Literature DB >> 20689813

Serodiagnosis of Echinococcus spp. infection: explorative selection of diagnostic antigens by peptide microarray.

Claudia List1, Weihong Qi, Eva Maag, Bruno Gottstein, Norbert Müller, Ingrid Felger.   

Abstract

BACKGROUND: Production of native antigens for serodiagnosis of helminthic infections is laborious and hampered by batch-to-batch variation. For serodiagnosis of echinococcosis, especially cystic disease, most screening tests rely on crude or purified Echinococcus granulosus hydatid cyst fluid. To resolve limitations associated with native antigens in serological tests, the use of standardized and highly pure antigens produced by chemical synthesis offers considerable advantages, provided appropriate diagnostic sensitivity and specificity is achieved. METHODOLOGY/PRINCIPAL
FINDINGS: Making use of the growing collection of genomic and proteomic data, we applied a set of bioinformatic selection criteria to a collection of protein sequences including conceptually translated nucleotide sequence data of two related tapeworms, Echinococcus multilocularis and Echinococcus granulosus. Our approach targeted alpha-helical coiled-coils and intrinsically unstructured regions of parasite proteins potentially exposed to the host immune system. From 6 proteins of E. multilocularis and 5 proteins of E. granulosus, 45 peptides between 24 and 30 amino acids in length were designed. These peptides were chemically synthesized, spotted on microarrays and screened for reactivity with sera from infected humans. Peptides reacting above the cut-off were validated in enzyme-linked immunosorbent assays (ELISA). Peptides identified failed to differentiate between E. multilocularis and E. granulosus infection. The peptide performing best reached 57% sensitivity and 94% specificity. This candidate derived from Echinococcus multilocularis antigen B8/1 and showed strong reactivity to sera from patients infected either with E. multilocularis or E. granulosus.
CONCLUSIONS/SIGNIFICANCE: This study provides proof of principle for the discovery of diagnostically relevant peptides by bioinformatic selection complemented with screening on a high-throughput microarray platform. Our data showed that a single peptide cannot provide sufficient diagnostic sensitivity whereas pooling several peptide antigens improved sensitivity; thus combinations of several peptides may lead the way to new diagnostic tests that replace, or at least complement conventional immunodiagnosis of echinococcosis. Our strategy could prove useful for diagnostic developments in other pathogens.

Entities:  

Mesh:

Substances:

Year:  2010        PMID: 20689813      PMCID: PMC2914747          DOI: 10.1371/journal.pntd.0000771

Source DB:  PubMed          Journal:  PLoS Negl Trop Dis        ISSN: 1935-2727


Introduction

For serodiagnosis of human helminthic infections, many currently used tests rely on native antigens, either extracted from whole worms (somatic antigens) maintained in laboratory animals, or cultivated in vitro to obtain excretory/secretory products (metabolic antigens). These natural antigens are limited in availability and suffer from batch-to-batch variation. A number of Echinococcus proteins have been recombinantly produced and tested for use in serodiagnosis [1]–[6] but to our knowledge, only recombinant EmII/3-10 [7], [8] and its related sequence Em18 [9] are successfully applied in commercial test kits. Recombinantly expressed antigens used in diagnostic tests require a high degree of purification to avoid cross-reactivity due to contaminants from the expression system. Unspecific binding and cross-reactivity are major problems with both, extracts of whole worms [10], [11] and recombinant proteins [12]. For improving diagnostic test performance, it is desirable to identify highly specific and highly reactive epitopes from the proteome of the pathogen in question and synthetically produce the corresponding peptide antigens. Synthetic peptides are advantageous for diagnostic applications since they are well defined, easily produced in large amounts, highly pure and often cost-saving if compared to the production of natural antigen in animal models or in vitro culture. Applications of peptides in immunodiagnosis of different parasitic diseases were given by Noya et al. [13]. The availability of an increasing number of pathogen genomes is boosting basic research as well as applied science. In the field of parasitological diagnostics, sequencing of parasites genomes also creates new opportunities. Annotated genomes and proteomes are available for some of the medically important protozoan pathogens, such as Plasmodium species and some Kinetoplastida species. Following the genome of the parasitic nematode Brugia malayi [14], the genome of Schistosoma mansoni, a blood vessel dwelling trematode, has recently been released [15] as well as a draft genomic sequence for Schistosoma japonicum [16] and more genome data from various helminth species are to be expected in the near future (see for example http://www.sanger.ac.uk/Projects/Helminths/ or http://www.nematode.net/). Currently, proteins predicted from ESTs, whole genomes or contigs are available for data mining already from a considerable number of helminth species. Using the sequence data available in the public domain, we have designed and tested a pathway for identifying novel antigens for serodiagnostic test development. Our selection procedure for peptide antigens relied on the application of bioinformatic filters to collections of protein sequences, including conceptually translated nucleotide sequence data. The selection criteria aimed at proteins located to the host-parasite interface. Such proteins are potentially seen by the host immune system and may elicit an immune response and thus represent good candidates of diagnostic antigens. Our in silico analysis therefore prioritized proteins containing a sorting signal directing the protein to the extracellular space (PSORT II [17]), transmembrane domains (TMHMM II [18]), or a C-terminal signature sequence for addition of glycosyl phosphatidylinositol (GPI) anchor (GPI-som [19]). These prediction algorithms require full length amino acid sequences with complete N- and C-termini, thus excluding the use of most EST libraries. The majority of proteins generally display well defined three dimensional structures, which is mostly globular. Our selection procedure preferred sequences in which the chemically synthesized peptide also adopts a natural conformation in vitro. There are two structural motifs meeting this claim. Firstly, the intrinsically unstructured regions (IUR) that lack a well defined three dimensional structure displaying an extended conformation that can be identified for example by IUPred [20]. Secondly the alpha-helical coiled-coil motif predicted for example by Paircoil2 [21]. Alpha-helical coiled-coils are believed to readily fold into a stable structure in aqueous solution [22]. A microarray platform served for testing the diagnostic potential of the peptides selected in silico. Using a high-throughput microarray format brings together the advantages of low reagent consumption and rapid multiplexed analysis. Particularly in diagnostics, the possibility of testing the reactivity of a given serum sample with multiple antigens simultaneously harbors great benefits. Promising candidates identified on microarray were further explored and validated for use in ELISA. We have carried out the proof-of-principle for bioinformatic selection of suitable long synthetic peptides (LSPs) for the tapeworms Echinococcus multilocularis and Echinococcus granulosus, both of major medical importance causing alveolar (AE) and cystic echinococcosis (CE), respectively. CE and particularly AE, due to its infiltrative and/or space-occupying growth, are severe diseases with high fatality rate and poor prognosis if managed incorrectly [23]. The importance of alveolar echinococcosis is not represented by the number of reported cases but rather by the severity of the disease in the individual patient [24]. Standard diagnostic tests for human echinococcosis, AE as well as CE, imply imaging techniques such as ultrasonography, x-ray and computer tomography, as well as serological tests based on enzyme-linked immunosorbent assay (ELISA) and immunoblots [25]. Antigens used in these serodiagnostic tests were developed from crude extracts to purified fractions to recombinant antigens and for E. multilocularis to vesicular fluid originating from in vitro cultivated metacestodes [26]. Despite substantial improvements have been achieved, the main screening test still relies on the availability and quality of native antigens, i.e. hydatid fluid of Echinococcus granulosus cysts collected from naturally infected intermediate hosts at the slaughterhouse. One study reported that source and quality or fertility of cysts are critical for test outcome. This called for standardization of antigens and test methods [10]. To produce a robust and reproducible test for the routine diagnostic laboratory, we have evaluated the performance of chemically synthesized peptides in comparison to natural (EgHF, EM2) [26], [27] and recombinant antigen (EmII/3-10) [7].

Materials and Methods

Ethics statement

Ethical clearance for retrospective use of anonymized patient sera for test development and quality control was obtained from the ethical committee (Ethikkommission beider Basel).

Human serum samples

Sera of healthy blood donors living in Switzerland were used to define a cut-off for distinguishing between positive and negative test results. In ELISA, 50 blood donor sera were used. In microarray, a single serum and 2 pools made of 5 sera each were used. For testing diagnostic peptide reactivity in ELISA, 44 sera from E. multilocularis- and 35 sera from E. granulosus-infected patients from Central Europe were used. All echinococcosis patients had active hepatic lesions of either CE1 or CE2 type (WHO-IWGE standardized classification) and all sera were sampled prior to any therapeutic intervention, i.e. before surgery and/or chemotherapy. Diagnoses were confirmed serologically as described by Müller et al. [26], in complementation to the clinical diagnosis based on imaging procedures and, if available, retrospective histopathological investigations. For testing cross-reactivity of the peptides, sera from patients with following infections were used (concomitant echinococcosis was ruled out by clinical and serological criteria): 2 trichinellosis, 2 trichuriasis, 10 toxocariasis, 8 ascariasis, 1 anisakiasis, 2 hookworm infection, 8 strongyloidiasis, 10 filariasis (Loa loa, Mansonella perstans, Onchocerca volvulus), 10 fascioliasis, 1 paragonimiasis, 11 schistosomiasis (Schistosoma mansoni, S. haematobium, S. mekongi), 12 neurocysticercosis (Taenia solium), 1 taeniasis (Taenia saginata), 1 diphyllobothriasis and 26 amoebic liver abscess (Entamoeba histolytica).

Sequence selection and peptide design

Protein sequences of Echinococcus multilocularis and E. granulosus were retrieved from NCBI Entrez Protein Database on October 16, 2007. NCBI Entrez Protein Database are compiled from a variety of sources with daily updates, including SwissProt, PIR, PRF, PDB, and translations from annotated coding regions in GenBank and RefSeq. To identify putative membrane or extracellular proteins, the protein sequences were analyzed using TMHMM II [18] for prediction of transmembrane domains, GPI-SOM [19] for prediction of glycosylphosphatidylinisotol (GPI) anchor signals, and PSORT II [17] for prediction of protein subcellular localization. All protein sequences were further screened for stretches of alpha-helical coiled-coils using Paircoil2 [21] and intrinsically unstructured regions using IUPred [20]. Both of these structures are believed to adopt native conformation in aqueous solution and therefore constitute major selection criteria. Due to the limited number of Echinococcus sequences in NCBI Entrez Protein Database and few predicted surface proteins containing stretches of alpha-helical CC and/or IURs, the analysis was extended to all proteins with alpha-helical coiled-coil and IUR predictions, irrespective of their predicted locations. This included known proteins previously tested in immunodiagnosis. To narrow down protein regions for selection of 30mer peptides, protein sequences were subjected to prediction of coiled-coil stability by STABLECOIL (http://biomol.uchsc.edu/cores/biophysics/stablecoil). In case of IURs antigenicity predictions were performed using BepiPred [28]. Thus detected regions of high predicted CC stability or antigenicity were favored. To increase solubility, peptides were selected to start and end with a hydrophilic or neutral amino acid and to harbour on average one charged amino acid, either positive or negative, per five residues. In addition, the guidelines suggested by the manufacturer were followed (http://www.altabioscience.bham.ac.uk/pdfs/Intro_to_series_SYNTHETIC_PEPTIDES.pdf). From 11 sequences listed in table S1, 45 peptides were selected according to the criteria mentioned above. Peptides were produced by Fmoc solid phase synthesis (Alta Bioscience, University of Birmingham, UK). The length of the peptides was limited by the EpiScan synthesis procedure (Alta Bioscience, University of Birmingham, UK) to a maximum of 30 amino acids. Thus the length of the peptides used for spotting onto microarrays ranged between 24 and 30 amino acids with an additional aminohexanoid acid (AHX) spacer and a biotin at the N-terminus. Biotin was required to bind peptides to a streptavidin-coated solid phase, i.e. microscope glass slide for microarrays (Alta Bioscience, University of Birmingham, UK) or to 96 well plates for ELISA. In order to remove electric charges from the free C-terminus, the synthetic peptides were modified by carboxy-terminal amidation. Thus, both N-terminal and C-terminal peptide ends were uncharged, mimicking natural segments of internal protein sequences. For defining optimal peptide length, we designed extended variants of the 8 most reactive candidates from the microarray. The length of extended peptides ranged between 40 and 47 residues (table 1). Modifications at the N- and C-terminus were identical to those of the microarray peptides. The extension of peptides was chosen to increase alpha-helical coiled-coil stability or to combine epitopes from two single peptides. To target these improved peptides to E. multilocularis diagnosis, we chose the E. multilocularis sequences for designing longer peptides. Sequences derived from antigen B8/1 (accession number BAC77657) and antigen B8/2 (accession number BAD89809). To our knowledge, these were the first synthetic peptides from any E. multilocularis antigen B sequence that were serologically evaluated. Alignments of homologous antigen B8/1- and antigen B8/2-sequences of the two Echinococcus species are shown in figures S1 and S2, respectively. Antigen B8/1-sequences of E. granulosus and E. multilocularis showed 86% identity and antigen B8/2-sequences 93% identity. Peptide longD8-9 coincided with the region of a previously published E. granulosus epitope EVKYFFER [29], but differed from another published synthetic peptide p176 [30]: p176 spans the N-terminal region of antigen B8/1 (amino acids 17–54), while longD8-9 covered the central part of the protein (amino acids 33–74). Within the overlap of 26 amino acids, three amino acids differed.
Table 1

Original and extended peptides of the 8 most reactive candidates from microarray.

ProteinAccession numberMicroarray peptideLengthAccession numberExtended peptideLengthPeptide sequence
EmII/3AAA50580D129AAA50580longD143EQKLRELRAQMVEKESDLADMKNKASAYESKIAELEMLLQQER
EmII/3AAA50580D1225AAA50580longD1240DEVQREVEAQKVAMAKKEAEKAQAEAELRRMREKHDAKHK
AgB8/1AAD38373D8, D929BAC77657longD8-942KMLGEMKYFFERDPLGQKLVDLLKELEEVFQMLRKKLRTALK
AgB8/2AAC47169D1127BAD89809longD1145DPLGQRLVALGNDLTAICQKLQLKIREVLKKYVKNLVEEKDDDSK
EM13Q07840A929Q07840longA945QVQNAKNEPFGTPEQLRKIEDKLRKGIMEEEKTRKAYEEALSSLS
PSCCP* CAD44854B625CAD44854longB647ETIQSLCEHNAALQQKLDEANQSVTEVSVQMKVMQQHLHTARVAIQS
EG19ABI24154D327ABI24154longD342EAEAKCLRRPHQRVVKEGEVSKGDEVDGEDRDDECVGGDEGR

*PSCCP: protoscolex-specific coiled-coil protein.

*PSCCP: protoscolex-specific coiled-coil protein.

Microarray

A microarray platform was used for screening in silico selected peptides for reactivity with patients' sera. The low-density peptide microarray (Alta Bioscience, University of Birmingham, UK) featured two blocks, each containing 45 Echinococcus peptide spots, a spotting control allowing positioning of grid for analysis (unrelated, TAMRA-labeled peptide), a control for serological detection (human IgG) and a blank (spotting solution). All microarray work was done at room temperature. Microarray slides were blocked for one hour in assay buffer (1×PBS pH 7.4, 0.05% Tween20, 3% milk powder). Individual human sera or serum pools were diluted 1∶50 in assay buffer and incubated for two hours in a moist chamber. Slides were washed for 3×5 minutes in assay buffer and incubated for one hour with a 1∶100 dilution of Cy5-labeled goat anti-human IgG (H+L) secondary antibody (Jackson ImmunoResearch Laboratories product number 109-175-088). Slides were washed for 3×5 minutes in assay buffer and quickly rinsed with deionized water before drying with compressed air. Slides were scanned at 532 and 635 nm using a GenePix 4100A microarray scanner (Bucher Biotec AG, Basel, Switzerland). Cy5 and TAMRA images and local background corrected fluorescence intensities (FI) were acquired using the Axon GenePix Pro 6.0 software. Further analysis was done in Microsoft Excel. Duplicate FI-values were averaged. Peptides were determined reactive if FI>1009. This cut-off was determined by testing single or pooled blood donor samples (pools made of 5 sera each), calculating average FI intensities plus 4 times the standard deviation. We chose 4 standard deviations rather than 3 because the majority of duplicate values differed in more than 20% from each other. This variation can be explained by unequal spot morphology. Peptides from reactive spots were forwarded to evaluation of test sensitivity and specificity performed by ELISA, the current standard format of routine serodiagnostics.

ELISA

96-well plates (NUNC Immobilizer Streptavidin) were pre-washed three times using an ELISA plate washer (deionized H2O, 0.05% Tween20) and coated overnight at 4°C with 100 µl/well of synthetic peptide diluted to 2 µg ml−1 in PBS pH 7.4. All following steps were carried out at room temperature. After washing, the plates were blocked for one hour with 150 µl/well of assay buffer (3% milk in PBS pH 7.4, 0.05% Tween20, 0.5 mM biotin). The plates were washed and incubated for one hour with human sera diluted 1∶200 in assay buffer (100 µl/well). Alkaline-phosphatase-conjugated goat anti-human IgG antibodies (Sigma product number A 3187) 1∶1000 in assay buffer were used as secondary antibodies. After washing, 100 µl of conjugate dilution was added to each well and incubated for one hour, followed by a final wash. Wells were then incubated for 15 minutes with 100 µl of p-nitrophenyl phosphate (Sigma product number N 4645) at a concentration of 1 mg ml−1 in substrate buffer (13.2 mM Na2CO3, 35 mM NaHCO3, 1mM MgCl2×6H2O, pH 9.6). Absorbance values (A405nm) were measured at 405 nm in a Tecan Sunrise microplate absorbance reader. All serum samples were tested in duplicates. The two values were averaged and blank-corrected. For distinguishing between positive and negative ELISA test results, 50 sera from healthy blood donors living in Switzerland were tested. The cut-off value was determined by the mean of the blood donor samples plus two standard deviations. Sensitivity and specificity of the single peptide candidates were calculated using test results from confirmed echinococcosis patients as true positives (TP). Blood donors and individuals infected by other helminths were taken as true negatives (TN). The working characteristics of the peptide antigens were explored by receiver-operating characteristics (ROC) plot analysis (Analyse-It, version 2.21). To test the impact of pooling peptide candidates, LSP longD12, longD1 and longD8-9 were mixed in equal parts (mixW) and applied at the same conditions as described above. The cut-off was determined by the mean A405nm of fifty blood donor samples plus 2 standard deviations. Sensitivity and cross-reactive behavior was tested with 30 echinococcosis sera and 15 sera from various helminth and amoeba infections that had previously shown cross-reactivity with the single peptides.

Results

Peptide selection

240 entries of E. multilocularis and 940 entries of E. granulosus proteins were retrieved from NCBI Entrez Protein Database including redundancies. Combining the outputs of PSORT II, TMHMM II, GPI-som, IUPred and Paircoil2, led to the selection of 11 protein candidates (table S1). According to the information available in GenBank, these proteins were isolated from metacestode or protoscolex tissue, with the possible exception of HSP70, for which no information on developmental stage was provided. Six proteins had been reported previously to react with antibodies from patients' sera: EmII/3 [7], EM13 [6], P-29 [31], GRP [32], EG19 [33], AgB8/1 and AgB8/2 [1]. These earlier findings supported the inclusion of these antigens in our analysis. In total, 45 peptide sequences from 11 proteins were chosen to be chemically synthesized and spotted onto microarray. 31 peptides derived from E. multilocularis and 14 from E. granulosus (table S1).

Screening by peptide microarray

In silico selected peptides were screened for diagnostic potential on a microarray platform (Alta Bioscience, University of Birmingham, UK). From a total of 45 peptides contained in the microarray, 17 showed reactivity with pooled or single sera from echinococcosis patients (8/31 peptides from E. multilocularis, 9/14 peptides from E. granulosus). The peptides that reacted above the cut-off determined from blood donor sera (FI>1009) are listed in table 2. These 17 peptides were considered to have diagnostic potential and were therefore subjected to further testing of specificity and sensitivity. The predicted structure of the reactive peptide candidates was mostly alpha-helical coiled-coil (7 peptides) and alpha-helical (7 peptides). 3 peptides were predicted to be intrinsically unstructured.
Table 2

Peptides with diagnostic potential identified on microarray.

E.m. E.m. E.m. E.m. E.m. E.m. E.m. E.m. E.g. E.g. E.g. E.g. E.g. E.g. E.g. E.g. E.g.
Proteina)a)a)b)b)b)c)c)d)d)e)e)f)f)f)g)g)
Peptide nameA8A9A10A4A5D12B6B9C10D2D3D5D7D8D9D10D11
StructurehelicalhelicalIURCCCCCCCCCChelicalhelicalIURIURhelicalhelicalhelicalhelicalCC
Em-pool-111000110010111000
Em-pool-200000000000000000
Em-pool-300001000000011000
Em-pool-4* 11100111001001001
Eg-pool-100000000000011011
Em-301000000000000000
Em-1101000000000001000
Em-1200000000001000000
Em-2300000000001001001
Em-2400000100000000000
Em-200000000000000000
Em-1501000100000010101
Em-1800000000100010000
Em-3400000000000000000
Em-3500010000000010000

*Data incorporates merged results from repeated assays.

a) EM13 (accession Q07840); b) EmII/3 (accession AAA50580); c) Protoscolex specific coiled-coil protein (accession CAD44854); d) HSP70 (accession Q24789); e) EG19 (accession ABI24154); f) Antigen B8/1 (accession AAD38373); g) Antigen B8/2 (accession AAC47169).

1 = positive.

0 = neative.

Em = AE serum.

Eg = CE serum.

*Data incorporates merged results from repeated assays. a) EM13 (accession Q07840); b) EmII/3 (accession AAA50580); c) Protoscolex specific coiled-coil protein (accession CAD44854); d) HSP70 (accession Q24789); e) EG19 (accession ABI24154); f) Antigen B8/1 (accession AAD38373); g) Antigen B8/2 (accession AAC47169). 1 = positive. 0 = neative. Em = AE serum. Eg = CE serum.

Assessing peptide performance in ELISA

The 17 peptides reactive on microarray were carried forward for evaluating their application in ELISA-based serodiagnosis, the current routine technique. Test sera from AE and CE patients and sera from patients with infections other than echinococcosis were used. Sensitivity, cross-reactivity and impact of peptide length were evaluated (data not shown). With respect to sensitivity, long peptides (more than 30 residues) were superior to shorter ones. 3 out of 17 peptides were selected for extensive validation: longD12 (deriving from E. multilocularis EmII/3-10), longD1 (EmII/3-10) and longD8-9 (E. multilocularis antigen B8/1). All 3 peptides did not clearly differentiate between AE and CE infections as can be seen by overlapping standard deviations of A405nm values obtained from AE and CE sera (figure 1). Peptides longD1 and longD12 derived from EmII/3-10, a well established antigen specific for the diagnosis of E. multilocularis infections [8]. In our hands, longD12 reacted with both, AE and CE sera (table 3: AE 10/44; CE 3/35). This contrasts with previous observations of a specific reactivity of EmII/3-10 with AE sera. The reactivity of peptide longD1 was similar to longD12 (AE: 11/44; CE: 2/35). Peptide longD8-9 (E. multilocularis antigen B8/1) reacted with more CE than AE sera (AE: 19/44; CE: 26/35) (table 3).
Figure 1

No clear discrimination of A405nm values measured from alveolar echinococcosis (AE) and cystic echinococcosis (CE) sera.

Following peptides served as antigens: 1A) longD8-9, cut-off 0.165. 1B) longD1, cut-off 0.200. 1C) longD12, cut-off 0.357. Bars represent mean and standard deviation. ▴ Alveolar echinococcosis (AE); □ Cystic echinococcosis (CE).

Table 3

Numbers of sera tested positive with peptides longD12, longD1 and longD8-9.

PeptidelongD8-9longD1longD12Cumulative result
Cut-off A405nm 0.1650.2000.357
Total testedPositivePositivePositivePositive
HealthyBlood donors5044411
CestodaAE4419111028
CE35262327
Taeniasis10000
Cysticercosis121001
Diphyllobotriasis10000
NematodaTrichinellosis20000
Trichuriasis20000
Anisakiasis10000
Hookworm10000
Strongyloidiasis81212
Toxocariasis100112
Filariasis100101
Ascariasis80000
TrematodaParagonimiasis10000
Fascioliasis100101
Schistosomiasis101325
ProtozoaAmoebiasis263438

No clear discrimination of A405nm values measured from alveolar echinococcosis (AE) and cystic echinococcosis (CE) sera.

Following peptides served as antigens: 1A) longD8-9, cut-off 0.165. 1B) longD1, cut-off 0.200. 1C) longD12, cut-off 0.357. Bars represent mean and standard deviation. ▴ Alveolar echinococcosis (AE); □ Cystic echinococcosis (CE). The cut-off values determined from 50 blood donors were similar for longD8-9 and longD1 with 0.165 and 0.200, respectively. The cut-off for longD12 was higher with an OD of 0.357. Compared to 90% sensitivity of a commercial E. granulosus hydatid fluid ELISA used in routine testing [34], the sensitivity of each single peptide alone was rather low, candidate longD8-9 being the most sensitive with 57%. LongD1 and longD12 both reached 16%. The specificities of longD8-9, longD1 and longD12 were 94%, 91% and 94% respectively, thus performing in the range required for a routine diagnostic assay. There were minor cross-reactivities observed with sera from helminth infections other than echinococcosis (table 3). Peptide longD8-9 was positive with 1/12 cysticercosis, 1/8 strongyloidiasis and 1/10 schistosomiasis sera. Peptide longD1 was seropositive with 2/8 strongyloidiasis, 1/10 toxocariasis, 1/10 filariasis, 1/10 fascioliasis and 3/10 schistosomiasis sera. Peptide longD12 was positive with 1/8 strongyloidiasis, 1/10 toxocariasis, 2/10 schistosomiasis sera. Cross-reactions with Taenia, Strongyloides and filaria are also seen in conventional diagnostic assays. We further tested the specificity with sera from patients suffering from liver abscess due to Entamoeba histolytica infection. LongD12 was positive with 3/26, longD1 with 4/26 and longD8-9 with 3/26 amebiasis sera (table 3). To compare the diagnostic performance of each peptide, a receiver-operating characteristics (ROC) plot was generated (figure 2). Candidate longD8-9 emerged as clear favorite, although on its own not meeting the sensitivity required for antigens applied in routine diagnostics.
Figure 2

ROC plot illustrating sensitivity and specificity of LSP longD12, longD1, longD8-9.

Diagonal line (orange): No discrimination; Square (green): longD8-9; Triangle (dark blue): longD1; Circle (light blue): longD12.

ROC plot illustrating sensitivity and specificity of LSP longD12, longD1, longD8-9.

Diagonal line (orange): No discrimination; Square (green): longD8-9; Triangle (dark blue): longD1; Circle (light blue): longD12. The use of 30–50mer peptides for serology impairs sensitivity compared to the full length antigen, because peptides likely harbor less epitopes. We calculated the cumulative sensitivity of the 3 single peptide ELISAs and measured the experimental combination of the 3 peptides in one antigen mix (mixW). The cut-off of mixW was 0.352, which is in the same range as the cut-off of one of its components, namely longD12. By cumulating the individual results of the 3 assays, the theoretical sensitivity indeed increased from 57% to 70%, but specificity decreased to 82% (table 4). Compared to cumulative positivity, pooling the 3 peptides in one well (mixW) led to a loss of positive test results. In return, the specificity increased due to a loss of cross-reactions. Positive test results obtained by single peptide ELISAs compared to pooled peptide ELISA are summarized in table 5.
Table 4

Sensitivity and specificity of peptides longD12, longD1 and longD8-9.

Peptidetotal AE+CETPFNTNFPSensitivitySpecificity
longD8-9794534120757%94%
longD17913661151216%91%
longD12791366127816%94%
cummulative7955241042370%82%

TP = true positive, FN = false negative, TN = true negative, FP = false positive.

Table 5

Comparison of positivity achieved by single peptides, cumulative results of single peptides and peptide pool mixW.

longD8-9longD1longD12cumulative resultmixW
Em-111011
Em-510010
Em-911011
Em-1411011
Em-2710011
Em-3100110
Em-3801011
Em-3910111
Em-4010010
Em-4111011
Em-4201011
Em-4410011
Em-4501111
Em-4700111
Em-5310011
Eg-110111
Eg-210010
Eg-310010
Eg-1110011
Eg-1200000
Eg-1310010
Eg-1411011
Eg-2210011
Eg-2410010
Eg-2510111
Eg-2810011
Eg-2910011
Eg-3110011
Eg-3210011
Eg-3401010
N-711111
N-2400111
N-2501010
N-3500000
T-1500000
T-1600111
T-1711010
T-2001010
C-1010010
C-1200000
C-1400000
A-401111
A-2310010
A-2410011
A-2600111

1 = positive.

0 = negative.

Em = E. multilocularis infection.

Eg = E. granulosus infection.

N = nematoda infection.

C = cestoda infection.

T = trematoda infection.

A = amoeba infection.

TP = true positive, FN = false negative, TN = true negative, FP = false positive. 1 = positive. 0 = negative. Em = E. multilocularis infection. Eg = E. granulosus infection. N = nematoda infection. C = cestoda infection. T = trematoda infection. A = amoeba infection.

Discussion

The use of synthetic peptides as substitutes of native antigen in immunoassays has been highly recommended for the diagnosis of infectious diseases by different authors [13], [30], [35]. Synthetic peptides are applied successfully in diagnosis of viral and bacterial infections [36]–[39]. Compared to a metazoan parasite, viruses and bacteria in general have smaller genomes and accomplish less complex post translational protein modifications, which might imply more rapid success in identification of immunodominant peptides. It even allows for analysis on whole proteome level [40]. Here, we investigated the use of synthetic peptides of 30–50 amino acids in length for the use in immunodiagnosis of human hydatid disease. We provided proof of principle for the selection of synthetic peptides by bioinformatic means and for screening on a microarray platform for diagnostic reactivity. 17 out of 45 peptides on the microarray proofed reactive with sera from echinococcosis patients. The peptide performing best in our investigation was longD8-9, a 42mer peptide deriving from E. multilocularis antigen B8/1. It reached a sensitivity of 57% and a specificity of 94%. The reactivity of LSP longD8-9 with sera from AE as well as CE patients suggests its use for both, patient screening as well as for follow-up examinations of treated patients. For the latter purpose, it will be necessary to determine the proportion of patients seroconverting during treatment. The applicability of our peptide antigen for monitoring treatment follow-up samples is ongoing work in our laboratory. Our results confirm previous reports [38], [41] that a test based on a single peptide needs to be complemented by additional peptides to reach a sensitivity comparable to the antigen extract. To compensate for limited sensitivity of individual peptides, we performed ELISAs with combinations of synthetic peptides applied as mixtures for coating. We compared these results to the “cumulative sensitivity”, a theoretical value obtained by summing up the positive results from individual peptide ELISAs for each serum tested. The cumulative result amounted to a theoretical sensitivity of 70%. We did not detect this high sensitivity. In contrast, pooling of 3 peptides in one well led to a loss of positive signals otherwise obtained with individually tested peptides. 8/29 echinococcosis samples were lost through pooling. One reason was suggested by an increased cut-off for pooled peptides. In some sera similar ODs were observed in individual test and in peptides mixtures, but due to increased cut-off for pooled peptides, these sera turned negative. The loss of sensitivity obtained with pooled peptides in mixW could also be due to partial occupation of streptavidin binding sites with less reactive antigen. The same reasons may account for increased specificity. Combination of peptides in one well led to a loss of unwanted cross-reactivity with 5/11 previously false positive signals disappearing. Thus in our study, pooling peptides increased specificity, but lowered sensitivity. In future work peptide mixes might be optimized by combining peptides with equally good diagnostic sensitivity and specificity. In particular, the sensitivity of mixes is likely increased by continuous search for new peptides with improved diagnostic operating characteristics as substitutes for the least reactive candidates. The behaviour of peptide mixtures applied as antigens in ELISA needs further investigation. To select peptides with broad recognition by human echinococcosis patients, our bioinformatic selection aimed at exported or parasite surface exposed antigens. Such proteins are likely to elicit an immune response. A major drawback was the scarce number of full-length Echinococcus spp. protein sequences deposited in public databases. Thus it might be worthwhile for further studies to adapt the bioinformatic selection criteria to the use of partial EST sequences. Our data points out the need for screening more peptide candidates. Further investigations on whole genome level are likely to provide additional candidates with sufficient sensitivity and specificity, which can eventually be combined to a synthetic antigen pool. Single or pooled LSPs are compatible with high throughput platform technologies such as luminex or biacore technology that could replace ELISA in the future. Additionally to surface or extracellular localization, one criterion during bioinformatic selection was prediction of secondary structures. Alpha-helical coiled-coils and intrinsically unstructured proteins are believed to adopt native conformation in aqueous solution and might therefore be well suited for immunoassays. It is widely accepted that the majority of epitopes are of the conformational type [42]. Our results showed that for diagnostic purposes the predicted alpha-helical and alpha-helical coiled-coil peptides were superior to peptides deriving from intrinsically unstructured regions. Among the serum-reactive peptides identified by microarray screening, 14 peptides were of predicted alpha-helical organization, while only 3 peptides derived from intrinsically unstructured regions. Furthermore, during our extensive testing of candidates, all IUR peptides were dismissed due to lack of sensitivity. In addition to the secondary and tertiary structure of a peptide, a further determinant for recognition is the immobilization of peptides to the solid phase used in an immunodiagnostic test. Antibody capture by peptides crucially depends on the accessibility of key residues and therefore the introduction of a spacer molecule to spatially separate the peptide from its carrier protein is vitally important [43]. The peptides in our study were synthesized with an N-terminal AHX-spacer coupled to biotin. The biotin was used to immobilize the peptide antigen to a streptavidin-coated solid phase, i.e. microscope glass slides and 96-well ELISA plates. Coating the biotinylated peptides to non-streptavidin surfaces such as Immulon 2HB (Thermo Scientific) or Poly Sorp (NUNC) ELISA plates, led in those samples tested to discrepancies of duplicate values and mostly reduced A405nm values, in a non-linear manner (data not shown). Immobilization of peptides by direct adsorbance to the polystyrene surface might lead to sterical blockage of key residues necessary for interaction with antibodies and thus decrease the A405nm values. Similarly, HIV-1 peptides showed in ELISA increased test sensitivity and specificity when immobilized via biotin-streptavidin [44]. Surfaces functionalized with streptavidin guarantee a directional, highly dense and reproducible coating of biotinylated peptide antigens. It has been shown that the direction of peptide immobilization is of secondary importance as long as peptides deriving from internal protein sequences are investigated [43]. Interactions of internal sequences do not depend on free N- or C-terminus and therefore attachment of spacer and carrier molecules can be achieved successfully at both termini of the peptide. Our approach represents an alternative to peptide selection by phage display [45], [46]. The bioinformatic selection avoids construction and handling of phage display libraries and panning procedures. The most important limitation to successful panning consists in the lack of selective antibodies. Antibody purification from human sera requires pure and specific antigen, which generally is not yet available. Our bioinformatic approach to peptide selection reduces complex lab work and is compatible with screening on peptide microarray. In our hands, this platform proved highly suitable for investigation of antigen-antibody interaction. Alignment of E. granulosus and E. multilocularis antigenB8/1 sequences with location of peptide D8, D9 and longD8-9. (0.42 MB TIF) Click here for additional data file. Alignment of E. granulosus and E. multilocularis antigenB8/2 sequences with location of D11 and longD11. (0.44 MB TIF) Click here for additional data file. Final set of peptides spotted onto microarray. (0.12 MB DOC) Click here for additional data file.
  44 in total

1.  Predicting transmembrane protein topology with a hidden Markov model: application to complete genomes.

Authors:  A Krogh; B Larsson; G von Heijne; E L Sonnhammer
Journal:  J Mol Biol       Date:  2001-01-19       Impact factor: 5.469

Review 2.  Antigenicity and immunogenicity of synthetic peptides.

Authors:  M H Van Regenmortel
Journal:  Biologicals       Date:  2001 Sep-Dec       Impact factor: 1.856

3.  Partial protection induced by phage library-selected peptides mimicking epitopes of Schistosoma japonicum.

Authors:  Li Ouyang; Xinyuan Yi; Xianfang Zeng; Jinchun Zhou; Qinlin Wang; Larry McReynolds
Journal:  Chin Med J (Engl)       Date:  2003-01       Impact factor: 2.628

4.  Immunodiagnosis of human neurocysticercosis using a synthetic peptide selected by phage-display.

Authors:  R C R Hell; P Amim; H M de Andrade; R A M de Avila; L Felicori; A G Oliveira; C A Oliveira; E Nascimento; C A P Tavares; C Granier; C Chávez-Olórtegui
Journal:  Clin Immunol       Date:  2009-01-30       Impact factor: 3.969

Review 5.  Biological, epidemiological, and clinical aspects of echinococcosis, a zoonosis of increasing concern.

Authors:  Johannes Eckert; Peter Deplazes
Journal:  Clin Microbiol Rev       Date:  2004-01       Impact factor: 26.132

6.  A novel recombinant antigen for immunodiagnosis of human cystic echinococcosis.

Authors:  Jun Li; Wen-Bao Zhang; Marianna Wilson; Akira Ito; Donald P McManus
Journal:  J Infect Dis       Date:  2003-12-09       Impact factor: 5.226

7.  Molecular cloning of an echinococcal microtrichal antigen immunoreactive in Echinococcus multilocularis disease.

Authors:  P M Frosch; C Geier; F J Kaup; A Müller; M Frosch
Journal:  Mol Biochem Parasitol       Date:  1993-04       Impact factor: 1.759

8.  Galbeta1-6Gal, antigenic epitope which accounts for serological cross-reaction in diagnosis of Echinococcus multilocularis infection.

Authors:  K Yamano; A Goto; F Nakamura-Uchiyama; Y Nawa; N Hada; T Takeda
Journal:  Parasite Immunol       Date:  2009-08       Impact factor: 2.280

9.  [Sensitivity and specificity of new commercial tests for the detection of specific Echinococcus antibodies].

Authors:  Herbert Auer; Cornelia Stöckl; Susanne Suhendra; Renate Schneider
Journal:  Wien Klin Wochenschr       Date:  2009-10       Impact factor: 1.704

Review 10.  Immunodiagnosis of parasitic diseases with synthetic peptides.

Authors:  O Noya; M E Patarroyo; F Guzmán; B Alarcón de Noya
Journal:  Curr Protein Pept Sci       Date:  2003-08       Impact factor: 3.272

View more
  27 in total

1.  Towards High-throughput Immunomics for Infectious Diseases: Use of Next-generation Peptide Microarrays for Rapid Discovery and Mapping of Antigenic Determinants.

Authors:  Santiago J Carmona; Morten Nielsen; Claus Schafer-Nielsen; Juan Mucci; Jaime Altcheh; Virginia Balouz; Valeria Tekiel; Alberto C Frasch; Oscar Campetella; Carlos A Buscaglia; Fernán Agüero
Journal:  Mol Cell Proteomics       Date:  2015-04-28       Impact factor: 5.911

Review 2.  Immunodiagnosis of human hydatid disease: Where do we stand?

Authors:  Bahador Sarkari; Zahra Rezaei
Journal:  World J Methodol       Date:  2015-12-26

3.  Peptide microarray analysis of in silico-predicted epitopes for serological diagnosis of Toxoplasma gondii infection in humans.

Authors:  Pavlo Maksimov; Johannes Zerweck; Aline Maksimov; Andrea Hotop; Uwe Gross; Uwe Pleyer; Katrin Spekker; Walter Däubener; Sandra Werdermann; Olaf Niederstrasser; Eckhardt Petri; Marc Mertens; Rainer G Ulrich; Franz J Conraths; Gereon Schares
Journal:  Clin Vaccine Immunol       Date:  2012-04-11

4.  Diagnostic peptide discovery: prioritization of pathogen diagnostic markers using multiple features.

Authors:  Santiago J Carmona; Paula A Sartor; María S Leguizamón; Oscar E Campetella; Fernán Agüero
Journal:  PLoS One       Date:  2012-12-14       Impact factor: 3.240

5.  Identification of a highly antigenic linear B cell epitope within Plasmodium vivax apical membrane antigen 1 (AMA-1).

Authors:  Lilian Lacerda Bueno; Francisco Pereira Lobo; Cristiane Guimarães Morais; Luíza Carvalho Mourão; Ricardo Andrez Machado de Ávila; Irene Silva Soares; Cor Jesus Fontes; Marcus Vinícius Lacerda; Carlos Chavez Olórtegui; Daniella Castanheira Bartholomeu; Ricardo Toshio Fujiwara; Erika Martins Braga
Journal:  PLoS One       Date:  2011-06-21       Impact factor: 3.240

Review 6.  Protein microarrays and biomarkers of infectious disease.

Authors:  Mohan Natesan; Robert G Ulrich
Journal:  Int J Mol Sci       Date:  2010-12-16       Impact factor: 5.923

7.  Echinococcus granulosus antigen B structure: subunit composition and oligomeric states.

Authors:  Karina M Monteiro; Mateus B Cardoso; Cristian Follmer; Nádya P da Silveira; Daiani M Vargas; Elliot W Kitajima; Arnaldo Zaha; Henrique B Ferreira
Journal:  PLoS Negl Trop Dis       Date:  2012-03-06

8.  A protein microarray for the rapid screening of patients suspected of infection with various food-borne helminthiases.

Authors:  Jia-Xu Chen; Mu-Xin Chen; Lin Ai; Jun-Hu Chen; Shao-Hong Chen; Yong-Nian Zhang; Yu-Chun Cai; Xing-Quan Zhu; Xiao-Nong Zhou
Journal:  PLoS Negl Trop Dis       Date:  2012-11-29

9.  Rapid identification of novel immunodominant proteins and characterization of a specific linear epitope of Campylobacter jejuni.

Authors:  Sebastian Hoppe; Frank F Bier; Markus von Nickisch-Rosenegk; Markus V Nickisch-Rosenegk
Journal:  PLoS One       Date:  2013-05-29       Impact factor: 3.240

10.  A review on diagnostic and preventive aspects of cystic echinococcosis and human cysticercosis.

Authors:  Sidhartha Giri; Subhash Chandra Parija
Journal:  Trop Parasitol       Date:  2012-07
View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.