Literature DB >> 15707495

Mass spectrometrical analysis of recombinant human growth hormone (Genotropin(R)) reveals amino acid substitutions in 2% of the expressed protein.

Felix Hepner1, Edina Cszasar, Elisabeth Roitinger, Gert Lubec.   

Abstract

BACKGROUND: The structural integrity of recombinant proteins is of critical importance to their application as clinical treatments. Recombinant growth hormone preparations have been examined by several methodologies. In this study recombinant human growth hormone (rhGH; Genotropin(R)), expressed in E. coli K12, was structurally analyzed by two-dimensional gel electrophoresis and MALDI-TOF-TOF, LC-MS and LC-MS/ MS sequencing of the resolved peptides.
RESULTS: Electrospray LC-MS analysis revealed one major protein with an average molecular mass of 22126.8 Da and some additional minor components. Electrospray LC-MS/MS evaluation of the enzymatically digested Genotropin(R) sample resulted in the identification of amino acid substitutions at the residues M14, M125, and M170; di-methylation of K70 (or exchange to arginine); deamidation of N149, and N152, and oxidation of M140, M125 and M170. Peak area comparison of the modified and parental peptides indicates that these changes were present in ~2% of the recombinant preparation.
CONCLUSION: Modifications of the recombinant human growth hormone may lead to structural or conformational changes, modification of antigenicity and development of antibody formation in treated subjects. Amino acid exchanges may be caused by differences between human and E. coli codon usage and/or unknown copy editing mechanisms. While deamidation and oxidation can be assigned to processing events, the mechanism for possible di-methylation of K70 remains unclear.

Entities:  

Year:  2005        PMID: 15707495      PMCID: PMC549540          DOI: 10.1186/1477-5956-3-1

Source DB:  PubMed          Journal:  Proteome Sci        ISSN: 1477-5956            Impact factor:   2.480


Background

The structural integrity of recombinant products generated by prokaryotic and eukaryotic organisms is a major concern. Modifications such as amino acid sequence substitution/mutations of recombinant proteins may lead to pharmacological inactivation, autoimmune phenomena [1-3] and adverse effects [4,5]. Human growth hormone (hGH) replacement is a frequent therapeutic intervention [6,7]. Genetic changes in human growth hormone have been linked to biological inactivity and disease: Lewis et al (2004) reported that a growth hormone variant I179_M179 showed decreased ability to activate the extracellular signal-regulated kinase pathway and Binder et al. (2002) described hGH deficiency due to mutations of the coding regions of the growth hormone-1 gene [8,9]. Zhu et al. (2002) reported a case of hGH R183_H183. This single mutation causes autosomal dominant growth hormone deficiency type II by prolonged retention time of R183_H183 aggregates into secretory granules [10]. However, although such changes can be detrimental, non functional sequence alteration induced by poor editing of recombinant proteins may act as a marker of growth hormone abuse in situations such as athlete doping. We therefore were highly interested in the homogeneity and structure of rhGH preparations. Genotropin® is expressed by E. coli, strain K12. It consists of a single polypeptide chain containing 191 amino acids and two disulfide bonds (C53-C165; C182-C189) [11] with a molecular mass of 22 124 Da – representing the most abundant growth hormone form in humans [12]. In humans two major hGH splicing variants have been described, a 22 kDa protein and a 20 kDa protein, that bind different sites at the growth hormone receptor and serve different biological activities [13,14]. The genetic origin of hGH is the hGH-N gene, located on the long arm of chromosome 17, in a 66-kbp cluster region closely related to four other genes: hGH-V, hCS-A, hCS-B and hCS-L. The hGH-N gene is expressed in both, pituitary and several nonpituitary sites [12], all other gene products are produced by placental syncytio-trophoblasts. A series of posttranslational modifications of hGH have been described and range from N-glycosylation, acetylation, deamidation, oxidation at M14 and M125 to polymerisation [12,15-18]. As mentioned above, Genotropin® is expressed by E. coli. Since the fidelity of hGH translation in E. coli cannot rely on copy editing [19,20], nor on correct codon usage [21-23], there is a large potential for sequence errors. That's why investigations of structural/sequential integrity, including amino acid exchanges/mutations, and post translational modifications of rhGH Genotropin® is of particular interest to for modern medicine and pharmacotherapy. The aim of the present study was to investigate the homogeneity of a commercial available rhGH, Genotropin®. This was achieved using two dimensional gel electrophoresis (2-DE), matrix-assisted laser desorption/ionisation mass spectrometry (MALDI-MS) followed by tandem mass spectrometry (MALDI-MS/MS) and liquid chromatography mass spectrometry (LC-MS) followed by tandem mass spectrometry (LC-MS/MS). These modern analytical tools provide definitive structural analysis independent of antibody availability and specificity.

Results

Two dimensional gel electrophoresis

Two dimensional gel electrophoresis (2-DE) of 1 mg Genotropin® showed a multiple spot pattern with masses between 20 000 and 35 000 Da and pIs from 4.5 to 7.0. Several two dimensional (2D) gels with sample amounts of 0.5, 1, 2, 5, 10, 20, 50, 100, 200 and 500 g of Genotropin® were performed. Decreasing protein load showed reduction of spot size and number and finally, limitation to two spots of 22000 Da with pI of 5.3 and 5.4. Neither MALDI-TOF-TOF nor LC-MS analysis of picked gel spots indicated any modifications or isoforms in an amount, that would explain differences between the two spots.

Electrospray LC-MS measurements of the Genotropin® sample

Electrospray liquid chromatography – mass spectrometry (LC-MS) measurements of the intact Genotropin® have shown that the main product was a molecule with an average molecular weight (MW) of 22126.8 Da. The manufacturers had determined the average MW of Genotropin® to be 22124 Da. The mass difference of approximately 3 Da may originate from the deconvulation of some broader, lower intensity peaks. Several minor components could be also detected. (Figure 1) The mass differences between the main product (Nr. 1) and components Nr. 2–5 respectively indicate the oxidation of several amino acid residues. Components Nr.6 and Nr.7 show a mass discrepancy of approximately +268 Da and -19 Da respectively. According to the ratios of peak areas (Table 1), the sample consists to 84.4% of the unmodified main component; the oxidation products are present to 13.7% of the whole sample and the ratio of other minor components, which may represent additional modifications or amino acid substitutions, is approximately 2%.
Figure 1

Reconstructed electrospray LC/MS spectrum of the GenotropinThe spectrum was recorded in positive ionization modus; 1 pM of the protein was injected. Detected average molecular masses: Nr.1.:22126.8 Da; Nr.2: 22143.5 Da; Nr.3: 22158.7 Da; Nr.4: 22174.4 Da; Nr.5: 22240.7 Da; Nr.6: 22395.9 Da; Nr7.: 22107.6 Da

Table 1

Relative peak areas of the components detected by electrospray LC/MS measurement

Molecular mass (Da)Area (cps)Area (%)
22126.94909.884.4
22143.5479.78.2
22158.7121.52.1
22174.4120.82.1
22107.676.91.3
22240.769.91.2
22395.940.40.7

Average molecular masses of the components detected in the LC/MS spectrum of 1 pM Genotropin® sample. The peak areas were calculated from the reconstructed spectrum (Figure 1) recorded in positive ionization.

Reconstructed electrospray LC/MS spectrum of the GenotropinThe spectrum was recorded in positive ionization modus; 1 pM of the protein was injected. Detected average molecular masses: Nr.1.:22126.8 Da; Nr.2: 22143.5 Da; Nr.3: 22158.7 Da; Nr.4: 22174.4 Da; Nr.5: 22240.7 Da; Nr.6: 22395.9 Da; Nr7.: 22107.6 Da Relative peak areas of the components detected by electrospray LC/MS measurement Average molecular masses of the components detected in the LC/MS spectrum of 1 pM Genotropin® sample. The peak areas were calculated from the reconstructed spectrum (Figure 1) recorded in positive ionization.

Electrospray LC-MS/MS measurements following the tryptic digestion of the Genotropin® sample

Electrospray tandem liquid chromatography – mass spectrometry (LC-MS/MS) measurements of the samples prepared from one dimensional SDS-PAGE indicated mass differences at several peptides. Doubly or triply charged ions were chosen for all MS/MS experiments due to their better fragmentation pattern. Table 2 shows the sequences of the modified peptides and possible explanations for the mass discrepancies.
Table 2

Results of electrospray LC-MS/MS and MALDI-TOF MS/MS measurements

SequenceM calculated (Da)M observed (Da)delta M (Da)Modification
EETQQKSNLELLR1586.831614.7427.91K70: di-methylation or → R *
FDTNSHNDDALLK1488.681489.600.92N149 / N152 deamidation
RLEDGSPR928.47900.46-28.01R127→ Q or K *
LFDNAMLR978.50994.4015.90M14 : oxidation
DMDKVETFLR1252.611268.4015.79M170: oxidation
DLEEGIQTLMGR1360.611376.6616.05M125: oxidation
LFDNAMLR978.50960.40-18.10M14 → I
DLEEGIQTLMGR1360.611342.60-18.01M125 → I
DMDKVETFLR1252.611234.60-18.01M170 → I
LFDNAMLR978.501035.4056.90Carbamidomethyl – N terminus

• Nearly isobaric mass differences

Sequences and mass differences of modified peptides detected in the Genotropin sample. Column 1: sequence of modified peptides following tryptic digestion of Genotropin®; column 2: calculated monoisotopic masses of the unmodified tryptic peptides; column 3: observed monoisotopic masses; column 4: differences of calculated and observed masses; column 5: possible explanations of the mass differences.

Results of electrospray LC-MS/MS and MALDI-TOF MS/MS measurements Nearly isobaric mass differences Sequences and mass differences of modified peptides detected in the Genotropin sample. Column 1: sequence of modified peptides following tryptic digestion of Genotropin®; column 2: calculated monoisotopic masses of the unmodified tryptic peptides; column 3: observed monoisotopic masses; column 4: differences of calculated and observed masses; column 5: possible explanations of the mass differences. A mass difference of +28 Da was detected at the position K70 (Figure 2), could be explained by the di-methylation of this residue, or by the exchange of this lysine to an arginine. These modifications result in a mass difference of 28.03 Da and 28.01 Da respectively. The accuracy of the mass spectrometric detection was not high enough to differentiate between these possibilities. Figure 2 shows the fragment spectrum of the peptide EETQQKSNLELLR. Intensive y ions verify that all residues have unchanged masses except of K70, which makes the localization of the mass discrepancy on that lysine residue unambiguous.
Figure 2

Electrospray LC-MS/MS spectrum of the modified peptide EETQQK*SNLELLR. Positive ionization product ion spectrum of the tryptic peptide m/z 808.4 generated by a linear ion trap mass spectrometer. Intensive y fragment ions verify that the K170 residue shows a mass increment of 28 Da compared to its theoretical mass.

Electrospray LC-MS/MS spectrum of the modified peptide EETQQK*SNLELLR. Positive ionization product ion spectrum of the tryptic peptide m/z 808.4 generated by a linear ion trap mass spectrometer. Intensive y fragment ions verify that the K170 residue shows a mass increment of 28 Da compared to its theoretical mass. Deamidation of the amino acids N149 and N152 was also detected. The molecular mass of the peptide RLEDGSPR was decreased with 28 Da. The mass difference could be localized to the N terminus of the peptide and might indicate the substitution of R127 with a lysine or glutamine. The mass difference of these residues is only 0.04 Da and the accuracy of the mass spectrometric detection was not high enough to differentiate between these amino acids. Residues M14, M125 and M170 were observed partly oxidized and in some cases the non oxidized residue showed a mass discrepancy of -18 Da (Table 2). This phenomenon is illustrated by Figure 3, which shows a product ion spectrum of the modified peptide LFDNAMLR. Fragment ions from the y series verify the mass reduction at the M14 residue. This mass difference can be explained by the replacement of these methionines with isoleucines, which can be originate from the substitution of the last base in the genetic codon of methionine (M:ATG; I:ATT/C/A). According to the ratios of the peak areas of the peptides containing the unmodified and possibly substituted methionines, these changes were present at < 2% of the whole protein amount. A mass increase of 57 Da was detected at the peptide LFDNAMLR. It could be localized at the N terminus of the peptide and it is supposed to be an artefact of the alkylation step during sample preparation. All modifications were partial; in each case peptides with both modified and unmodified residues were present. LC-MS/MS spectra for all modified peptides are available as supplementary material.
Figure 3

Electrospray LC-MS/MS spectrum of the peptide LFDNAM*LR. Positive ionization product ion spectrum of the tryptic peptide m/z 482.3 generated by a linear ion trap mass spectrometer. Ions of the y series verify the mass discrepancy of -18 Da at the M14 residue compared to its theoretical value.

Electrospray LC-MS/MS spectrum of the peptide LFDNAM*LR. Positive ionization product ion spectrum of the tryptic peptide m/z 482.3 generated by a linear ion trap mass spectrometer. Ions of the y series verify the mass discrepancy of -18 Da at the M14 residue compared to its theoretical value.

MALDI analysis of Genotropin®

Approximately 96 spots were excised from a 2D gel with a sample load of 1 mg Gentotropin® and identified by MALDI-TOF on the basis of peptide mass matching [24] following in gel digestion with trypsin. Those samples which were analysed by peptide mass fingerprinting from MALDI-TOF were additionally analysed using LIFT-TOF/TOF MS/MS from the same target. A maximum of three precursor ions per sample were chosen for MS/MS analysis. Genotropin® was unambiguously identified by MS and MS/MS Data (Figure 4 and 5), with a maximum of 24 matching peptides, representing a sequence- coverage of 86% to human growth hormone sequence present in database (Figure 4, Table 3). All picked and analysed spots showed similar peptide mass fingerprints. Only the oxidation status of M varied, represented by a mass difference (ΔM) of 16 Da. Oxidation at M14 was demonstrated in 59,52% of analysed spots, 80,91% of M125 and 54,87% of M170 showed oxidation too (Table 3). Neither changes in amino acid sequence, nor post translational modifications like phosphorylation or deamidation could be detected by this method.
Figure 4

MS spectrum of Genotropin showing oxidation of M(a) MS spectrum of Genotropin® generated by an Ultraflex™ TOF/TOF (Bruker Daltonics) operated in the reflector mode for MALDI-TOF peptide mass fingerprint (PMF). Enlarged sections (b-d) from PMF of Genotropin® showing oxidised/non-oxidised status (ÄM+16Da) of Methionine. (b) first peak: LFDNAMLR (979.529 Da)/ second peak: LFDNAMLR + oxidation of Methionine (995.519 Da); (c) first peak: DMDKVETFLR (1253.587 Da) / second peak: DMDKVETFLR + oxidation of Methionine (1269.572); (d) first peak: SVFANSLVYGASDSNVYDLLKDLEE-GIQTLMGR (3605.040) / second peak: SVFANSLVYGASDSNVYDLLKDLEE-GIQTLMGR + oxidation of Methionine (3621.064)

Figure 5

MS/MS spectra of GenotropinLIFT-TOF/TOF (MS/MS) (a, b) spectra of Genotropin® generated by an Ultraflex™ TOF/TOF (Bruker Daltonics) operated in LIFT mode for MALDI-TOF/TOF fully automated using the FlexControl™ software. The parent ions (m/z 1205.56 and m/z 2342.12) were selected for further analysis by MS/MS and the amino acid sequences NYGLLYCFR (5a) and LHQLAFDTYQEFEEAYIPK (5b) were unambiguously assigned to human growth hormone.

Table 3

Sequence coverage and peptide masses of Genotropin®

Sequence Coverage: 86%
Matched peptides shown in Bold
1FPTIPLSRLF DNAMLRAHRL HQLAFDTYQE FEEAYIPKEQ KYSFLQNPQT
51SLCFSESIPT PSNREETQQK SNLELLRISL LLIQSWLEPV QFLRSVFANS
101LVYGASDSNV YDLLKDLEEG IQTLMGRLED GSPRTGQIFKQTYSKFDTNS
151HNDDALLKNY GLLYCFRKDM DKVETFLRIV QCRSVEGSCG F
Start – EndObservedMr(expt)Mr(calc)DeltaMissSequence

1–8930.61929.60929.530.070FPTIPLSR
1–161906.971905.961906.01- 0.051FPTIPLSRLFDNAMLR Oxidation (M)
9–16979.51978.50978.500.010LFDNAMLR
17–382706.342705.332705.320.001AHRLHQLAFDTYQEFEEAYIPK
20–382342.122341.112341.13- 0.020LHQLAFDTYQEFEEAYIPK
20–412727.352726.342726.320.021LHQLAFDTYQEFEEAYIPKEQK
39–643058.513057.503057.450.051EQKYSFLQNPQTSLCFSESIPTPSNR
42–642673.262672.262672.250.000YSFLQNPQTSLCFSESIPTPSNR
42–703416.793415.783415.600.181YSFLQNPQTSLCFSESIPTPSNREETQQK
65–771587.801586.791586.83- 0.031EETQQKSNLELLR
78–942055.192054.182054.19- 0.010ISLLLIQSWLEPVQFLR
95–1152262.092261.082261.12- 0.040SVFANSLVYGASDSNVYDLLK
95–1273621.023620.023619.770.251SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGR Oxidation (M)
116–1271377.621376.621376.66- 0.050DLEEGIQTLMGR Oxidation (M)
141–1582097.012096.002095.980.021QTYSKFDTNSHNDDALLK
146–1581489.661488.651488.68- 0.030FDTNSHNDDALLK
146–1672676.262675.252675.240.011FDTNSHNDDALLKNYGLLYCFR
159–1671205.561204.551204.57- 0.020NYGLLYCFR
159–1681333.641332.631332.66- 0.031NYGLLYCFRK
169–1781253.581252.571252.61- 0.041DMDKVETFLR
169–1781269.571268.561268.61- 0.041DMDKVETFLR Oxidation (M)

Sequence coverage of 86% and 21 matching peptides of Genotropin® to human growth hormone could be detected using MALDI MS/ MS-MS data.

MS spectrum of Genotropin showing oxidation of M(a) MS spectrum of Genotropin® generated by an Ultraflex™ TOF/TOF (Bruker Daltonics) operated in the reflector mode for MALDI-TOF peptide mass fingerprint (PMF). Enlarged sections (b-d) from PMF of Genotropin® showing oxidised/non-oxidised status (ÄM+16Da) of Methionine. (b) first peak: LFDNAMLR (979.529 Da)/ second peak: LFDNAMLR + oxidation of Methionine (995.519 Da); (c) first peak: DMDKVETFLR (1253.587 Da) / second peak: DMDKVETFLR + oxidation of Methionine (1269.572); (d) first peak: SVFANSLVYGASDSNVYDLLKDLEE-GIQTLMGR (3605.040) / second peak: SVFANSLVYGASDSNVYDLLKDLEE-GIQTLMGR + oxidation of Methionine (3621.064) MS/MS spectra of GenotropinLIFT-TOF/TOF (MS/MS) (a, b) spectra of Genotropin® generated by an Ultraflex™ TOF/TOF (Bruker Daltonics) operated in LIFT mode for MALDI-TOF/TOF fully automated using the FlexControl™ software. The parent ions (m/z 1205.56 and m/z 2342.12) were selected for further analysis by MS/MS and the amino acid sequences NYGLLYCFR (5a) and LHQLAFDTYQEFEEAYIPK (5b) were unambiguously assigned to human growth hormone. Sequence coverage and peptide masses of Genotropin® Sequence coverage of 86% and 21 matching peptides of Genotropin® to human growth hormone could be detected using MALDI MS/ MS-MS data.

Discussion

The dominant protein in the Genotropin® preparation has an average molecular mass of 22127 Da. Electrospray LC-MS/MS evaluation of the trypsinized recombinant human growth hormone (rhGH) resulted in the identification of amino acid substitutions at residues M14, M125 and M170. Di-methylation of K70 or exchange to arginine, deamidation of N149 and N152, and oxidation of M14, M125 and M170 were also observed. These sequence alteration account for 2% of the recombinant protein. Amino acid exchanges of a rhGH has been described before: Gellerfors et al. (1990) describe exchanges rhGH Q65_V65 and rhGH Q66_K66[25]. Since the product was not identified we cannot compare our results. Binding of recombinant human growth hormone to the GH receptor may be modified by the five amino acid exchanges observed in the present study. Pal et al. (2003) calculated binding energy differences between modified human growth hormone (hGHv; M14_W14) and wild type human growth hormone (hGHwt; M14) with the result that the hGHv had more binding affinity to its receptor than hGHwt [26,27]. Cunningham et al. showed that M14 influenced binding, even if it is not a "hot spot" for linkage to its receptor. Furthermore, the amino acid exchanges detected may very well lead to antigenic differences and thus form the molecular basis for eliciting immune responses. The underlying cause of amino acid exchanges may be codon usage and/or absence of copy editing in E. coli: The M_I exchanges may be due to miscast of the third nucleoside of the cognate anticodon at the so-called Wobble-position, i.e. switch cytosine to guanine/adenosine, a phenomenon described by Crick as "Wobble- hypothesis [28]. Crick (1966) postulated a certain amount of wobble at the third base position of the codon allowing more than one possible codon-anticodon- base pairing. Methionine (M)_I exchange of rhGH Genotropin® may have been generated as the base pair G-G / G-A was replacing G-C. Arginine (R)_K/Q and R_G exchanges of rhGH Genotropin® may be due to difficulties in translation of the rare codon AGG. Kane et al. (1995) predicted translational problems with an abundant mRNA species containing an excess of rare tRNA codons that may arise after the initiation of transcription of a cloned heterologous gene in the E. coli host [21]. Recent studies suggest clusters of AGG/AGA codons can reduce both quantity and quality of the synthesized protein [22,29]. Translational modification normally does not include amino acid exchanges but rather frameshift mutations/deletions [21,29-31]. In summary, we found two different pathways for amino acid exchanges in Genotropin®: translation errors due to usage of (1) the rare codon AGG in E. coli and (2) incorrect codon usage consisted with Crick's "Wobble-hypothesis". Oxidative modification of a recombinant human growth hormone has been described by Karlsson et al. (1999) who demonstrated M14 and M125 oxidation as detected by LC-MS [32]. No other group have reported oxidation of M170 as in our study. Indeed Teh et al. (1987) oxidised natural hGH extracted from pituitary glands and detected M14 and M125 oxidation by reversed phase chromatography [33]. Gellerfors et al. (1990) oxidised rhGH with hydrogen peroxide but again failed to show oxidation of M170, as detected by reversed phase chromatography [25]. It is not known whether oxidation of methionines in recombinant human growth hormone leads to functional impairment but conformational changes are unlikely as proposed by circular dichroism and 1H-NMR studies [33]. It is worth mentioning that oxidised methionines are not localised at the receptor binding site. Post translational modification such as N-acetylation, N-glycosylation, deamidation and oxidation have been reported for rhGH, hGH and bovine growth hormone (bGH) [15-17,34]. Dimethylation of K70 in rhGH and hGH have not previously been reported. Whether transmethylation occurred during processing or is a post translational event during rhGH production in E. coli is unknown. Nevertheless, Martal et al. (1985) demonstrated reduction of biological activity of hGH and bGH by methylation and ethylation of its residues K41, K70, and K115[35]. Therefore, dimethylation of K70 in Genotropin® could have biological relevance, probably reducing its pharmacotherapeutic activity. Deamidation of N149 and N152 may be due to technical processing, probably by heat treatment or lyophilisation and has already been reported by Gellerfors et al (1990) and Karlsson et al. (1999) [25,32]. Though these appear to have no function significance [26,27,36]. Modifications of the recombinant human growth hormone, as shown in this study, may effect functionality and safety depending on the prevalence of such forms in the preparation. As already mentioned above, impaired binding to the receptor, conformational changes leading to impaired function, amino acid exchanges as mutations may well lead to immune phenomena or even disease [1-3,37]. In addition, such modifications may act as markers of these proteins in situations like rhGH doping.

Conclusions

Using one- and two-dimensional gel electrophoresis, electrospray LC-MS, LC- MS/MS and MALDI-TOF-TOF mass spectrometry we detected a series of modifications of the recombinant human growth hormone (Genotropin®) including amino acid exchanges, oxidation, di-methylation and deamidation. This analytical battery is a reliable, specific and sensitive analytical tool for this purpose.

Methods

Sample preparation

Genotropin © MiniQuick 1,0 mg (Pharmacia & Upjohn; Stockholm, Sweden) was suspended in 0,5 ml of sample buffer consisting of 8 M urea (Merck, Darmstadt, Germany), 4% CHAPS (3- [(3-cholamidopropyl) dimethylammonio]-1-propane-sulfonate) (Sigma, St. Louis, MO, USA), 10 mM 1,4-dithioerythritol (Merck, Germany) and 0,5% carrier ampholytes "Resolyte" 3,5–10 (BDH Laboratory Supplies, Electran ®, England). The suspension was transferred into Ultrafree-4 centrifugal filter units (Millipore, Bedford, MA), for desalting and concentrating proteins. Protein content of the supernatant was quantified by the Bradford protein assay system [38]. The standard curve was generated using bovine serum albumin and absorbance was measured at 595 nm.

One-dimensional SDS-polyacrylamide gel electrophoresis

One dimensional SDS-polyacrylamide gel was performed as described by Laemmli [39]. Samples of 0.5, 1, 2, 5, 10, 30, 50 and 100 μg were loaded on the gel. For determination of molecular weight 10 μl of precision plus protein standards, all blue (Bio Rad, California, USA), were applied on the gels.

Two-dimensional gel electrophoresis (2-DE)

2 DE was performed essentially as reported [40]. Samples of 1 mg protein were applied on immobilized pH 3–10 nonlinear gradient strips in sample cups at their basic and acidic ends. Focusing was started at 200 V and the voltage was gradually increased to 8000 V at 4 V/min and then kept constant for a further 3 h (approximately 150,000 Vh totally). After the first dimension, strips (18 cm) were equilibrated for 15 min in the buffer containing 6 M urea, 20% glycerol, 2% SDS, 2% DTT and then for 15 min in the same buffer containing 2.5% iodoacetamide instead of DDT. After equilibration, strips were loaded on 9–16% gradient sodium dodecylsulfate polyacrylamide gels for second-dimensional separation. The gels (180 × 200 × 1.5 mm) were run at 40 mA per gel. Immediately after the second dimension run, gels were fixed for 12 h in 50% methanol, containing 10% acetic acid, the gels were stained with Colloidal Coomassie Blue (Novex, San Diego, CA) for 12 h on a rocking shaker. Molecular masses were determined by running standard protein markers (Biorad Laboratories, Hercules, CA) covering the range 10–250 kDa. pI values were used as given by the supplier of the immobilized pH gradient strips (Amersham Bioscience, Uppsala, Sweden). Excess of dye was washed out from the gels with distilled water and the gels were scanned with ImageScanner (Amersham Bioscience). Electronic images of the gels were recorded using Adobe Photoshop and Microsoft Power Point Softwares.

Matrix-assisted laser desorption ionisation mass spectrometry

Spots were excised with a spot picker (PROTEINEER sp™, Bruker Daltonics, Germany), placed into 96-well microtiter plates and in-gel digestion and sample preparation for MALDI analysis were performed by an automated procedure (PROTEINEER dp™, Bruker Daltonics) [41,42]. Briefly, spots were excised and washed with 10 mM ammonium bicarbonate and 50% acetonitrile in 10 mM ammonium bicarbonate. After washing, gel plugs were shrunk by addition of acetonitrile and dried by blowing out the liquid through the pierced well bottom. The dried gel pieces were reswollen with 40 ng/μl trypsin (Promega, U.S.A.) in enzyme buffer (consisting of 5 mM Octyl β-D-glucopyranoside (OGP) and 10 mM ammonium bicarbonate) and incubated for 4 hrs at 30°C. Peptide extraction was performed with 10 μl of 1% TFA in 5 mM OGP. Extracted peptides were directly applied onto a target (AnchorChip™, Bruker Daltonics) that was load with α-cyano-4-hydroxy-cinnamic acid (Bruker Daltonics) matrix thinlayer. The mass spectrometer used in this work was an Ultraflex™ TOF/TOF (Bruker Daltonics) operated in the reflector mode for MALDI-TOF peptide mass fingerprint (PMF) or LIFT mode for MALDI-TOF/TOF fully automated using the FlexControl™ software. An accelerating voltage of 25 kV was used for PMF. Calibration of the instrument was performed externally with [M+H]+ ions of angiotensin I, angiotensin II, substance P, bombesin, and adrenocorticotropic hormones (clip 1–17 and clip 18–39). Each spectrum was produced by accumulating data from 200 consecutive laser shots. Those samples which were analysed by PMF from MALDI-TOF were additionally analysed using LIFT-TOF/TOF MS/MS from the same target. A maximum of three precursor ions per sample were chosen for MS/MS analysis. In the TOF1 stage, all ions were accelerated to 8 kV under conditions promoting metastable fragmentation. After selection of jointly migrating parent and fragment ions in a timed ion gate, ions were lifted by 19 kV to high potential energy in the LIFT cell. After further acceleration of the fragment ions in the second ion source, their masses could be simultaneously analysed in the reflector with high sensitivity. PMF and LIFT spectra were interpreted with the Mascot software (Matrix Science Ltd, London, UK). Database searches, through Mascot, using combined PMF and MS/MS datasets were performed via BioTools 2.2 software (Bruker). A mass tolerance of 100 ppm and 2 missing cleavage sites for PMF and MS/MS tolerance of 0.5 Da and 1 missing cleavage sites for MS/MS search were allowed and oxidation of methionine residues was considered. The probability score calculated by the software was used as criterion for correct identification. The algorithm used for determining the probability of a false positive match with a given mass spectrum is described elsewhere [43].

Nano-electrospray LC-MS and LC-MS/MS analysis

Genotropin® MiniQuick 0.6 mg (Pharmacia & Upjohn; Stockholm, Sweden) was suspended in the solution provided in the two-chamber cartridge and diluted with 1% formic acid (Merck; Darmstadt, Germany) in water (Maxima, Elga; High Wycombe, UK) to 1 pM/μl. 1 μl of this solution was used for the nano-electrospray LC-MS investigation. The HPLC used was an UltiMate™ system (Dionex Corporation; Sunnyvale, CA, USA) equipped with a PepMap C18 purification column (300 μm × 5 mm) and a 75 μm × 150 mm analytical column of the same material. 0.1% TFA (Pierce Biotechnology Inc.; Rockford, IL, USA) was used on the Switchos module for the binding of the peptides and a linear gradient of acetonitrile (Chromasolv®, Sigma-Aldrich; Seelze, Germany) and 0.1% formic acid in water was used for the elution. The gradient was (A = 5% acetonitrile / 0.1% formic acid in water; B = 80% acetonitrile / 0.1% formic acid in water) 0% B for 12 min, 80% B in 30 min, 100 % B in 3 min, 100% B for 10 min, 0% B in 2 min, 0% B for 23 min. The flow rate was 240 nl/min. The LC-system was coupled on-line to a QSTAR Pulsar hybrid mass spectrometer (Applied Biosystems; Foster City, CA, USA). The nanospray source of Proxeon (Odense, Denmark) was used with the distal coated silica nanospray capillaries of New Objective (Woburn, MA, USA). The electrospray voltage was set to 1800 V. Spectra were acquired over the mass range of m/z 600–1600. The accumulation time was 1 sec. Protein spectra were deconvoluted by Analyst® (Applied Biosystems; Foster City, CA, USA). LC-MS/MS analyses were carried out also with the UltiMate™ system interfaced to the QSTAR Pulsar or to an LTQ (Thermo; San Jose, CA, USA) linear ion trap mass spectrometer. The gradient was (A = 5% acetonitrile / 0.1% formic acid in water B = 80% acetonitrile / 0.1% formic acid in water) 0% B for 12 min, 60% B in 88 min, 100 % B in 5 min, 100% B for 10 min, 0% B in 5 min, 0% B for 20 min. Peptide spectra were recorded over the mass range of m/z 450–1300, MS/MS spectra were recorded in information dependent data acquisition over the mass range of m/z 50–1600. One peptide spectrum was recorded followed by two MS/MS spectra on the QSTAR Pulsar instrument; the accumulation time was 1 sec for peptide spectra and 2 sec for MS/MS spectra. The collision energy was set automatically according to the mass and charge state of the peptides chosen for fragmentation. One full spectrum was recorded followed by 3 MS/MS spectra on the LTQ instrument, automatic gain control was applied and the collision energy was set to the arbitrary value of 35. Doubly or triply charged ions were selected for product ion spectra. MS/MS spectra were interpreted by Mascot (Matrix Science Ltd, London, UK).

Competing interests

The author(s) declare that they have no competing interests.

Authors' contributions

Felizardo, Maureen carried out MALDI-TOF-TOF analysis. Raja, Karlin participated in sequence alignments and in the design of the study. All authors read and approved the final manuscript.
  42 in total

Review 1.  RNA editing.

Authors:  A Brennicke; A Marchfelder; S Binder
Journal:  FEMS Microbiol Rev       Date:  1999-06       Impact factor: 16.408

2.  Biologically inactive growth hormone caused by an amino acid substitution.

Authors:  Y Takahashi; H Shirono; O Arisaka; K Takahashi; T Yagi; J Koga; H Kaji; Y Okimura; H Abe; T Tanaka; K Chihara
Journal:  J Clin Invest       Date:  1997-09-01       Impact factor: 14.808

3.  Reduction of actin-related protein complex 2/3 in fetal Down syndrome brain.

Authors:  Rachel Weitzdoerfer; Michael Fountoulakis; Gert Lubec
Journal:  Biochem Biophys Res Commun       Date:  2002-05-03       Impact factor: 3.575

Review 4.  Growth hormone heterogeneity: genes, isohormones, variants, and binding proteins.

Authors:  G Baumann
Journal:  Endocr Rev       Date:  1991-11       Impact factor: 19.871

5.  Cleavage of structural proteins during the assembly of the head of bacteriophage T4.

Authors:  U K Laemmli
Journal:  Nature       Date:  1970-08-15       Impact factor: 49.962

6.  A novel dysfunctional growth hormone variant (Ile179Met) exhibits a decreased ability to activate the extracellular signal-regulated kinase pathway.

Authors:  Mark D Lewis; Martin Horan; David S Millar; Vicky Newsway; Tammy E Easter; Linda Fryklund; John W Gregory; Martin Norin; Cristóbal-Jorge Del Valle; Juan Pedro López-Siguero; Ramón Cañete; Luis Fernando López-Canti; Nieves Díaz-Torrado; Rafael Espino; Angels Ulied; Maurice F Scanlon; Annie M Procter; David N Cooper
Journal:  J Clin Endocrinol Metab       Date:  2004-03       Impact factor: 5.958

7.  The 20-kD human growth hormone reduces body fat by increasing lipolysis and decreasing lipoprotein lipase activity.

Authors:  Shunichi Takahashi; Noboru Satozawa
Journal:  Horm Res       Date:  2002

8.  The functional binding epitope of a high affinity variant of human growth hormone mapped by shotgun alanine-scanning mutagenesis: insights into the mechanisms responsible for improved affinity.

Authors:  Gabor Pal; Anthony A Kossiakoff; Sachdev S Sidhu
Journal:  J Mol Biol       Date:  2003-09-05       Impact factor: 5.469

9.  Isolation of Escherichia coli synthesized recombinant eukaryotic proteins that contain epsilon-N-acetyllysine.

Authors:  B N Violand; M R Schlittler; C Q Lawson; J F Kane; N R Siegel; C E Smith; E W Kolodziej; K L Duffin
Journal:  Protein Sci       Date:  1994-07       Impact factor: 6.725

10.  Methionine oxidation in human growth hormone and human chorionic somatomammotropin. Effects on receptor binding and biological activities.

Authors:  L C Teh; L J Murphy; N L Huq; A S Surus; H G Friesen; L Lazarus; G E Chapman
Journal:  J Biol Chem       Date:  1987-05-15       Impact factor: 5.157

View more
  6 in total

Review 1.  Oxidation of therapeutic proteins and peptides: structural and biological consequences.

Authors:  Riccardo Torosantucci; Christian Schöneich; Wim Jiskoot
Journal:  Pharm Res       Date:  2013-09-25       Impact factor: 4.200

2.  UV photodegradation of murine growth hormone: chemical analysis and immunogenicity consequences.

Authors:  Amber Haynes Fradkin; Olivier Mozziconacci; Christian Schöneich; John F Carpenter; Theodore W Randolph
Journal:  Eur J Pharm Biopharm       Date:  2014-04-20       Impact factor: 5.571

3.  "De-novo" amino acid sequence elucidation of protein G'e by combined "top-down" and "bottom-up" mass spectrometry.

Authors:  Yelena Yefremova; Mahmoud Al-Majdoub; Kwabena F M Opuni; Cornelia Koy; Weidong Cui; Yuetian Yan; Michael L Gross; Michael O Glocker
Journal:  J Am Soc Mass Spectrom       Date:  2015-01-06       Impact factor: 3.109

4.  Discrimination of recombinant from natural human growth hormone using DNA aptamers.

Authors:  John G Bruno; Maria P Carrillo; Taylor Phillips; Allison Edge
Journal:  J Biomol Tech       Date:  2011-04

5.  Capillary electrophoresis-mass spectrometry using noncovalently coated capillaries for the analysis of biopharmaceuticals.

Authors:  R Haselberg; V Brinks; A Hawe; G J de Jong; G W Somsen
Journal:  Anal Bioanal Chem       Date:  2011-02-14       Impact factor: 4.142

Review 6.  Applications in Which Aptamers Are Needed or Wanted in Diagnostics and Therapeutics.

Authors:  John G Bruno
Journal:  Pharmaceuticals (Basel)       Date:  2022-06-01
  6 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.