Literature DB >> 36214961

Designing a novel SOX9 based multi-epitope vaccine to combat metastatic triple-negative breast cancer using immunoinformatics approach.

HemaNandini Rajendran Krishnamoorthy1, Ramanathan Karuppasamy2.   

Abstract

Immunotherapies are a promising treatment option especially for the management of TNBC owing to its higher levels of tumour-associated antigens together with higher mutational load. Of note, the administration of preventive vaccines in the early stage of the cancer holds promise for effective disease management. Therefore, the present study aimed to develop a novel multi-epitope peptide-based vaccination against TNBC employing SOX9, which has recently been recognized as a key regulator of TNBC metastasis. The immunodominant regions from the SOX9 protein were computed and assessed based on their ability to elicit both T and B lymphocyte mediated responses. The resultant epitopes were fused using appropriate linkers (EAAAK, KK, AAY and GPGPG) and adjuvant (50S ribosomal protein L7/L12) to enhance the vaccine's immunogenicity. The physicochemical properties and population coverage were also anticipated for the constructed vaccine. Adding together, docking and dynamics simulation studies were performed on the modelled vaccine against TLR-4 to provide insight into the stability. Finally, the designed vaccine was cloned into the pET28 (+) vector and immunological simulation studies were carried out. These results demonstrate that our designed vaccine had the potency to trigger humoral and cellular immune responses. Based on these collective evidences, the final proposed vaccine could be an interesting therapeutics for the management of TNBC in the near future. Schematic representation of an efficient vaccine design framework by combining the range of immunoinformatics strategies.
© 2022. The Author(s), under exclusive licence to Springer Nature Switzerland AG.

Entities:  

Keywords:  Dynamics; Immune simulation; In silico cloning; SOX protein; Triple-negative breast cancer

Year:  2022        PMID: 36214961      PMCID: PMC9549049          DOI: 10.1007/s11030-022-10539-w

Source DB:  PubMed          Journal:  Mol Divers        ISSN: 1381-1991            Impact factor:   3.364


Introduction

Triple-negative breast cancer (TNBC), which represents 10–30% of breast cancer cases, is characterized by the absence of the progesterone receptor, epidermal growth factor receptor 2 and oestrogen receptor [1]. Currently, surgery and chemotherapy are the primary treatment modalities for patients with TNBC [2]. However, the response to these options had limited efficacy and significant toxicity [3]. Furthermore, TNBC has also grown resistance to targeted and endocrine therapy due to molecular heterogeneity [4]. For these reasons, efficient treatment options and potential biomarkers are an unmet need for the management of TNBC. Recent advances in the immune-landscape of the tumour microenvironment (TME) have gained insight into cancer immunotherapy [3]. Immunotherapy primarily aims to eliminate tumour cells by boosting both the cell and antibody mediated immune response, thereby reducing the probability of metastasis, relapse and resistance [5]. In TNBC, the TME is characterized by higher levels of lymphocyte infiltration and tumour mutational burden, suggesting that it would respond more likely to immunotherapy. Studies in the literature have shown that cancer subunit vaccines are a promising active immunotherapy approach that stimulate the CD 8+, CD 4+ and B cells to eliminate cancer cells. The main advantages of these subunit vaccines include minimal toxicity and specific adaptive immune response [6]. In fact, 45.5% of clinical trials for breast cancer vaccines are peptide-based. PVX-410, P10s-PADRE and TPIV200 are some of the chimeric vaccines for TNBC that are currently in clinical phase trials [7]. Furthermore, a plethora of studies are being conducted to identify potential peptide vaccines to combat TNBC. For instance, Kumar et al. proposed a subunit vaccine by identifying the potential cell surface markers for TNBC management [8]. Similarly, Mahdevar et al. and Parvizpour et al. designed novel peptide-based vaccines for cancer-testis antigens (BORIS, MAGE-A and NY-ESO-1) by fusing the immunodominant CTL and HTL epitopes to prevent TNBC [9, 10]. The most frequently explored tumour antigens to date for vaccine development include HER2 protein, cancer testis-antigen, mucin-1 (MUC-1) and carcino-embryonic antigen (CEA) [11]. However, there are countless overexpressed proteins that might be promising vaccine candidates. Recently, ten transcription factors have been discovered to play a significant part in the progression of TNBC, including androgen receptor (AR), bromodomain 4 (BRD4), forkhead box C1 (FOXC1) homeobox protein engrailed-1 (EN1), MYC, myeloid zinc finger (MZF1), p53, sex-determining region Y-related HMG-Box (SOX) members, zinc finger E-box binding homeobox 1 (ZEB1) and high mobility group AT-hook 1 (HMGA1). In particular, the SOX proteins SOX 9, SOX 10, SOX 2, SOX 4, SOX 8 and SOX 11 are reported to be overexpressed in TNBC. However, effective inhibition of these TFs remains elusive because of the absence of binding pockets and intracellular localization [12, 13]. Meanwhile, scientific advancement has drawn attention to the development of vaccination strategy using these transcription factors. For instance, Polakova et al. designed a DNA vaccine against the transcription factor SOX 2 which is essential for stem cell self-renewal and is also overexpressed in numerous cancer [14]. Similarly, Friedman et al. demonstrated the presence of immunodominant B and T lymphocyte epitopes from SOX 4 and suggested that could be used in a peptide-based vaccine against lung carcinoma [15]. Despite the fact that SOX9 has been identified as the key regulator of TNBC progression, no therapeutics approved for the treatment of patients who have SOX9 overexpression [16]. In light of this evidence, we implemented immunoinformatics approaches alongside simulation strategies to develop a novel multi-epitope chimeric vaccine that could be an effective therapy option for the management of TNBC.

Methodology

Retrieval of protein sequence

The amino acid sequence of the sex-determining region Y-related HMG-box transcription factor 9 (SOX9) (UniProt ID: P48436) was retrieved in FASTA format from the UniProt database. The protein sequence was submitted to an ensemble of computational tools for the prediction of the immunodominant epitopes.

Prediction of immunogenic epitopes

Prediction of T-cell epitopes

The NetCTL 1.2 online server was employed to anticipate MHC class I restricted (CTL) epitopes, which utilizes artificial neural networks (ANN) to predict MHC-peptide binding. In the current investigation, prediction was carried out using a peptide length of 9 mers and a threshold value of 0.75 against twelve MHC class I super types (A1, A2, A3, A24, A26, B7, B8, B27, B39, B44, B58 and B62). The threshold is set to achieve highest prediction performance both in terms of sensitivity and specificity. Similarly, the NetMHC II 2.3 server was used to estimate the HTL epitopes that bind to HLA-DQ, HLA-DP and HLA-DR alleles using artificial neural networks [17]. The epitopes were predicted using a 15-mer peptide length and threshold values of 2% for strong binders and 10% for weak binders, respectively. Peptides of increased length have an increased affinity for MHC class II relative to shorter peptides for MHC class I. More precisely, MHC class I accommodate peptides of 8–10 residues. On the other hand, the open binding groove of MHC class II proteins typically accommodates peptides of 13–25 residues [18]. Given the importance of peptide-MHC interaction to the cellular immune response, we have utilized the default peptide length to retrieve the epitopes with greater affinity. NetCTL-1.2 also achieves the highest sensitivity of 0.75.

Prediction of continuous and discontinuous B-cell epitopes

The BCPREDS server, a SVM-based classifier with an accuracy of 74.57% was utilized for the prediction of linear B-cell epitopes [19]. In the present study, the SOX9 protein sequence was examined for potent B-cell epitopes with a default threshold value of 0.75 and an epitope length of 20 mers. Parallely, the Ellipro server computes a protrusion index (PI) value for each estimated conformational B-cell epitope by combining the Tornton's method with residue clustering algorithms [20, 21]. The PI value represents the proportion of protein atoms that are responsible for antibody binding and extend beyond the molecular bulk.

Assessment of immunogenic properties of the predicted epitopes

From the array of predicted peptides, potent antigenic regions were shortlisted depending on their allergenicity, toxicity and antigenicity characteristics. Initially, the antigenicity of the epitopes was assessed using the VaxiJen (version 2.0) server, which has an accuracy range of 70 to 89% at a threshold of 0.4 and virus as the target organism [22]. The default parameters were employed for the consistent and reliable prediction of protective antigens. Similarly, the toxicity of the predicted epitopes was examined using the ToxinPred server with an SVM (Swiss-Prot) based method being employed [23]. Additionally, the AllerTOP v. 2.0 server, which is based on auto cross covariance (ACC) was used to evaluate the allergenicity of the epitopes [24]. It should be noted that not all HTL peptides are capable of inducing cytokine production. Hence IFNepitope a SVM-based server was utilized to estimate IFN-γ inducing HTL epitopes.

Population coverage analysis and multi–epitope vaccine construction

The development of peptide-based vaccines relies greatly on population coverage analysis [25]. The IEDB's population coverage analysis tool was used with the default options to calculate the population coverage of potential epitopes and their HLA alleles. The final vaccine molecule was constructed using the selected CTL, HTL and B-cell epitopes. To enhance the immunogenicity, the 50S ribosomal protein L7/L12 (Locus RL7_MYCTU; Acc No. P9WHE3) was chosen as an adjuvant.

Assessment of immunological and physicochemical properties of the construct

The overall purpose of vaccination is to observe the post-injection activity of the designed vaccine in the body. Therefore, we utilized AllerTop (version 2.0) and Vaxijen (version 2.0) respectively to assess the antigenic and non-allergenic behaviour of the vaccine. In addition, various physicochemical properties including theoretical isoelectric point (pI), extinction coefficient, molecular weight, instability index, amino acid composition, aliphatic index and grand average hydropathy (GRAVY) were computed for the chimeric vaccine by the Expasy ProtParam server to gain insight into the physicochemical characteristics of final vaccine candidate [26].

Prediction and validation of secondary and tertiary structure

The PSIPRED online server, which works by incorporating neural networks and PSI-BLAST (Position-Specific Iterated-BLAST), was employed for the prediction of the alpha helices, beta sheets and coils in the designed vaccine [27]. The tertiary structure of the final vaccine sequence was anticipated using the ROBETTA server which generates three-dimensional structures based on deep learning methods. The modelled vaccine construct was then validated using the PROCHECK, ERRAT and VERIFY 3D tools from the SAVES v6.0 server. These servers evaluate the tertiary structure with different aspect ratios [28, 29].

Docking studies of designed vaccine and immune receptors (TLR-2 and TLR-4)

Molecular docking is a key tool to predict the predominant binding modes of a ligand with a protein of a known three-dimensional structure [30]. In the present study, the designed vaccine was docked against TLRs such as TLR-2 (PDB ID: 6NIG) and TLR-4 (PDB ID: 4G8A) using the ClusPro 2.0, a fully automated algorithm that performs rigid-body protein–protein docking. It filters docked conformations with good surface complementarity and ranks them based on their clustering properties [31]. The docked complex was then visualized using the PyMOL software and the interaction between the vaccine and the TLRs (TLR-2 and TLR-4) were analysed to gain insight into the binding pattern.

Molecular dynamic simulation

Molecular dynamics simulation was carried out using GROMACS v2020.1 with GROMOS force field to further confirm the stability of the developed vaccine. Initially, the system was solvated using simple point charge (SPC) water molecules in a 10 Å dodecahedron box which was configured using the editconf inbuilt tool of GROMACS. The total charge of the system was -28 which was neutralized by adding 28 sodium counter ions using the genion tool. Subsequently, the energy of the complex was minimized prior to MD run with 10 kJ/mol force constant using the Steepest Descent algorithm. The Particle-Mesh Ewald method was applied to explore the electrostatic interactions. The hydrogen bonds and the Van der Waals interactions are constrained and truncated by implementing LINCS algorithm. The Number of particles, volume and temperature (NVT) and Number of particles, pressure and temperature (NPT) ensembles were run for 50 ps to restrain the position for the heavy atoms. The system was then heated to 300 K, the optimal physiological temperature of the biological host system, with a lapsing time of 0.1 ps and pressure of 1 bar using the Berendsen algorithm. Finally, the vaccine and the vaccine-TLR-4 complex were subjected to 50 ns MD simulations with a 2 fs time step interval. The parameters such as root-mean-square deviation (RMSD), radius of gyration (Rg) and solvent accessible surface area (SASA) were evaluated using GROMACS utilities.

Codon optimization and in silico cloning of the vaccine construct

Back translation and codon optimization were done using the Java Codon Adaptation Tool (JCat) with Escherichia coli (K12 strain) as the expression host system for the protein sequence of the designed vaccine. The server computes two parameters important for assessment of protein expression level, namely, the codon adaptive index (CAI) and the GC content. The protein expression will be noble if the CAI value is 1.0 and GC content is in the range between 30 and 70%. Beyond this range an unfavourable effects on translation and transcriptional efficiencies will be observed [32]. The SnapGene software was utilized for in silico cloning of the codon optimized vaccine into the pET28 (+).

Immune simulation studies

C-ImmSim, an online simulation server was used to illustrate the immune response profile between the human immune system and the vaccine construct. The C-ImmSim portrays the humoral and cellular responses of a mammalian system against the constructed vaccine using position-specific scoring matrix (PSSM) and machine learning techniques, respectively [33]. For the analysis, three injections containing 1000 vaccine proteins with no LPS were given with a 4 week interval of 1, 84 and 168 steps. The remaining parameters, such as the random seed, simulation volume and number of antigens to inject, were left at their default settings with the exception of "Simulation Steps," which was set to 1050.

Results and discussion

Prediction and screening of CTL, HTL and B-cell epitopes

Cytotoxic T lymphocytes (CTL) and helper T lymphocytes (HTL) are key components of the adaptive immune system as they play a major role in acquiring long-term immunity [34, 35]. In the present study, a total 115 CTL epitopes and 303 HTL epitopes were predicted by the NetCTL 1.2 and NetMHC II 2.3 servers, respectively. Initially, the predicted epitopes were narrowed down by their ability to bind to at least three MHC I and MHC II alleles. Subsequently, these epitopes were assessed for antigenicity, toxicity, allergenicity and IFN-γ inducing property (only for HTL) using AllerTOP, VaxiJen, ToxinPred and IFNepitope servers, respectively. Finally as shown in Tables 1 and 2, 3 CTL epitopes (GQVTYTGSY, NLPHYSPSY and AAGQGTGLY) and 3 HTL epitopes (NIETFDVNEFDQYLP, GLYSTFTYMNPAQRP and GISSTAATPASAGHV) were selected for further analysis.
Table 1

Predicted CTL epitopes of SOX9 protein and its immunogenic properties

PeptidesAlleleAntigenicityAllergenicityToxicity
GQVTYTGSYA1, B27, B620.6997Non-allergenNon-toxic
NLPHYSPSYA1, A26, B620.4475Non-allergenNon-toxic
AAGQGTGLYA1, A26, B620.6651Non-allergenNon-toxic
Table 2

Predicted HTL epitopes of SOX9 protein and its immunogenic properties

PeptidesAllelesImmunogenic properties
AntigenicityAllergenicityIFN-γToxicity
NIETFDVNEFDQYLPHLA-DPA10103, HLA-DPB10402, HLA-DQA10101, HLA-DQB10501, HLA-DQA10102, HLA-DQB105020.4356Non-allergenInducerNon-toxic
GLYSTFTYMNPAQRPHLA-DQA10102, HLA-DQB10602, HLA-DQA10601, HLA-DQB10402, HLA-DRB1_0401, HLA-DRB1_1001, HLA-DRB5_01010.5122Non-allergenInducerNon-toxic
GISSTAATPASAGHVHLA-DQA10102, HLA-DQB10602, HLA-DQA10103, HLA-DQB10603, HLA-DQA10201, HLA-DQB10301, HLA-DQA10201, HLA-DQB10303, HLA-DQA10201, HLA-DQB10402, HLA-DQA10501, HLA-DQB10301, HLA-DQA10501, HLA-DQB10302, HLA-DQA10501, HLA-DQB103030.5486Non-allergenInducerNon-toxic
Predicted CTL epitopes of SOX9 protein and its immunogenic properties Predicted HTL epitopes of SOX9 protein and its immunogenic properties B-cell epitopes are antigenic regions to which antibodies bind to trigger an immune response [36]. Therefore, recognizing these epitopes in an antigen is essential for designing a chimeric vaccine. The BCPREDS server predicted 17 B-cell epitopes with scores ranging from 0.8 to 1.0. Only 10 of these epitopes were non-toxic, antigenic and non-allergenic (Table 3). Epitopes with an antigenic score of 1.0 (GEHSGQSQGPPTPPTTPKTD, GKADLKREGRPLPEGGRQPP and SEDSAGSPCPSGSGSDTENT) were considered for further analysis.
Table 3

Predicted linear B-cell epitopes of SOX9 protein

ProteinEpitopeScoreVaxijen scoreAllergenicityToxicity
SOX9*GEHSGQSQGPPTPPTTPKTD10.7068Non-allergenNon-toxic
*GKADLKREGRPLPEGGRQPP10.6941Non-allergenNon-toxic
*SEDSAGSPCPSGSGSDTENT10.8349Non-allergenNon-toxic
QENTFPKGEPDLKKESEEDK0.9990.4860Non-allergenNon-toxic
PFMKMTDEQEKGLSGAPSPT0.9910.8493Non-allergenNon-toxic
NESEKRPFVEEAERLRVQHK0.9870.7546Non-allergenNon-toxic
TLVPMPVRVNGSSKNKPHVK0.9860.7353Non-allergenNon-toxic
TTLSSEPGQSQRTHIKTEQL0.9490.7346Non-allergenNon-toxic
QPRRRKSVKNGQAEAEEATE0.9331.1107Non-allergenNon-toxic
SEQQQHSPQQIAYSPFNLPH0.8890.5050Non-allergenNon-toxic

*Epitopes considered for vaccine design

Predicted linear B-cell epitopes of SOX9 protein *Epitopes considered for vaccine design

Assembling of multi-epitope vaccine construct

The chosen CTL, HTL and linear B-cell epitopes were fused to form a robust vaccine construct using appropriate linkers and adjuvants. As a result, the final vaccine consisted of three CTL, three HTL and three B-cell epitopes with a final length of 295 amino acids (Fig. 1). In order to boost the immunogenicity, 50S ribosomal protein was used as an adjuvant at the N-terminal end of the vaccine using EAAAK linker. EAAAK is a rigid α-helix peptide linker that provides efficient functional domain separation in fusion proteins [37].
Fig. 1

The structural representation of the final vaccine construct

The structural representation of the final vaccine construct The CTL epitopes were joined using the AAY linkers. In mammalian cells, the Ala-Ala-Tyr (AAY) linker acts as the proteasomes' restriction site. As a result, epitopes coupled by an AAY linker are efficiently separated within the cells. Moreover, the vaccine construct’s immunogenicity is also enhanced by the AAY linker [37]. Similarly, the GPGPG linkers, which have the potential to trigger HTL responses necessary for a synthetic vaccine, were utilized to combine the CD4+ epitopes [38]. Finally, to incorporate the B-cell peptides KK linkers were utilized, which are also capable of enhancing the immunogenicity [39].

Evaluation of population coverage

The peptide binding domains of MHC class I and MHC class II restricted HLA alleles are polymorphic, implying that they possess different binding specificities [40]. As a result, determining population coverage for predicted antigenic regions is an essential part of developing a multi-epitope vaccine. According to Table 4 and Fig. 2a, the estimated global population coverage for the shortlisted epitopes is 99.65% across 109 countries. Similarly, the population coverage across Indian population is found to be 99.83% as shown in Fig. 2b. In a nutshell, the findings indicate that the selected immunodominant peptides could be used to develop a synthetic vaccine that could be administered to a larger population.
Table 4

Estimated population coverage score for Indian and world population

Population/areaClass combined
Coverageaaverage_hitbpc90c
India99.83%4.722.77
World99.65%4.72.63
Average99.744.712.7
Standard deviation0.090.010.07

aProjected population coverage

bAverage number of epitope hits/HLA combinations recognized by the population

cMinimum number of epitope hits/HLA combinations recognized by 90% of the population

Fig. 2

Population coverage analysis a Worldwide, b Indian population

Estimated population coverage score for Indian and world population aProjected population coverage bAverage number of epitope hits/HLA combinations recognized by the population cMinimum number of epitope hits/HLA combinations recognized by 90% of the population Population coverage analysis a Worldwide, b Indian population

Prediction of immunogenic property, physicochemical property and secondary structure of the designed vaccine

The constructed chimeric vaccine was subjected to allergenicity, toxicity and antigenicity evaluation. The designed vaccine candidate had an antigenicity score of 0.5945, indicating that it is a probable antigen capable of eliciting an immune response. Also, the vaccine construct is found to be non-toxic and non-allergic thus proving its safety. Adding together, the Expasy Protparam online server was utilized to explore the vaccine's other physical and chemical properties. It is evident that the final synthetic vaccine is composed of 295 amino acids and has a molecular weight of 30.14 kDa which is ideal for vaccine construction and purification during experimental evaluation. The instability index of the constructed vaccine is found to be 39.84, implying its high stability. Further, the aliphatic index and the theoretical pI are observed to be 65.36 and 4.91, respectively, reflecting its high thermo-stability and acidic nature. The designed vaccine has an estimated half-life of 30 h in mammalian reticulocytes (in vitro), > 20 h in yeast (in vivo) and > 10 h in E. coli (in vivo). The GRAVY (grand average of hydropathicity) score is found to be − 0.408 denoting the hydrophilic nature of the vaccine. The values of the physicochemical properties are tabulated in Table 5.
Table 5

Analysis of physicochemical properties of the vaccine construct

Physicochemical parametersValue
Molecular weight (kDa)30.14
No. of amino acids295
Theoretical pI4.91
Instability index39.84
Aliphatic index65.36
GRAVY− 0.408
Antigenicity0.5945 (probable antigen)
AllergenicityNon-allergen
Analysis of physicochemical properties of the vaccine construct

Modelling and validation of secondary and tertiary structure

Secondary structures are important in protein folding and structure [41]. The PSIPRED server was used to calculate the percentage of secondary structure, which included 33.56% (alpha-helix), 12.20% (extended strand) and 57.24% (coils). The result is shown in Fig. S1. The tertiary structure of the designed vaccine was modelled by ROBETTA server. Out of 5 models predicted by the server, model 2 was chosen based on the model evaluation performed using SAVES server. The modelled tertiary structure was assessed by PROCHECK, VERIFY 3D and ERRAT provided by the SAVES servers to determine the possible errors and reliability of the model. According to the Ramachandran plot, 90.5% of the residues are in the favoured region (Fig. S2a). In addition, the overall quality factor of the model is found to be 94.50. The modelled 3D structure is visualized using PyMOL (Fig. S2b).

Prediction of conformational B-cell peptides

The discontinuous B-cell epitopes are regions in the antigen that are commonly recognized by the antibodies, which play a substantial role in antibody-mediated immunity. The ElliPro server was employed to discover the non-sequential B-cell epitopes from the constructed vaccine. As illustrate in Fig. S3, the algorithm estimated 6 conformational B-cell epitopes in our proposed vaccine with scores ranging from 0.87 to 0.54 (Table 6) indicating that these regions will be distinguished by antibodies.
Table 6

Predicted discontinuous B-cell epitopes

S. no.ResiduesNumber of residuesScore
1SQGPPTPPTTPKTDKKGKADLKREGRPLPEGGRQPPKKSEDSAGSPCPSGSGSDTENT580.87
2MAKLSTDELLDAEMDFVKKFEETEVTAAAPV310.686
3QEFILEAAGDKKIGVGAPKPVAKEADEAKAKLEAAGATVTVKEAAAKGQ490.604
4SSTAATPASAGV120.584
5IET30.537
6FDVN40.523
Predicted discontinuous B-cell epitopes

Molecular docking

Understanding the molecular details of antigen detection is a crucial and effective step for the successful development of peptide-based vaccinations. Toll-like receptors (TLRs) are essential for identifying particular patterns in host molecules and also play a significant role in innate immunity during cancer. According to reports, TNBC cells exhibits nearly tenfold less TLR-2 expression than ER/PR+ cells [42]. Similarly, TLR-4 was also reported to be less expressed in TNBC patient compared to luminal and HER2+ patients [43]. These data suggest that the low expression of TLR-2 and TLR-4 may aid in immune evasion and tumour growth in TNBC. Therefore, keeping these facts in mind, we carried out a molecular docking study to assess how the designed vaccine will interact with these immune molecules. The docking results showed that the proposed vaccine significantly binds to the TLR-4 (− 1074.3 kcal/mol) than the TLR-2 receptor (− 981.2 kcal/mol). Thus, we selected TLR-4 for further analysis. The PyMOL software was used to view the bound complex of TLR-2 and TLR-4 with vaccine (Figs. S4 and S5) and the binding residues between the vaccine-TLR-2 and vaccine-TLR-4 were visualized using the PDBSum. Based on the interaction analysis report, it is observed that the designed subunit vaccine formed 15 hydrogen bonds with TLR-4 chain A and 5 hydrogen bonds with TLR-4 chain C (Fig. 3a). On the contrary, it exhibits 10 hydrogen bonds with TLR-2 chain A and 12 hydrogen bonds with TLR-2 chain B (Fig. 3b). Of note, the binding of vaccine with TLR-4 protein was facilitated by highest number of non-bonded contacts than with TLR-2 protein. Although these non-bonded contacts are weaker, collectively it could support the binding of vaccine construct with the immune molecule. These interacting patterns implicate that the designed vaccine has a strong affinity and structural stability against TLR-4 than TLR-2 protein. It is worth noting that docking score correlates favourably with the available literature information and thus validates the docking analysis. For instance, the literature highlights TLR-4 recognition by 50S ribosomal protein L7/L12 and causes DC maturation which further results in the release of pro-inflammatory cytokines (TNF-alpha, IL-1beta and IL-6). The evidences also suggest that naïve T cells could also be stimulated by 50S ribosomal protein L7/L12-activated DCs, which could also efficiently polarize CD4+ and CD8+ T cells to produce IFN-gamma and trigger T cell-mediated cytotoxicity [44].
Fig. 3

a Interacting residues between chain A and chain C of TLR-4 with vaccine (chain E). The hydrogen bonds are represented in blue colour. b Interacting residues between chain A and chain B of TLR-2 with vaccine (chain E). The hydrogen bonds are represented in blue colour

a Interacting residues between chain A and chain C of TLR-4 with vaccine (chain E). The hydrogen bonds are represented in blue colour. b Interacting residues between chain A and chain B of TLR-2 with vaccine (chain E). The hydrogen bonds are represented in blue colour

Molecular dynamics simulation

A molecular dynamics simulation was executed for 50 ns using both vaccine-TLR-4 complex and vaccine in order to validate the binding mode and stability of the complex. The results were analysed using parameters such as RMSD, Rg and SASA to gain insights into the stability at molecular level. Initially, the vaccine's RMSD value increased sharply, reaching nearly 2.78 nm in 12 ns. Between 12 and 15 ns, minimal fluctuations were observed. Around 50 ns, the RMSD value reached to 2.5 nm. Similarly, the complex's RMSD value increased in a positive trend, reaching 1.5 nm at 12 ns. Afterwards, the RMSD value dropped to 1.4 nm around 14 ns and continued till the end of the simulation. Therefore, from Fig. 4a it can be observed that the vaccine-TLR-4 complex exhibited a lower RMSD value, which could be beneficial for structural stability.
Fig. 4

Molecular dynamics simulation analysis a RMSD graph of TLR-4—vaccine complex. b Radius of gyration of TLR-4—vaccine complex and c solvent accessible surface graph of TLR-4—vaccine complex

Molecular dynamics simulation analysis a RMSD graph of TLR-4—vaccine complex. b Radius of gyration of TLR-4—vaccine complex and c solvent accessible surface graph of TLR-4—vaccine complex Radius of gyration (Rg) is used to characterize the flexibility of the receptor-ligand complex. A small Rg value illustrates that the proteins are in folded state during the simulation. As depicted in Fig. 4b, the average Rg score for the construct was found to be 1.90 nm and the average Rg score for the vaccine-TLR-4 complex was 3.8 nm. These results indicate that the designed vaccine remained compact during the simulation. Solvent accessible surface area (SASA) is used to determine the surface area that can be accessed by solvent molecules. The average SASA values of our vaccine and vaccine—TLR-4 complex were monitored during the 50 ns MD simulation and are found to be 156.501 nm2 and 480 nm2 respectively. The complex's higher SASA value implies that it is stable in the solvent environment (Fig. 4c).

Codon optimization and in silico cloning

Codon optimization is frequently done to improve the translation efficiency of a target gene by considering the codon bias of the host organism. The Java Codon Adaptation tool was utilized to optimize the codon usage of the vaccine construct in E. coli (K12 strain). The Codon Adaptation Index (CAI) was estimated to be 0.98, signifying the success of target gene expression. The GC content of the vaccine construct was found to be 53.67% and it was in the optimal range of 30–70%. Further, the DNA sequence of the vaccine construct was cloned into pET-28 (+) vector between the EcoR1 and MluI restriction sites. These restriction sites were not present in the DNA sequence of the vaccine construct. As a result, they were added at the N-terminal and C-terminal ends of the vaccine, respectively. Finally, the in silico cloning was successfully done using the SnapGene software. The total length of the final vaccine clone was observed to be 5314 bp as depicted in Fig. 5.
Fig. 5

In silico cloning of vaccine construct into the pET28 (+) vector using SnapGene software

In silico cloning of vaccine construct into the pET28 (+) vector using SnapGene software According to immune simulation results from C-ImmSim, secondary and tertiary immune responses had higher amounts of IgM, IgM + IgG, IgG1 + IgG2 and IgG1 antibodies than the primary immune response, suggesting that our proposed vaccine molecule has the ability to activate the complement system, which is important in controlling infections. Moreover, it can be observed that the concentration of the antigen also significantly decreased with an increase in the concentration of the antibody during each phase of the immune response (Fig. 6a). In addition to the increase in antibodies, other cytokines, including IFN-γ, were also found to be produced at higher levels during immunological reactions (Fig. 6b). Taken together, these immune response results confirm that designed vaccine is able to trigger a robust cellular and humoral immune response.
Fig. 6

Immune response profile of the vaccine construct a concentration of immunoglobulins, b concentration of cytokines and interleukin

Immune response profile of the vaccine construct a concentration of immunoglobulins, b concentration of cytokines and interleukin

Conclusion

The present study aimed to identify the antigenic, non-allergic and non-toxic T- and B-cell epitopes of SOX9 with the aid of immunoinformatics strategies. These epitopes, which could elicit cell-mediated as well as humoral immunity, were fused together with an adjuvant (50 s ribosomal L7/L12 protein) to design an epitope-based peptide vaccine against TNBC. The designed vaccine exhibits an instability index of 39.84, which highlights its stability in a test tube. The molecular docking confirmed that the developed vaccine can improve natural defences by binding to immune cell receptor TLR-4. The MD simulation analysis demonstrated that the TLR-4-vaccine complex had a smaller RMSD (1.4 nm) and a higher SASA (480 nm2), indicating its structural integrity and stability in the solvent environment. Additionally, the Rg value (3.8 nm) of the proposed vaccine was lower, reflecting the molecule's compact nature. Similarly, the immunological simulation studies suggested the developed vaccine could also elicit a potent cellular immune response. The collective evidences from our study highlight that the developed chimeric vaccine candidate could be utilized in the treatment regimen for the management of patients with metastatic triple-negative breast cancer. However, further studies are needed to demonstrate that our vaccine is an effective TNBC preventive. Below is the link to the electronic supplementary material. Supplementary file1 (DOCX 1211 kb)
  39 in total

Review 1.  Breast cancer vaccines: Heeding the lessons of the past to guide a path forward.

Authors:  Cinzia Solinas; Marco Aiello; Edoardo Migliori; Karen Willard-Gallo; Leisha A Emens
Journal:  Cancer Treat Rev       Date:  2019-11-29       Impact factor: 12.111

2.  B and T cell epitope-based peptides predicted from clumping factor protein of Staphylococcus aureus as vaccine targets.

Authors:  Jyotirmayee Dey; Soumya Ranjan Mahapatra; Pratima Singh; Swadheena Patro; Gajraj Singh Kushwaha; Namrata Misra; Mrutyunjay Suar
Journal:  Microb Pathog       Date:  2021-09-02       Impact factor: 3.738

3.  Design and Evaluation of a Multi-Epitope Peptide of Human Metapneumovirus.

Authors:  Xiaoyan Li; Liru Guo; Mei Kong; Xu Su; Dongjing Yang; Ming Zou; Yinghua Liu; Likun Lu
Journal:  Intervirology       Date:  2016-04-21       Impact factor: 1.763

4.  Scalable web services for the PSIPRED Protein Analysis Workbench.

Authors:  Daniel W A Buchan; Federico Minneci; Tim C O Nugent; Kevin Bryson; David T Jones
Journal:  Nucleic Acids Res       Date:  2013-06-08       Impact factor: 16.971

5.  ElliPro: a new structure-based tool for the prediction of antibody epitopes.

Authors:  Julia Ponomarenko; Huynh-Hoa Bui; Wei Li; Nicholas Fusseder; Philip E Bourne; Alessandro Sette; Bjoern Peters
Journal:  BMC Bioinformatics       Date:  2008-12-02       Impact factor: 3.169

Review 6.  Major Histocompatibility Complex (MHC) Class I and MHC Class II Proteins: Conformational Plasticity in Antigen Presentation.

Authors:  Marek Wieczorek; Esam T Abualrous; Jana Sticht; Miguel Álvaro-Benito; Sebastian Stolzenberg; Frank Noé; Christian Freund
Journal:  Front Immunol       Date:  2017-03-17       Impact factor: 7.561

7.  In silico design of a triple-negative breast cancer vaccine by targeting cancer testis antigens.

Authors:  Sepideh Parvizpour; Jafar Razmara; Mohammad M Pourseif; Yadollah Omidi
Journal:  Bioimpacts       Date:  2018-07-02

Review 8.  Breast Cancer Vaccines: Disappointing or Promising?

Authors:  Si-Yuan Zhu; Ke-Da Yu
Journal:  Front Immunol       Date:  2022-01-28       Impact factor: 7.561

Review 9.  Targeting cytotoxic T lymphocytes for cancer immunotherapy.

Authors:  J Maher; E T Davies
Journal:  Br J Cancer       Date:  2004-08-31       Impact factor: 7.640

10.  Expression profile of Toll‑like receptors in human breast cancer.

Authors:  Shuxun Shi; Cong Xu; Xiaonan Fang; Yonghuan Zhang; Hua Li; Wujun Wen; Guiwen Yang
Journal:  Mol Med Rep       Date:  2019-11-26       Impact factor: 2.952

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.