Literature DB >> 35647680

Crystal structure of an extracellular superoxide dismutase from Onchocerca volvulus and implications for parasite-specific drug development.

Amr Moustafa1, Markus Perbandt1, Eva Liebau2, Christian Betzel1, Sven Falke1.   

Abstract

Superoxide dismutases (SODs) are metalloproteins that are responsible for the dismutation of superoxide anion radicals. SODs are consequently protective against oxidative damage to cellular components. Among other protective mechanisms, the filarial parasite Onchocerca volvulus has a well developed defense system to scavenge toxic free radicals using SODs during migration and sojourning of the microfilariae and adult worms in the human body. O. volvulus is responsible for the neglected disease onchocerciasis or `river blindness'. In the present study, an extracellular Cu/Zn-SOD from O. volvulus (OvEC-SOD) was cloned, purified and crystallized to obtain structural insight into an attractive drug target with the potential to combat onchocerciasis. The recombinant OvEC-SOD forms a dimer and the protein structure was solved and refined to 1.55 Å resolution by X-ray crystallography. Interestingly, a sulfate ion supports the coordination of the conserved copper ion. The overall protein shape was verified by small-angle X-ray scattering. The enzyme shows a different surface charge distribution and different termini when compared with the homologous human SOD. A distinct hydrophobic cleft to which both protomers of the dimer contribute was utilized for a docking approach with compounds that have previously been identified as SOD inhibitors to highlight the potential for individual structure-based drug development. open access.

Entities:  

Keywords:  Cu/Zn superoxide dismutases; Onchocerca volvulus; X-ray crystallography; docking; drug targets; metal ion coordination; parasites

Mesh:

Substances:

Year:  2022        PMID: 35647680      PMCID: PMC9158661          DOI: 10.1107/S2053230X22005350

Source DB:  PubMed          Journal:  Acta Crystallogr F Struct Biol Commun        ISSN: 2053-230X            Impact factor:   1.072


Introduction

The filarial parasite Onchocerca volvulus is the causative agent of human onchocerciasis, an infectious disease characterized by skin lesions, acute and chronic dermatitis, and depigmentation (Brattig et al., 1994 ▸). It is the second leading cause of infectious blindness worldwide. At least 220 million people are estimated to have required preventive chemotherapy against onchocerciasis. 99% of infected people live in Africa and 1.15 million people are visually impaired or blind according to the World Health Organization (World Health Organization, 2022 ▸). Onchocerciasis causes chronic disability with long-term complications and socio-economic problems, particularly in developing countries. A number of strategies to control onchocerciasis have aimed at targeting the transmitting vector, i.e. the blackfly, and/or fighting O. volvulus in the human host itself. Among various approaches, the drug ivermectin has frequently been used (Basáñez et al., 2008 ▸). However, ivermectin is only effective against microfilariae (Borsboom et al., 2003 ▸), has adverse effects and emerging resistance has also been reported due to its massive utilization (Keiser et al., 2002 ▸; Osei-Atweneboana et al., 2007 ▸). Hence, there is an urgent need for the development of drugs that also target adult worms since they resume the production of microfilariae (Churcher et al., 2009 ▸). Alternative treatments using medicinal plants have been also put in place, using Onchocerca ochengi and Caenorhabditis elegans as model organisms (Cho-Ngwa et al., 2010 ▸; Ndjonka et al., 2011 ▸). Moreover, substantial work has focused on targeting Wolbachia bacteria, which coexist in symbiosis with filarial worms (Harcus et al., 2004 ▸; Wanji et al., 2009 ▸). Although these attempts have been successful in decreasing the number of cases, onchocerciasis has by no means been eliminated and continues to be a major public health concern. One additional approach focuses on the identification of excretory/secretory products (ESPs) that are essentially involved in parasite–host interaction. Their diversity and extracellular accessibility render them attractive drug targets (Hewitson et al., 2008 ▸; Lustigman et al., 2002 ▸). The secretion of antioxidant enzymes by parasites is thought to predominantly protect them against toxic reactive oxygen species (ROS) released by immune effector cells as a host defense mechanism (Hewitson et al., 2008 ▸). O. volvulus responds to ROS by producing antioxidant enzymes such as thioredoxin peroxidase (Chandrashekar et al., 1998 ▸), glutathione S-transferases (Liebau et al., 2008 ▸) and superoxide dismutases (SODs; Henkle-Dührsen et al., 1997 ▸; Lizotte-Waniewski et al., 2000 ▸). SODs are metalloenzymes that catalyse the disproportion redox reaction of superoxide anions to oxygen and hydrogen peroxide, i.e. + 2H+ → O2 + H2O2. In addition to oxidative stress, this is also relevant for peroxide signaling (Montllor-Albalate et al., 2019 ▸). Since H2O2 is a rather inert and small oxidant, it can freely diffuse through cell membranes and possesses multiple physiological effects, as discussed elsewhere (Storz & Imlayt, 1999 ▸; Rahbari et al., 2017 ▸). SODs are distinguished based on their cellular localization and the metal cofactor(s) in their active sites. All SOD subgroups have been characterized in humans in great detail (Petersen et al., 2004 ▸, 2008 ▸), as well as, for example, in fungi (Robinett et al., 2018 ▸; Mohsin et al., 2021 ▸) and to a limited extent in nematodes (Dabir et al., 2008 ▸; Henkle-Dührsen et al., 1994 ▸; James et al., 1994 ▸; Ou et al., 1995 ▸). A number of copper(II) complexes are capable of mimicking SOD activity (Siqueira et al., 2020 ▸). Nanocomposite-based materials with SOD activity are being considered for pharmaceutical use in the treatment of stress-related diseases (Pavlovic et al., 2021 ▸). Some high-resolution structures of SODs have been determined, among which is the recently reported structure of a Cu/Zn-SOD from the fungus Chaetomium thermophilum (Mohsin et al., 2021 ▸). The first characterization of a SOD from O. volvulus was reported by Henkle et al. (1991 ▸), but additional SOD activity was found in in vitro culture supernatants of Onchocerca microfilariae and adult worms (James et al., 1994 ▸). The suggestion that there is another secretory or excretory form of this enzyme was supported by a study that detected a SOD in larval and adult stages (Henkle-Dührsen et al., 1997 ▸). It was first predicted that the individual N-terminal signal peptide (SP) of this extracellular SOD (OvEC-SOD; EC 1.15.1.1) is cleaved off between Asn42 and Gly43 of the preprocessed protein (James et al., 1994 ▸). Although computational tools for the detection of SPs have continuously improved, the detection of cleavage sites remains challenging. This is especially critical when preparing the recombinant production of putative ESPs for structural studies. In terms of our investigations, we successfully designed a soluble OvEC-SOD construct starting from Gly43 of the preprocessed protein. The structure of OvEC-SOD was solved at 1.55 Å resolution, comprising a homodimer with 156 residues and one copper and one zinc ion in the active site of each protomer. Despite the conserved fold, the overall sequence identities compared with human cytosolic and extracellular SODs are only 45% and 55%, respectively. Inhibitors of Taenia solium SOD, which potentially target a widely non­conserved cleft close to the dimerization interface, were docked to OvEC-SOD. The overall structure of OvEC-SOD and its dimerization were verified in solution. Structural insights into OvEC-SOD may shed light on the structural diversity of SODs and may potentially further be exploited in future drug-discovery approaches to treat onchocerciasis with improved specificity.

Materials and methods

Cloning, protein production and purification

The open reading frame encoding OvEC-SOD starting from Ala44 was amplified from O. volvulus genomic DNA by PCR (Table 1 ▸). The N-terminus of the protein is supplemented with an OmpA signal peptide mediating secretion to the periplasmic space, a Strep-tag II and a TEV protease cleavage site (ENLYFQ↓G). Escherichia coli BL21 (DE3) cells were transformed and grown in Luria–Bertani medium containing 50 µg ml−1 ampicillin at 310 K. When the optical density at 600 nm reached approximately 0.6, overexpression was induced by adding 200 µg anhydrotetracycline per litre of shaking culture. After 4 h, the cells were harvested by centrifugation and resuspended in lysis buffer (50 mM Tris–HCl, 500 mM NaCl, 5% glycerol pH 8.0). The cells were disrupted by sonication and the supernatant was loaded onto a StrepTactin Sepharose column (IBA, Germany) pre-equilibrated with lysis buffer. Protein was eluted using 2.5 mM desthiobiotin in the same buffer. The Strep-tag II was cleaved off by TEV protease at a molar ratio of 1:50 using the combined fractions containing OvEC-SOD. Subsequent size-exclusion chromatography allowed estimation of the oligomeric state of OvEC-SOD using a calibrated HiLoad 16/600 Superdex 200 column equilibrated with 50 mM Tris–HCl, 200 mM NaCl pH 8.0. The homogeneity and the optimal solution composition were verified by dynamic light scattering using a Spectrolight 300 instrument (XtalConcepts, Germany) in preparation for crystallization experiments. The identity and integrity of the purified protein were confirmed by SDS–PAGE (Laemmli, 1970 ▸) as shown in Supplementary Fig. S1(.
Table 1

Macromolecule-production information

Source organism Onchocerca volvulus Leuckart, 1894
DNA sourceGenomic DNA
Forward primer5′-GGGCAA GAATTCCATGGCTAGAAGAGCAGTAGCAGT-3′
Reverse primer5′-GGGCAA GGATCCTCAAGCAGCAATGCCAATAACACC-3′
Expression vectorpASK-IBA16 (IBA, Germany)
Expression host Escherichia coli BL21 (DE3)
Complete amino-acid sequence MKKTAIAIAVALAGFATVAQAASWSHPQFEKSGGGGGENLYFQGAETAVPNSMARRAVAVLRGDAGVSGIIYFQQGSGGSITTISGSVSGLTPGLHGFHVHQYGDQTNGCTSAGDHYNPFGKTHGGPNDRIKHIGDLGNIVAGANGVAEVYINSYDIKLRGPLSVIGHSLVVHANTDDLGQGTGNMREESLKTGNAGSRLACGVIGIAAVS

Crystallization and crystal handling

OvEC-SOD was initially screened against 400 distinct crystallization conditions (Qiagen, Germany) applying the sitting-drop vapor-diffusion method using a Honeybee 961 dispensing robot (Genomic Solutions, UK) at 293 K combined with a 2-well MRC plate. A 500 nl droplet of protein solution was mixed with the same volume of reservoir solution and equilibrated against 50 µl reservoir solution. Brick-shaped crystals appeared after one week using a reservoir solution consisting of 0.01 mM calcium chloride, 0.1 mM sodium acetate pH 4.0, 60%(w/v) MPD. Unfortunately, these crystals only diffracted to approximately 6 Å resolution. To optimize the crystal quality, the N-terminal tag was cleaved off and otherwise identical crystallization experiments were performed. Crystals appeared using the conditions specified in Table 2 ▸ and grew to full size after five months. The crystal morphology is shown in Supplementary Fig. S1(.
Table 2

Crystallization conditions for OvEC-SOD

MethodVapor diffusion, sitting drop
Plate type96-well MRC2 plate
Temperature (K)293
Protein concentration (mg ml−1)18
Buffer composition of protein solution50 mM Tris–HCl, 200 mM NaCl pH 8.0
Composition of reservoir solution10%(w/v) PEG 20 000, 20%(v/v) PEG MME 550, 30 mM each of di-, tri-, tetra- and pentaethylene glycol, 0.1 M MOPS/HEPES–Na (premixed in an equimolar ratio) pH 7.5
Drop volume and mixing ratio500 nl protein, 500 nl reservoir
Volume of reservoir (µl)50
Crystals were prepared for data collection by manual harvesting using nylon loops. They were briefly immersed in mother liquor supplemented with 10% glycerol as a cryoprotectant and were flash-cooled in liquid N2 for subsequent data collection.

Data collection, processing and refinement

Diffraction data were collected on EMBL beamline P13 at DESY, Hamburg, Germany. Further details are specified in Table 3 ▸. Indexing of the data was carried out with XDS (Kabsch, 2010 ▸). The crystal structure was solved by molecular replacement with MOLREP (Vagin & Teplyakov, 2010 ▸) using the crystal structure of a C. elegans SOD (PDB entry 3kbe; O. N. Pakhomova, A. B. Taylor, J. P. Schuermann, V. L. Culotta & P. J. Hart, unpublished work) as a search model. REFMAC5 (Kovalevskiy et al., 2018 ▸) from the CCP4 suite version 4.2 (Winn et al., 2011 ▸) was used for iterative refinement in combination with Coot (Emsley et al., 2010 ▸) for manual model building. Model building resulted in an overall R of 15.9% and R free of 18.1% using all data in the resolution range 25.80–1.55 Å. Data-collection, indexing and refinement statistics are shown in Tables 3 ▸ and 4 ▸, respectively. The structure was deposited in the Protein Data Bank with PDB code 5in2.
Table 3

Data collection and processing for OvEC-SOD

Values in parentheses are for the outer shell.

Diffraction sourceBeamline P13, PETRA III
Wavelength (Å)1.033
Temperature (K)100
DetectorPILATUS 6M
Crystal-to-detector distance (mm)180
Rotation range per image (°)0.1
Total rotation range (°)360
Exposure time per image (ms)20
Space group P3121
a, b, c (Å)58.4, 58.4, 77.6
α, β, γ (°)90, 90, 120
Mosaicity (°)0.22
Resolution range (Å)25.80–1.55 (1.60–1.55)
Total No. of reflections198412
No. of unique reflections22806
Completeness (%)100 (100)
Multiplicity8.7 (8.0)
I/σ(I)〉14.1 (3.33)
CC1/2 99.9 (99.9)
R merge 0.075 (0.420)
R r.i.m. 0.07 (0.45)
Overall B factor from Wilson plot (Å2)21.2
Matthews coefficient (Å3 Da−1)2.4
Solvent content (%)48.8

Estimated as R r.i.m. ≃ R merge(N/(N − 1))1/2, where N is the data multiplicity.

Table 4

Structure solution and refinement for OvEC-SOD

Values in parentheses are for the outer shell.

Resolution range (Å)25.80–1.55 (1.60–1.55)
Completeness (%)100 (100)
No. of reflections, working set22776 (2109)
No. of reflections, test set1185 (122)
Final R cryst (%)15.9 (20.2)
Final R free (%)18.1 (27.7)
Cruickshank DPI0.065
No. of non-H atoms
 Protein1119
 Ligands (including all ions)27
 Water92
 Total1238
R.m.s. deviations
 Bond lengths (Å)0.009
 Angles (°)1.240
Average B factors (Å2)
 Protein29.6
 Ligands35.3
 Water35.6
Ramachandran plot
 Most favored (%)98.3
 Allowed (%)1.7

Structural investigation of OvEC-SOD in solution

Monodisperse solutions containing pure OvEC-SOD were applied to small-angle X-ray scattering (SAXS) to verify the dimerization of OvEC-SOD and to analyze its shape. Data were collected on EMBL beamline P12 at the PETRA III storage ring, DESY, Hamburg, Germany as further specified in Supplementary Table S1. Four solute concentrations in the range 0.5–7.5 mg ml−1 were exposed to the beam. The obtained scattering amplitudes were averaged over all 40 exposures per sample for 45 ms each and the averaged buffer scattering of 40 buffer exposures was subtracted. Data were normalized to the transmitted beam intensity. The scattering profiles were plotted and evaluated using PRIMUS as part of the ATSAS suite (Manalastas-Cantos et al., 2021 ▸). The Guinier approximation (Guinier, 1939 ▸) was utilized to determine the radius of gyration (R g). The pair distance-distribution function was calculated using GNOM. Ab initio models were calculated using GASBOR (Svergun et al., 2001 ▸). Furthermore, CRYSOL (Svergun et al., 1995 ▸) and SREFLEX (Panjkovich & Svergun, 2016 ▸), which considers additional conformational flexibility of a given high-resolution structure in solution, allowed the comparison of the scattering data to known high-resolution crystal structure coordinates.

Docking

Using FTmap (Kozakov et al., 2015 ▸), potential binding sites for the default docking library of small molecules were identified. These binding sites and the individual pattern of binding sites on the surface of related SODs are considered to be useful in preparation for fragment-based drug-development approaches and also for identifying potential binding sites of a given ligand. The underlying probe library consistes of 16 molecules, i.e. acetamide, acetonitrile, acetone, acetaldehyde, methylamine, benzaldehyde, benzene, isobutanol, cyclohexane, N,N-dimethylformamide, dimethyl ether, ethanol, ethane, phenol, 2-propanol and urea. The compounds for the docking of putative inhibitors were selected based on a previous docking study as well as activity and specificity assays on T. solium Cu/Zn-SOD (García-Gutiérrez et al., 2011 ▸). These authors utilized the LeadQuest library, which contains 51 068 drug-like compounds, reduced the size of the screen using Lipinski-like rules for docking and finally tested 50 candidate compounds in vitro. The molecular weights of the library compounds range from 200 to 700 Da. Based on this previous study, which indicated inhibitor binding outside the active site (García-Gutiérrez et al., 2011 ▸), and agreement with FTmap indicating potentially druggable binding sites, the in silico docking analysis was prepared. AutoDock 4.2.3 (Morris et al., 2009 ▸) was used for compound docking to the OvEC-SOD dimer applying the Lamarckian genetic algorithm (LGA). For each docking, the grid size was set to 60 × 60 × 60 Å with a grid spacing of 0.675 Å centered at the putative hydrophobic compound binding cleft in proximity to the dimerization interface of the OvEC-SOD dimer [grid center coordinates (x, y, z): −9.3, −3.8, −13.5]. Step sizes of 1 Å for translation and 60° for rotation were chosen, the maximum number of energy evaluations was set to 150 000 and 150 runs were performed. Ligand-binding site plots were prepared using LigPlot+ version 2.2 (EMBL–EBI).

Results and discussion

Overall crystal structure

The major differences among Cu/Zn-type SODs at the sequence level are the length and composition of the large non­conserved turns and loops, as visualized as an alignment in Supplementary Fig. S2. The crystal structure of OvEC-SOD contains one molecule per asymmetric unit; the respective data processing is summarized in Table 4 ▸. The biological assembly, however, is a dimer with two distinct independent active sites. Every monomer contains three α-helices, accounting for approximately 9% of the secondary structure, and nine β-sheets representing 37% of the secondary structure. The OvEC-SOD structure shows typical features of SODs that are highly conserved throughout the different kingdoms of organisms, including the Greek-key β-barrel motif (Fig. 1 ▸ a). Closely related homologues from Homo sapiens share an overall r.m.s.d. of <1 Å for Cα positions with OvEC-SOD (Fig. 1 ▸ b). The common feature is a large cylindrical barrel comprising nine extended sheets with an entirely antiparallel structure. The rest of the protomer structure contains two loops of a nonrepetitive type. The first loop, i.e. residues 47–84, has two distinct parts. The first part is a disulfide loop, which is connected to the β-barrel motif by a disulfide bond. The second part is predominantly hydrophilic and contributes to coordination of the Zn2+ ion. The second, and also the second largest, loop is hydrophilic and is referred to as the electrostatic loop. The dimerization interface mainly consists of hydrophobic interactions, involving only four hydrogen bonds. The dimer, as displayed in Fig. 1 ▸(c), has a dimerization interface area of approximately 730 Å2.
Figure 1

High-resolution crystal structure of OvEC-SOD. (a) Topology diagram of the protein and its secondary structure. (b) Superposition of O. volvulus SOD (green) with T. solium SOD (pink; PDB entry 3mnd; Cα r.m.s.d. of 0.5 Å; Hernández-Santoyo et al., 2011 ▸) and H. sapiens SOD (purple); PDB entry 1hl4; Cα r.m.s.d. of 0.5 Å; Strange et al., 2003 ▸). (c) Cartoon and surface representation of the crystallographic OvEC-SOD dimer. The approximate position of the active site as highlighted in (d) is framed. (d) Close-up of the active site and the two conserved metal ions. The coordination distances are shown in Å.

The active site of OvEC-SOD and its geometry

The active site contains one Cu2+ ion relevant for catalysis and one structural Zn2+ ion. The identity of the metal ions is supported by the CMM server (Zheng et al., 2014 ▸) based on their coordination geometries. Specifically, B factors of 21.4 and 18.3 Å2 were determined for the copper and zinc ions, respectively. Further, the gRMSD, i.e. the determined deviation from ideal coordination angles (ligand–metal–ligand) for the respective metal ion (Zheng et al., 2014 ▸), is 9.4° for the copper ion and 7.9° for the zinc ion. The coordination spheres of the Cu2+ and Zn2+ ions are defined by the invariant residues His46, His48, His63 and His120 and His63, His71, His80 and Asp83, respectively (Fig. 1 ▸ d). The Zn2+ ion is coordinated by three histidine residues and one aspartate residue in a tetragonal geometry. The Cu2+ ion is coordinated by three histidine residues arranged in a distorted tetrahedral geometry. Additionally, many high-resolution SOD structures possess a water molecule that is involved in the coordination. To our knowledge, for the first time in a Cu/Zn-SOD structure a larger anion consisting of multiple atoms was identified in this position; although, it is generally not easy to crystallo­graphically distinguish sulfate from phosphate. The sulfate ion interacts via one of its O atoms, which is at a distance of 2.06 Å from the Cu2+ ion and appears to displace water (Fig. 1 ▸ d and Supplementary Fig. S3). As MOPS and HEPES are sulfonic acids, and sulfate (and also phosphate) was not part of the original crystallization solution and buffer composition, one can consider that the sulfate electron density might be part of a disordered buffer molecule or could alternatively originate from the E. coli culture or the purification environment. The copper ion is not only involved in the redox cycle of the catalytic activity but along with the zinc ion also contributes to the stability of the typical SOD β-barrel motif (Assfalg et al., 2003 ▸). Hence, it might be hypothesized that the observed ligand ion of the complex could stabilize the protein at an elevated stress level in E. coli, although the requirements for formation of the copper complex are not fully understood in vivo. In human SOD1 in E. coli cells copper was reported to be absent in the context of NMR experiments (Banci et al., 2011 ▸). The catalytic activity of OvEC-SOD seems to be independent of the presence of a conserved water molecule (Banci et al., 1989 ▸). In OvEC-SOD, His63 forms a ‘bridge’ between the Cu2+ and Zn2+ ions, with distances of 3.2 and 2.0 Å, respectively. The Cu–His63–Zn imidazolate bridge is intact in the oxidized form of the enzyme. In the reduced form of the enzyme this bond is broken and the catalytic metal becomes three-coordinated (Ascone et al., 1997 ▸). In the oxidized form, the typical distance between copper and zinc should be approximately 6.0 Å, while in the reduced form of the enzyme this distance should be around or greater than 6.5 Å. The crystal structure of OvEC-SOD revealed that this bond was broken at a distance of 6.9 Å between the metal ions (Fig. 1 ▸ d). The active-site channel is formed in part by the disulfide loop, i.e. residues 48–62, and in part by the electrostatic loop, i.e. residues 130–146. The latter provides the electrostatic potential to drive the substrate to the reaction site with a major regulatory potential depending on charge and conformation (García-Gutiérrez et al., 2011 ▸). However, the entrance of the channel to the active site varies in sequence and also in structure when comparing OvEC-SOD with the homologous human enzyme. In human Cu/Zn-SOD this electrostatic loop is positively charged overall, while OvEC-SOD contains more nonpolar and negatively charged residues. In OvEC-SOD the loop is ordered, with well defined 2F o − F c electron density. The active-site channel is maintained by the conserved intramolecular disulfide bond. The side chain of Arg146, which is the residue responsible for the correct orientation of superoxide in the catalytic cavity and is highly conserved, is stabilized by hydrogen bonding to the carbonyl O atom of Cys57.

SAXS

Monodisperse solutions containing purified OvEC-SOD after affinity-tag cleavage were used in SAXS measurements to confirm the crystallographic dimer and analyze the solution structure (Fig. 2 ▸). There was no indication of concentration-dependent oligomerization. The scattering amplitudes recorded at different concentrations were averaged, resulting in the scattering pattern displayed in Fig. 2 ▸(a). SAXS data-collection parameters and characteristics of the protein are summarized in Supplementary Table S1.
Figure 2

Solution structure of OvEC-SOD. (a) Averaged normalized scattering intensities (blue) plotted against the momentum transfer s as obtained by SAXS. The calculated fit curve (green) is a comparison with the ab initio model shown as gray spheres in (c). (b) Scattering intensities and fit curve as shown in (a) superposed with additional fit curves of the OvEC-SOD dimer crystal structure with the SAXS data using either CRYSOL (magenta) or SREFLEX (yellow) for structural comparison. (c) Superposition of the OvEC-SOD dimer crystal structure in green and the ab initio model of OvEC-SOD based on the SAXS data.

The molecular mass of 38 ± 2 kDa was estimated from the forward scattering using bovine serum albumin as a reference protein. This approximation indicates that OvEC-SOD is dimeric in solution. An experimental R g of 2.55 ± 0.01 nm and a D max of 9 ± 1 nm were determined. The ab initio structure was calculated using scattering vectors up to s = 0.4 Å−1 and indicated a rhomboidal shape that was superposed with the crystal structure. The fit curve of this ab initio model is shown in Fig. 2 ▸(a). Comparison of the experimental SAXS scattering data with theoretical scattering curves calculated using the crystal structure of the OvEC-SOD dimer resulted in the optimized fit curves shown in Fig. 2 ▸(b). Considering the additional conformational flexibility of OvEC-SOD in solution, the experiment confirms that the OvEC-SOD dimer seen in the crystal resembles the overall structure of the protein in solution well. The core of the solution structure is formed by the presumably more rigid β-sheets surrounded by loop regions and helices at both ends of the elongated dimer, rendering the ab initio structure shown in Fig. 2 ▸(c). The scattering data including the described fitting is available in the Small Angle Scattering Biological Data Bank (SASBDB) as entry SASDPF2. According to Muñoz et al. (2005 ▸), the dimerization of SODs in solution is typical and vital for their catalytic function. Dimer-destabilizing mutations of Cu/Zn-SODs have been related to a number of degenerative motor neurone diseases (Téllez-Valencia et al., 2004 ▸; Hough et al., 2004 ▸), with a very complex maturation pathway of the dimeric functional holo-enzyme, as recently summarized for SOD1 (Trist et al., 2021 ▸).

Previously identified inhibitors and their potential binding sites

50 compounds from the LeadQuest library were selected in silico and screened in vitro for inhibition of T. solium SOD in a previous approach (García-Gutiérrez et al., 2011 ▸). A set of polyaromatic compounds within this library showed inhibition of T. solium SOD in vitro, with IC50 values in the micromolar range. They were predicted to bind outside the highly conserved active site with specificity for T. solium SOD over the human homologue by in silico docking (García-Gutiérrez et al., 2011 ▸). Docking scores are summarized in Supplementary Table S2. Since the residues directly or indirectly involved in metal binding are conserved among Cu/Zn-SODs, binding outside the narrow core active site in regions with lower sequence conservation is of particular interest for the development of highly species-specific SOD inhibitors. García-Gutiérrez and coworkers searched for potentially druggable binding cavities in silico, which may indicate an option to interfere with the catalytic activity of T. solium SOD. Similarly, we considered in silico predictions provided by the FTmap server utilizing small-molecule docking across the entire protein surface. FTmap predicted a wide central cleft, which is formed by both protomers of the OvEC-SOD dimer, as a ‘hotspot’ for interaction with small molecules from the default FTmap library. The patterns of small-molecule interaction are notably different for the three homologue proteins that were analyzed despite the similarity of the proteins (Supplementary Fig. S4). This wide cleft spanning halfway around the narrow side of the dimer close to the dimerization site overlaps with a binding site considered and previously used in docking studies by García-Gutiérrez and coworkers. Utilizing this cleft as the definition of the region of interest, three of the previously analyzed T. solium Cu/Zn-SOD inhibitors were selected for a similar docking approach with OvEC-SOD. Specifically, the targeted core of this cleft comprises amino acids 62–64, 104–113 and 152 of the OvEC-SOD structure. This location is separated from the active site and hence the docking does not interfere with the metal-coordination sites. García-Gutiérrez and coworkers hypothesize that one explanation for the observed inhibition could be local restrictions of loop movement in close proximity to the abovedescribed cleft, resulting in reduced substrate delivery to the active site upon compound binding. The three docked compounds are indicated to specifically interact with partly differing sections of the targeted cleft, as shown in Figs. 3 ▸(a)–3 ▸(c). The putative mechanism of binding is mainly assured through hydrophobic interactions and involves both protomers of the dimer, both of which are in agreement with the binding sites reported for T. solium SOD. A hydrogen bond to compounds 1545-7806 and 1502-3317 is formed via the backbone of the conserved Leu106 of OvEC-SOD. Favoring species specificity, Arg3 and Arg107 of OvEC-SOD, which contribute hydrophobic interactions with all three described ligands, as well as several amino-acid side chains between positions 107 and 115, which hydrophobically interact with at least one of the compounds, are not conserved. Previously, in the comparison of T. solium SOD and the homologue from H. sapiens, the partly nonconserved residues Thr107 and Ser111 were highlighted by García-Gutiérrez and coworkers; however, T. solium and O. volvulus share a serine at position 111. Detailed two-dimensional ligand-binding site plots for the docked compounds are displayed in Supplementary Fig. S5.
Figure 3

Docking of LeadQuest compounds to OvEC-SOD (gray): (a) ID 1545-7806 (molecular mass 426.5 g mol−1; C23H26N2O4S), (b) ID 1460-00055 (molecular mass 562.6 g mol−1; C30H28F6N2O2), (c) ID 1502-3317 (molecular mass 438.6 g mol−1; C77H87F6N11O10S).

The docking scores obtained for OvEC-SOD are slightly different from the values obtained for T. solium Cu/Zn-SOD, as summarized in Supplementary Table S2. However, for both homologues a higher affinity compared with the human SOD homologue is indicated in silico. A careful verification of these predictions by further in vitro experiments and by means of structural biology is nonetheless desirable, also considering the challenges in state-of-the-art docking approaches as summarized by Zev and coworkers in the context of a protease (Zev et al., 2021 ▸). Further understanding of the mode of action of the compounds, potential off-target effects and options for allosteric specific inhibition of SODs would provide a solid perspective for structure-based optimization of the compounds based on the presented crystallographic data. In summary, the widely conserved structure of OvEC-SOD was solved and compared with its solution structure, which comprises an elongated dimer. Differences in metal-ion coordination are discussed. Based on the individual surface areas of OvEC-SOD and related enzymes, initial suggestions for achieving species specificity in inhibitor development remain to be expanded. PDB reference: extracellular Cu/Zn superoxide dismutase, 5in2 SASBDB reference: extracellular Cu/Zn superoxide dismutase, SASDPF2 Supplementary Figures and Tables. DOI: 10.1107/S2053230X22005350/no5193sup1.pdf
  55 in total

1.  Deciphering conformational transitions of proteins by small angle X-ray scattering and normal mode analysis.

Authors:  Alejandro Panjkovich; Dmitri I Svergun
Journal:  Phys Chem Chem Phys       Date:  2016-02-17       Impact factor: 3.676

2.  Molecular replacement with MOLREP.

Authors:  Alexei Vagin; Alexei Teplyakov
Journal:  Acta Crystallogr D Biol Crystallogr       Date:  2009-12-21

3.  Cleavage of structural proteins during the assembly of the head of bacteriophage T4.

Authors:  U K Laemmli
Journal:  Nature       Date:  1970-08-15       Impact factor: 49.962

4.  Crystal structure of Cu / Zn superoxide dismutase from Taenia solium reveals metal-mediated self-assembly.

Authors:  Alejandra Hernández-Santoyo; Abraham Landa; Edith González-Mondragón; Martha Pedraza-Escalona; Ricardo Parra-Unda; Adela Rodríguez-Romero
Journal:  FEBS J       Date:  2011-08-08       Impact factor: 5.542

Review 5.  Eukaryotic copper-only superoxide dismutases (SODs): A new class of SOD enzymes and SOD-like protein domains.

Authors:  Natalie G Robinett; Ryan L Peterson; Valeria C Culotta
Journal:  J Biol Chem       Date:  2017-12-19       Impact factor: 5.157

6.  Bacterial endosymbionts of Onchocerca volvulus in the pathogenesis of posttreatment reactions.

Authors:  Paul B Keiser; Stacey M Reynolds; Kwablah Awadzi; Eric A Ottesen; Mark J Taylor; Thomas B Nutman
Journal:  J Infect Dis       Date:  2002-02-19       Impact factor: 5.226

7.  The folding of human active and inactive extracellular superoxide dismutases is an intracellular event.

Authors:  Steen V Petersen; Torsten Kristensen; Jane S Petersen; Lasse Ramsgaard; Tim D Oury; James D Crapo; Niels C Nielsen; Jan J Enghild
Journal:  J Biol Chem       Date:  2008-04-02       Impact factor: 5.157

8.  Brugia malayi: localisation and differential expression of extracellular and cytoplasmic CuZn superoxide dismutases in adults and microfilariae.

Authors:  X Ou; L Tang; M McCrossan; K Henkle-Dührsen; M E Selkirk
Journal:  Exp Parasitol       Date:  1995-05       Impact factor: 2.011

9.  Selective activity of extracts of Margaritaria discoidea and Homalium africanum on Onchocerca ochengi.

Authors:  Fidelis Cho-Ngwa; Melanie Abongwa; Moses N Ngemenya; Kennedy D Nyongbela
Journal:  BMC Complement Altern Med       Date:  2010-10-28       Impact factor: 3.659

10.  Signal sequence analysis of expressed sequence tags from the nematode Nippostrongylus brasiliensis and the evolution of secreted proteins in parasites.

Authors:  Yvonne M Harcus; John Parkinson; Cecilia Fernández; Jennifer Daub; Murray E Selkirk; Mark L Blaxter; Rick M Maizels
Journal:  Genome Biol       Date:  2004-05-18       Impact factor: 13.583

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.