on binding (data not shown). In summary, we have identified the apical regions of the fourth and second extra-cellular loops of meningococcal MC58 PorA and H. influenzae Rd KW20 OmpP2, respectively, as the LamR-binding regions of these bacterial ligands.

Discussion

Several neurotropic pathogens bind to the 37/67-kDa laminin receptor on host microvascular endothelial cells. In particular, this adherence strategy is used by the bacterial pathogens S. pneumoniae, N. meningitidis and H. influenzae [22]. These species target a common carboxy-terminal recognition site on LamR (amino acids 263–282), since antibodies recognizing this sequence or a peptide corresponding to LamR residues 263–282 could inhibit bacterial binding to microvascular endothelial cells [22]. The bacterial ligands required for LamR-binding were subsequently identified as pneumococcal CbpA, meningococcal PilQ and PorA and H. influenzae OmpP2 [22]. Understanding the structural basis for the ability of these ligands to bind LamR could facilitate the design of therapeutic interventions which could prevent or disrupt the interaction and thus engender protection against bacterial meningitis. To this end, we previously investigated the LamR-binding region of CbpA: a secreted protein that acts as a bridging adhesin to human cells [35]. The CbpA LamR-binding region mapped to a highly conserved surface-exposed loop (residues 391EPRNEEK397) linking the second and third anti-parallel α-helices of the R2 domain. Pneumococcal strains which failed to bind LamR were shown to have this region missing from CbpA [22]. Two residues within this region were found to be particularly important for LamR binding; pneumococci expressing a CbpAP392G-R393G derivative showed significantly reduced binding to recombinant LamR and endothelial cells. CbpAP392G-R393G-coated microspheres showed significantly reduced binding to mouse cerebral endothelium compared to those bearing wild-type CbpA [22]. Importantly, in a mouse model of pneumococcal meningitis, strains expressing CbpAP392G-R393G rarely caused meningitis compared to strains expressing wild-type CbpA, thus underlining the in vivo significance of these key residues in the disease process in the mouse model [22]. In this study, we undertook to define the regions of meningococcal PorA and H. influenzae OmpP2 required for LamR-binding. Both are abundant outer membrane trimeric porins that contain multiple surface-exposed loop structures, but lack sequences resembling the CbpA LamR-binding domain. Using sub-fragments of recombinant MC58 PorA and Rd KW20 OmpP2, our results suggest that their LamR-binding domains are localized to amino acids 171–240 and amino acids 91–99 respectively, since derivatives containing these regions bound LamR; in contrast derivatives lacking these regions showed significantly reduced LamR-binding. For both PorA and OmpP2, predicted surface-exposed loops mapped to these LamR-binding regions. The importance of these loops was confirmed using synthetic peptides based on their sequences. Peptides corresponding to either PorA loop 4 or OmpP2 loop 2 bound LamR, whilst scrambled peptides based on these loops or a peptide based on PorA loop 1 bound less well. Additionally, PorA loop 4 could significantly inhibit binding of LamR to full-length PorA in contrast to PorA loop 1. To further refine the region within the 34-amino acid loop 4 required for optimal LamR-interaction, the binding abilities of shorter overlapping peptides spanning the loop were determined. This approach was not undertaken for OmpP2 loop 2, since our data already indicated that optimal binding was dependant on a short 9-amino acid region (residues 91–99) corresponding to the apex of the loop. Likewise for PorA loop 4, the highest LamR-binding was exhibited by short peptides mapping to the loop apex, suggesting that the key residue(s) mediating binding are localized to this region. LamR-binding exhibited by synthetic peptides or ligand sub-fragments purified under non-native conditions might not accurately reflect the ability of native ligands embedded in the Gram negative outer membrane to interact with LamR. We therefore confirmed our findings using H. influenzae and meningococcal LamR-ligands expressed in their in vivo context. H. influenzae Rd KW20 expressing OmpP2 containing a 9-amino acid deletion from the apex of loop 2 showed significantly reduced LamR-binding compared to wild-type. However, LamR-binding was not reduced to the level determined for the H. influenzae ΔompP2 control strain, indicating that residues outside of the deleted region may also have a minor effect to modulate binding. Recent investigations into the role of OmpP2 and its loops in pathogenesis have focused on the ability of the protein and some of its loops (principally loop 7) to activate host signaling cascades (including the mitogen-activated protein kinase cascade) and initiate the innate immune response (inducing the release of TNF-alpha and IL-6) in a variety of human cell types [36], [37], [38], [39]. Here we show that, in addition to the demonstrated role of OmpP2 loop 7 in pathogenesis, loop 2 is also biologically relevant as it largely determines the LamR binding activity of OmpP2. Our analysis of PorA-mediated LamR-binding in the meningococcus was complicated by the presence of PilQ, the second LamR ligand expressed by this organism. Consequently, our LamR-binding experiments were undertaken in pilQ knockout derivatives of MC58 to exclude the effects of this protein. Importantly, N. meningitidis expressing PorA lacking 14-amino acids from the apex of loop 4 exhibited a significant reduction in LamR-binding compared to strains expressing wild-type PorA. In fact, removing these amino acids from PorA in a pilQ knockout background, reduced LamR-binding to levels indistinguishable from that of a pilQ porA double knockout mutant. Importantly, this was not due to the inability of the modified PorA to insert into the meningococcal outer membrane. Based on our data, we conclude that the fourteen amino acids of loop 4 represent the sole LamR-binding domain of PorA in this strain. Further deletions or site-directed mutagenesis of residues in this region of PorA may lead to further refinement of this binding domain. Loop 2 corresponds to variable region 1 of OmpP2 [24]. Thus, antigenic variation at this loop is likely to explain the varying LamR-binding capabilities of H. influenzae isolates reported previously [22]. Similarly, the fourteen amino acid LamR-binding region of PorA corresponds to the VR2 of this antigen. Our identification of VR2 as the LamR-binding of PorA in this study is consistent with previous observations from an experiment in which porA of a meningococcal isolate with a low LamR-binding activity (Z4682) was replaced with porA from MC58 [22]. Strain Z4682 bound LamR at 50% of the level of MC58; following the porA replacement, LamR-binding was increased to 94% of MC58 [22]. The PorA variants (VR1, VR2) of MC58 and Z4682, respectively, are: 7, 16-2 and 7.1, 1 (http://pubmlst.org/neisseria/PorA/). Differences in VR1 sequence between variants 7 and 7.1 are minor, involving the presence/absence of a duplication of two residues. In contrast, the differences in amino acid sequence between VR2 variants 16-2 and 1 are considerable (16-2: YYTKNTNNNLTLVP; 1: YVAVENGVAKKVA). Since VR1 corresponds to loop 1, and VR2 to loop 4, this provided circumstantial evidence linking loop 4, but not loop 1 to differences in LamR-binding ability. Here, using a comprehensive approach involving PorA sub-fragments, synthetic peptides and meningococcal strains expressing PorA in which specific extracellular loops were deleted, we confirm that the fourth extra-cellular loop is the LamR-binding region of this protein. Since over 630 PorA VR2 variants (classified into 20 families) have been identified across meningococcal isolates to date, we suggest that the LamR-binding ability conferred by PorA is variable between strains. In contrast, since PilQ is highly conserved (≥98% identity at amino acid level between genome sequenced meningococcal strains), we hypothesize that PilQ confers a relatively constant LamR-binding capability to strains of different lineages. We are currently determining the LamR-binding domain(s) of PilQ to allow us to investigate this further. Why the meningococcus has evolved to express two LamR-binding ligands, whilst H. influenzae and pneumococcus both express only one is unclear. However, meningococci have previously been reported to express multiple adhesins with overlapping ligand-binding capabilities [40]. Functional redundancy is required to maintain colonization because of the propensity of the organism to phase and/or antigenically vary its surface structures. PorA is one such variable surface structure; in addition to being antigenically variable, PorA expression levels vary between isolates and within a population of the same isolate. This is a result of slipped-strand mispairing at a homopolymeric tract in the porA promoter [41]. In addition, PorA expression may be absent altogether due to: slipped-strand mispairing at a homopolymeric tract within the porA gene [41]; deletion of porA [42]; or via the insertion of an IS element [43]. Whether PilQ expression is varied in similar ways and if so, what the genetic mechanisms governing this variation are, are not currently known. However, we suggest that the meningococcus utilizes two LamR-ligands in order to maintain a degree of LamR-binding capability, irrespective of changes in PorA (or possibly PilQ) expression, during the infection process. Since meningococci are normally commensal organisms inhabiting the nasopharynx, and infection of the meninges represents a relatively rare event that is unlikely to contribute to the dissemination of this accidental pathogen, selective pressure leading to such functional redundancy is likely to be applied at mucosal surfaces and not at the meninges. In summary, we have identified the LamR-binding regions within meningococcal PorA and H. influenzae OmpP2. These regions correspond to the apical regions of the fourth and second extra-cellular loops, respectively. Both loops are hyper-variable, suggestive of the molecular basis for the diverse range of LamR-binding capabilities previously reported for meningococcal and H. influenzae strains of different lineages. Increased knowledge of the structural motifs of bacterial ligands that interact with LamR may facilitate the design of therapeutic interventions which could disrupt or modulate the interaction of neuroinvasive bacteria with LamR and engender protection against bacterial meningitis. However, given that both OmpP2 loop 2 and PorA loop 4 are hyper-variable, this may hinder the design of strategies to block LamR-binding, which are effective against a wide range of pathogenic strains.

Materials and Methods

Bacterial strains and growth conditions

Escherichia coli JM109 was used as the host strain for mutagenic constructs and for expression of 6× histidine-tagged recombinant protein fragments (Table S1). This strain was grown at 37°C in Lysogeny Broth (LB) or on LB agar supplemented, where appropriate, with ampicillin, kanamycin or streptomycin and spectinomycin (all at 100 µg ml−1). N. meningitidis strains were grown at 37°C, in an atmosphere of air plus 5% CO2, on Columbia agar with chocolated horse blood (Oxoid) or in Brain Heart Infusion (BHI) broth (Oxoid) supplemented, where appropriate, with streptomycin and spectinomycin (100 µg ml−1) and/or kanamycin (50 µg ml−1). H. influenzae strains were grown at 37°C, in an atmosphere of air plus 5% CO2, on Columbia agar with chocolated horse blood (Oxoid) or in BHI broth supplemented with haemin (10 µg ml−1) and NAD (10 µg ml−1), and where appropriate, with kanamycin (50 µg ml−1).

DNA manipulation

Chromosomal DNA was purified using the DNeasy Tissue kit (Qiagen). Plasmid DNA was prepared by using the QIAprep Spin kit (Qiagen). Restriction enzymes were purchased from Roche and used according to the manufacturer's instructions. DNA sequencing was carried out on an ABI 377 automated DNA sequencer at the School of Biomedical Sciences (University of Nottingham).

Construction of plasmids encoding PorA sub-fragments

The plasmids encoding PorA20–392, PorA20–170, PorA20–258 and PorA20–332 were obtaining by amplifying porA fragments from N. meningitidis MC58 using a common forward oligonucleotide primer (porA-F1; Table S2) incorporating a BamHI restriction site, and reverse primers porA-R, porA-R1, porA-R2 and porA-R3, respectively, incorporating SalI restriction sites. The resulting amplicons were BamHI/SalI-digested and ligated into BamHI/SalI-digested pQE30 to yield pPorAQE30, pPorA20-170, pPorA20-258 and pPorA20-332, respectively (Table S1). The construct for expression of PorA95–170 was obtained by performing inverse PCR using pPorA20-170 as template DNA. The primers used for this (porA-F2 and porA-R4; Table S2) incorporated BglII restriction sites into the amplicon, allowing re-ligation of the product following appropriate enzymatic treatment to yield pPorA95-170. An identical strategy was used to generate pPorA150-258, but utilizing pPorA20-258 as template DNA and primers porA-F3 and porA-R4 (Table S2). Inverse PCR, using pPorAQE30 as template, was utilized to obtain PorAΔ58–94, PorAΔ125–149 and PorAΔ169–240. The primers pairs used for this: porA-F4/-R5 (PorAΔ58–94), porA-F3/-R6 (PorAΔ125–149) and porA-F5/-R7 (PorAΔ169–240) incorporated BglII restriction sites into the amplicon, allowing re-ligation of the product following BglII treatment to yield pPorAΔ58–94, pPorAΔ125–149 and pPorAΔ169–240, respectively (Table S1).

Construction of plasmids encoding OmpP2 sub-fragments

The plasmid encoding OmpP224–359 was obtaining by amplifying ompP2 from H. influenzae Rd KW20 using primers P2F1 (incorporating a BamHI restriction site; Table S2) and P2R1 (incorporating a SalI restriction site). The resulting amplicon was BamHI/SalI-digested and ligated into BamHI/SalI-digested pQE30 to yield pNJO74 (Table S1). The plasmid encoding OmpP2224–359 was constructed by inverse PCR using pNJO74 as template and P2Δ1-4I_F and P2Δ1-4I_R primers (Table S2). The amplified product was BamHI-digested and then re-ligated to yield pMSA1 (Table S1). The plasmid encoding OmpP224–225 was also constructed by IPCR using pNJO74 as template, but utilizing P2Δ5-8I_F and P2Δ5-8I_R primers (Table S2). The amplified product was SalI-digested and then re-ligated to yield pMSA2 (Table S1). Inverse PCR using pNJO74 as template was also utilized to derive the plasmids encoding OmpP2 lacking loop 1, 2, 3 or 4. Primer pairs utilized were: P2ΔL1I_F and P2ΔL1I_R (loop 1 deletion), P2ΔL2I_F and P2ΔL2I_R (loop 2 deletion), P2ΔL3I_F and P2ΔL3I_R (loop 3 deletion) and P2ΔL4I_F and P2ΔL4I_R (loop 4 deletion; Table S2). These primers incorporated BglII restriction sites into the amplicons, allowing re-ligation of the products following appropriate enzymatic treatment to yield pMSA3, pMSA4, pMSA5 and pMSA6, respectively (Table S1).

Protein expression and purification

Recombinant histidine-tagged LamR was purified as described previously [22]. For the expression of PorA and OmpP2 derivatives, plasmids were transformed into E. coli JM109, cultures grown to exponential phase (OD600>0.5) and induced with isopropyl β-D-1-thiogalactopyranoside (IPTG; 1 mM) for 3 h. Recombinant proteins were then affinity-purified using HisPur™ Cobalt Resin (Pierce) under denaturing conditions using a previously described method [44]. Final column elutes were buffer exchanged into 1× PBS using PD-10 desalting columns (GE Healthcare) according to the manufacturer's instructions.

SDS-PAGE and immunoblotting

Proteins were electrophoretically separated using polyacrylamide gels (Mini-Protean III; Bio-Rad). Proteins were stained using SimplyBlue Safestain™ (Invitrogen) or transferred to nitrocellulose membranes. Membranes were probed with either mouse anti-pentahistidine antibody (Qiagen; 1∶5000 diluted) or mouse monoclonal anti-PorA (NIBSC code: 01/514; 1∶5000 diluted) or rabbit polyclonal anti-OmpP2 (1∶5000 diluted) in blocking buffer (5% [wt/vol] non fat dry milk, 0.1% [vol/vol] Tween 20 in 1× phosphate-buffered saline [PBS]) and incubated for 2 h. After being washed in PBS with 0.1% Tween 20, membranes were incubated for 2 h with 1∶30,000-diluted goat anti-mouse (or anti-rabbit) IgG-alkaline phosphatase conjugate (Sigma) and washed with PBS with 0.1% Tween 20. Immunoblots were developed using BCIP/NBT-Blue liquid substrate (Sigma).

DIG-labeling of proteins and bacteria

DIG-labeling was carried using the Roche DIG-NHS Protein labeling kit, used as per manufacturer's instructions. Briefly, for protein the pH was adjusted to pH 9.0 by addition of 2 M sodium carbonate, and DIG-NHS reagent added in a 1∶10 molar ratio. Reactions were incubated at room temperature for 1 h, and then unbound DIG-NHS was removed using PD-10 desalting columns (GE Healthcare). For bacteria, cells were harvested from an overnight plate, washed 3 times in PBS with 0.05% Tween 20 (PBST) and resuspended in sodium carbonate buffer (150 mM; 142 mM NaHCO3, 8 mM Na2SO3, pH 9.0). Bacteria (optical density at 600 nm = 1.0) were then labeled with 10 µg ml−1 DIG-NHS at room temperature for 30 min. Bacteria were then washed 3 times with PBST and resuspended in PBS containing 1% bovine serum albumin (BSA; Sigma).

Enzyme-linked immunosorbent assays

100 µl aliquots of 5 µg ml−1 protein in sodium carbonate buffer were added to a CovaLink NH microplate (Nalge Nunc International, USA), and incubated at room temperature for 1 h or overnight at 4°C. The plate was washed three times with PBST and blocked with 1% BSA/PBS for 1 h. After removal of the blocking solution, 100 µl of 5 µg ml−1 DIG-labeled protein or DIG-labeled bacteria (OD600 at 0.04) was added and incubated at room temperature for 90 min or at 4°C overnight. Following vigorous washing in PBST (5 washes with 5 min soaking times), 100 µl of anti-DIG HRP conjugate (Roche), diluted 1∶5000 in 1% BSA/PBS, was added to wells and incubated for 1 h. Plates were again vigorously washed and color developed by adding 100 µl ABTS substrate (Roche). Plates were read with an ELISA reader (Biotek EL800) at an absorbance of 405 nm. Alternatively, for unlabelled LamR, 100 µl of protein (5 µg ml−1) was added to coated wells. After washing, bound LamR was detected using rabbit polyclonal anti-LamR (diluted 1∶1000) in 1% BSA/PBS followed by goat anti-rabbit IgG-HRP conjugate (Sigma; diluted 1∶10,000). Inhibition assays were performed as described above, except that 0.5 µg aliquots of DIG-labeled LamR were pre-incubated with 0.5–100 µg of peptide for 4 h at room temperature prior to being added to coated wells. OD values shown are minus OD values obtained from control wells coated with 100 µl aliquots of 1% BSA. Statistical significance was determined using two-tailed Student's t test.

Synthetic peptides

The synthetic PorA and OmpP2 peptides utilized in this study are detailed in Table 1. All were synthesized (high purity grade; peptide purity >95%) by GenScript, USA.

PorA loop 4 truncation in N. meningitidis

A 42-bp deletion in the coding sequence of MC58 porA was introduced into a previously constructed plasmid, pPorA-4d (Table S1), by inverse PCR using primers L4-F1 and L4-R1 (Table S2). Amplification resulted in a product containing the desired deletion and incorporating unique BglII and BamHI sites, thus allowing re-ligation of the fragment to form pPorAΔL4 (Table S1). Inverse PCR using primers L4-F2 and L4-R2 was then used to introduce a BglII site downstream of porA, into which a BglII-digested Ω cassette (encoding resistance to spectinomycin and streptomycin) [45] was inserted to form pPorAΔL4Ω (Table S1). This plasmid was subsequently used to mutate N. meningitidis MC58 by natural transformation and allelic exchange as previously described [46]. The porA loop 4 deletion in the resulting mutant (MC58PorAΔ197–210) was confirmed by PCR analysis and DNA sequencing. Growth curve assays carried out using liquid cultures showed no significant differences between MC58PorAΔ197–210 and the wild-type strain (data not shown). The pilQ knockout mutation was subsequently introduced into this strain to generate MC58PorAΔ197–210ΔpilQ using previously described methods [22].

OmpP2 loop 2 truncation in H. influenzae

A 2.7-kb region containing the ompP2 gene and flanking DNA was amplified from H. influenzae Rd KW20 using primers F1 and mP2_R (Table S2) and TA-cloned into pGEM-T Easy to yield pMSA8 (Table S1). This template was subject to inverse PCR using OmgF and OmgR primers, thus incorporating BamHI restriction sites into the amplicon and a copy of a DNA uptake sequence (5′-AAGTGCGGTCA-3′) which is required for efficient DNA uptake by H. influenzae [47]. The BamHI site was used to introduce a BamHI-digested kanamycin resistance cassette downstream of, and in the same orientation as ompP2, to generate pMSA15. Inverse PCR utilizing primers P2ΔL2I_F and P2ΔL2I_R was subsequently used to remove the nucleotides encoding OmpP2 amino acids 91–99. Use of P2ΔL2I_F and P2ΔL2I_R incorporated BglII-sites into the amplicon, thus allowing re-ligation to form pMSA16. Nucleotide sequencing revealed a single base pair deletion present in the 5′ end of the ompP2 coding sequence in pMSA8 and in subsequent constructs which would lead to premature translation of ompP2 in H. influenzae. To repair this, a 539-bp mega primer spanning the mutated region was amplified from Rd KW20 chromosomal DNA using primers F1 and MegaR (Table S2). The mega primer was then used in conjunction with primer mP2_R using pMSA16 as template to generate a linear repaired mutagenic product comprising of upstream flanking sequence, ompP2 lacking nucleotides encoding loop 2, kanamycin resistance cassette and downstream flanking sequence. This product was used to naturally transform H. influenzae Rd KW20 using a previously described method for the natural transformation of N. meningitidis [46]. The ompP2 loop 2 deletion in the resulting mutant (RdOmpP2Δ91–99) was confirmed by PCR analysis and DNA sequencing. Growth curve assays carried out using liquid cultures showed no significant differences between RdOmpP2Δ91–99 and the wild-type strain (data not shown).

Mutation of OmpP2 in H. influenzae

796-bp of ompP2 was removed from pMSA15 by inverse PCR using primers ΔP2F and P2ΔL2I_R. These primers incorporated BglII-sites allowing re-ligation of the amplicon to form pMSA17 (Table S1). This PCR template was then used in conjunction with primers F1 and P2FR to yield a linear mutagenic PCR product that was used to naturally transform H. influenzae Rd KW20 using a previously described method [46]. The ompP2 deletion in the resulting mutant (RdΔompP2) was confirmed by PCR analysis and DNA sequencing. Growth curve assays carried out using liquid cultures showed no significant differences between RdΔompP2 and the parental strain (data not shown).

Cell fractionation and confocal microscopy

Cell fractionation was undertaken as described previously [48]. For confocal microscopy, growth from overnight cultures was harvested by centrifugation (4000× g for 10 min), resuspended in 1× PBS, and the OD600 adjusted to 1.0. 50 µl aliquots were then added to Knittel adhesive glass slides (SLS) and left at room temperature for 1 h. Bacteria were fixed using 4% paraformaldehyde for 10 min. Slides were washed four times in 1× PBS and then blocked with 1% BSA/PBS for 1 h. Surface-accessible PorA was labeled with mouse anti-meningococcal serosubtype P1.7 monoclonal primary antibody (1∶25 diluted; NIBSC code: 01/514) for 1 h. Following washing in 1× PBS, goat anti-mouse IgG-cascade blue conjugate (1∶800 diluted; Invitrogen) was added for 1 h. Following further washes in 1× PBS, membranes were stained with FM1-43 (10 µM; Invitrogen) in Hank's Balanced Salt Solution (Invitrogen) for 30 min in the dark. Following a final 1× PBS wash, coverslips were mounted with Prolong Gold anti-fade (Invitrogen) and images acquired on a Zeiss LSM700 confocal microscope using a 63× objective. Images are single sections (300 nm) and data was collected from different fluorophores in separate channels. Images were processed using Image J and Adobe Photoshop. Bacterial strains and plasmids. (DOCX) Click here for additional data file. List of primers used in this study. (DOCX) Click here for additional data file.
  47 in total

1.  PorA VR3 Typing Database: a web-based resource for the determination of PorA VR3 alleles of Neisseria meningitidis.

Authors:  Ivano de Filippis; Vivek Gopalan; Yentram Huyen
Journal:  Infect Genet Evol       Date:  2010-08-27       Impact factor: 3.342

2.  Laminin receptor initiates bacterial contact with the blood brain barrier in experimental meningitis models.

Authors:  Carlos J Orihuela; Jafar Mahdavi; Justin Thornton; Beth Mann; Karl G Wooldridge; Noha Abouseada; Neil J Oldfield; Tim Self; Dlawer A A Ala'Aldeen; Elaine I Tuomanen
Journal:  J Clin Invest       Date:  2009-05-11       Impact factor: 14.808

3.  Formation of the 67-kDa laminin receptor by acylation of the precursor.

Authors:  S Butò; E Tagliabue; E Ardini; A Magnifico; C Ghirelli; F van den Brûle; V Castronovo; M I Colnaghi; M E Sobel; S Ménard
Journal:  J Cell Biochem       Date:  1998-06-01       Impact factor: 4.429

4.  Serotype-specific entry of dengue virus into liver cells: identification of the 37-kilodalton/67-kilodalton high-affinity laminin receptor as a dengue virus serotype 1 receptor.

Authors:  Chutima Thepparit; Duncan R Smith
Journal:  J Virol       Date:  2004-11       Impact factor: 5.103

5.  Importance of an immunodominant surface-exposed loop on outer membrane protein P2 of nontypeable Haemophilus influenzae.

Authors:  K Yi; T F Murphy
Journal:  Infect Immun       Date:  1997-01       Impact factor: 3.441

Review 6.  Molecular typing of meningococci: recommendations for target choice and nomenclature.

Authors:  Keith A Jolley; Carina Brehony; Martin C J Maiden
Journal:  FEMS Microbiol Rev       Date:  2006-12-01       Impact factor: 16.408

7.  Maintaining protection against invasive bacteria with protein-polysaccharide conjugate vaccines.

Authors:  Andrew J Pollard; Kirsten P Perrett; Peter C Beverley
Journal:  Nat Rev Immunol       Date:  2009-03       Impact factor: 53.106

8.  Studies of the structure of the metastasis-associated 67 kDa laminin binding protein: fatty acid acylation and evidence supporting dimerization of the 32 kDa gene product to form the mature protein.

Authors:  T H Landowski; E A Dratz; J R Starkey
Journal:  Biochemistry       Date:  1995-09-05       Impact factor: 3.162

9.  Proteomic analysis of human U937 cell line activation mediated by Haemophilus influenzae type b P2 porin and its surface-exposed loop 7.

Authors:  Valeria Severino; Angela Chambery; Mariateresa Vitiello; Marco Cantisani; Stefania Galdiero; Massimiliano Galdiero; Livia Malorni; Antimo Di Maro; Augusto Parente
Journal:  J Proteome Res       Date:  2010-02-05       Impact factor: 4.466

10.  An eleven-base-pair sequence determines the specificity of DNA uptake in Haemophilus transformation.

Authors:  D B Danner; R A Deich; K L Sisco; H O Smith
Journal:  Gene       Date:  1980-11       Impact factor: 3.688

View more
  8 in total

Review 1.  Looking into laminin receptor: critical discussion regarding the non-integrin 37/67-kDa laminin receptor/RPSA protein.

Authors:  Vincent DiGiacomo; Daniel Meruelo
Journal:  Biol Rev Camb Philos Soc       Date:  2015-01-28

Review 2.  Pathogens penetrating the central nervous system: infection pathways and the cellular and molecular mechanisms of invasion.

Authors:  Samantha J Dando; Alan Mackay-Sim; Robert Norton; Bart J Currie; James A St John; Jenny A K Ekberg; Michael Batzloff; Glen C Ulett; Ifor R Beacham
Journal:  Clin Microbiol Rev       Date:  2014-10       Impact factor: 26.132

3.  Broadly protective protein-based pneumococcal vaccine composed of pneumolysin toxoid-CbpA peptide recombinant fusion protein.

Authors:  Beth Mann; Justin Thornton; Richard Heath; Kristin R Wade; Rodney K Tweten; Geli Gao; Karim El Kasmi; John B Jordan; Diana M Mitrea; Richard Kriwacki; Jeff Maisonneuve; Mark Alderson; Elaine I Tuomanen
Journal:  J Infect Dis       Date:  2013-09-16       Impact factor: 5.226

4.  Neisseriae internalization by epithelial cells is enhanced by TLR2 stimulation.

Authors:  Deana N Toussi; Lee M Wetzler; Xiuping Liu; Paola Massari
Journal:  Microbes Infect       Date:  2016-07-01       Impact factor: 2.700

5.  Deciphering the complex three-way interaction between the non-integrin laminin receptor, galectin-3 and Neisseria meningitidis.

Authors:  Fulwah Alqahtani; Jafar Mahdavi; Lee M Wheldon; Matthew Vassey; Necmettin Pirinccioglu; Pierre-Joseph Royer; Suzan M Qarani; Shaun Morroll; Jeroen Stoof; Nicholas D Holliday; Siew Y Teo; Neil J Oldfield; Karl G Wooldridge; Dlawer A A Ala'Aldeen
Journal:  Open Biol       Date:  2014-10       Impact factor: 6.411

6.  Pathogen-inspired drug delivery to the central nervous system.

Authors:  Rebecca L McCall; Joseph Cacaccio; Eileen Wrabel; Mary E Schwartz; Timothy P Coleman; Rachael W Sirianni
Journal:  Tissue Barriers       Date:  2014-08-08

7.  Ribosomal Protein SA-Positive Neutrophil Elicits Stronger Phagocytosis and Neutrophil Extracellular Trap Formation and Subdues Pro-Inflammatory Cytokine Secretion Against Streptococcus suis Serotype 2 Infection.

Authors:  Qiang Sun; Na Li; Li Jia; Wenfei Guo; Hexiang Jiang; Baijun Liu; Chuntong Bao; Mengmeng Liu; Jing Huang; Liancheng Lei
Journal:  Front Immunol       Date:  2021-02-02       Impact factor: 7.561

8.  Identification of the Neuroinvasive Pathogen Host Target, LamR, as an Endothelial Receptor for the Treponema pallidum Adhesin Tp0751.

Authors:  Karen V Lithgow; Brigette Church; Alloysius Gomez; Emily Tsao; Simon Houston; Leigh Anne Swayne; Caroline E Cameron
Journal:  mSphere       Date:  2020-04-01       Impact factor: 4.389

  8 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.