Naoki Hasunuma1, Masahiro Kawakami1, Hirotsugu Hiramatsu2, Takakazu Nakabayashi1. 1. Graduate School of Pharmaceutical Sciences, Tohoku University Sendai 980-8578 Japan takan@m.tohoku.ac.jp. 2. Department of Applied Chemistry and Institute of Molecular Science, National Chiao Tung University 1001, Ta-Hsueh Road Hsinchu 30010 Taiwan.
Fullerene (C60) and its derivatives have received considerable attention over the last two decades due to their wide range of applications such as in photovoltaic and artificial photosynthetic devices.[1-3] In the field of medicine and biochemistry, much effort has been devoted to the application of fullerenes to photodynamic therapy (PDT) since fullerenes have the ability to efficiently generate singlet oxygen, which is one of the reactive oxygen species (ROS), upon photoexcitation.[4-7] Singlet oxygen is generated from energy transfer from the triplet excited state of C60 to O2 in the ground triplet state, and C60 exhibits a very high quantum yield of the formation of the triplet state from the singlet excited state (∼0.96 for C60 in benzene[8]), resulting in the efficient generation of singlet oxygen. However, fullerenes are completely insoluble in water, which precludes their application to most biological systems. Chemical modifications such as the addition of hydroxyl groups have been performed to solubilize fullerenes in water.[9-13] Other methods such as the inclusion of organic macromolecules,[14-16] laser ablation,[7,17] and solvent substitution methods[18] have also been proposed. A variety of water-soluble fullerene derivatives have now been chemically synthesized; however, a sufficient amount of fullerene derivative seems not to be readily prepared in many cases. Simple methods for preparing sufficient amounts of water-soluble fullerenes are necessary for the purpose applying fullerenes to a variety of biochemical methodologies.In the present study, we have shown that C60 becomes soluble in water simply by mixing C60 and amyloid β 1-40 (Aβ40) peptide in distilled water. A pale yellow aqueous solution was obtained just after stirring the mixture. The solubility of C60 in water results from the generation of a complex between C60 and Aβ (Aβ40-C60). Herein, we have investigated (i) the generation, fundamental properties, and stability of Aβ40-C60, (ii) the inhibition of fibrillation of Aβ40 using Aβ40-C60 and light, and (iii) the application of Aβ40-C60 in PDT.Aβ peptides have extensively been studied due to their role in the development of Alzheimer's disease.[19,20] Aβ peptides are generated from β-amyloid precursor protein, and the oligomeric and fibril forms of Aβ have been reported to be toxic and causative agents in the pathogenesis of Alzheimer's disease. Therefore, investigations into the inhibition of Aβ fibrillation from monomer peptides are important to suppress the progression of Alzheimer's disease.[21-27] If ROS generated by photoexcitation of fullerenes can be applied to Aβ, there is a possibility that Aβ fibrillation can be inhibited by fullerenes and light. Actually, the inhibition of Aβ fibrillation by photoirradiation of water-soluble fullerene derivatives was reported[28,29] and these fullerenes are expected to be fibril inhibitors like the photoactive compounds recently reported.[30-33] The present Aβ40-C60 also exhibits the photo-induced activity to inhibit the fibrillation of Aβ40.
Experimental
Preparation of Aβ40
Aβ40 was synthesized using a peptide synthesizer (431A, Applied Biosystems) and the crude product was purified with HPLC systems (JASCO) equipped with an ODP-50 column (Shodex). 5 mM ammonium acetate (pH 10.5) and acetonitrile were used as hydrophilic and hydrophobic mobile phases, respectively. Molecular weight of the purified peptide determined by ESI mass spectrometry (solariX, Bruker) agreed with the monoisotopic mass of the Aβ40 peptide.[34]The Aβ40 peptide was dissolved into doubly-distilled water (0.35 mg mL−1), and the solution was adjusted to pH 10.5 using an aqueous solution of NaOH. The solution was left at room temperature for 1 h to dissolve irregular and unexpected aggregates, and was then centrifuged (16 100 rcf, 10 min). The supernatant containing only the monomeric species of Aβ40 was diluted with an aqueous solution of NaOH (pH 10.5) and the concentration of Aβ40 was adjusted to 80 μM using the molar absorption coefficient of a tyrosine residue of Aβ40 at 275 nm (1410 M−1 cm−1).[35]
Preparation of Aβ40-C60 complex
2 mg of fullerene (C60) powder (Kanto Kagaku) was added to 1 mL of the aqueous solution of Aβ40 (80 μM) at pH 10.5. The solution was stirred (ca. 800 rpm) at 4 °C for 120 h in a glass vial, followed by centrifugation (16 100 rcf, 10 min). The supernatant was collected and used as the solution of the Aβ40-C60 complex. The concentration of C60 in aqueous solution was in the range of 20–60 μM. For the evaluation of the concentration, we used the peak of the absorption of Aβ40-C60 at 342 nm with the assumption that its molar absorption coefficient is the same as that of the peak of the absorption of C60 at 334 nm in o-dichlorobenzene (5.2 × 104 M−1 cm−1).[36]
Inhibitory effect on fibrillation of Aβ40
Sample solution was prepared by mixing 300 μL of Aβ40-C60 and/or Aβ40 aqueous solution and 300 μL of buffer solution containing 40 mM Tris and 300 mM NaCl. The final concentration was ∼40 μM Aβ40 and 10–30 μM C60 with 20 mM Tris, 150 mM NaCl. To examine the effect of photoirradiation on the fibrillation of Aβ40, two sample tubes were separately prepared and incubated at 37 °C for 5 days. One was incubated without any pre-treatment, while the other was placed into a 1 cm quartz black cuvette and was irradiated with 488 nm cw laser light (Spectra-Physics) at 140 mW for 1 h in prior to the incubation. Fibrillation was monitored with measurements of circular dichroism (CD) and thioflavin T (ThT) fluorescence assay.
Preparation of cells
HeLa cells were cultured in a 10 cm dish (Corning) filled with Dulbecco's Modified Eagle's Medium (DMEM) at 37 °C in the presence of 5% CO2. The cells were cultured until 80% confluent, and the cells were washed with phosphate buffered saline without Ca2+ and Mg2+ (PBS(−)) after removing DMEM. Then the HeLa cells were prepared with trypsin–EDTA treatment. After trypsin–EDTA was removed, DMEM was added to the dish, and the cell suspension was transferred to a centrifuge tube. DMEM was prepared as follows: Dulbecco's modified Eagle's medium (D5796, Sigma) was mixed with Fetal bovine serum (10 vol%) (10437-028, Gibco) and Penicillin G–Streptomycin sulfate (5 vol%) (15070-063, Gibco). PBS(−) containing NaCl (8.00 g L−1), KCl (0.20 g L−1), Na2HPO4 (1.15 g L−1), and KH2PO4 (0.20 g L−1) was used for the experiments after autoclaving at 120 °C for 20 min.
Thioflavin T fluorescence assay
30 μL of aqueous solution including Aβ40-C60 and/or Aβ40 was mixed with 1.3 mL of thioflavin T (ThT) solution containing 5 μM ThT and 50 mM Gly-NaOH (pH 8.5), and left for 10 min at room temperature in dark to ensure the staining of Aβ40 fibrils. Then, the sample solution was placed in a 1 cm quartz cuvette and the fluorescence intensity at 485 nm was recorded for 3 min using a FP-6500 spectrofluorometer (JASCO). The excitation wavelength was 455 nm and the spectral slit width was set at 5 nm for both excitation and emission measurements. The average intensity for 3 min was plotted against the fibrillation reaction. To avoid sedimentation of insoluble aggregates, the sample solution was gently stirred with a stirrer in the cuvette during the measurement.
ADPA absorption assay
Anthracene-9,10-dipropionic acid (ADPA) was commercially obtained from Chemodex Ltd. and was dissolved in aqueous solution whose pH was adjusted to pH 10.5 using an aqueous solution of NaOH. Then, 300 μL of the prepared ADPA solution was mixed with the same amount (300 μL) of Aβ40-C60 aqueous solution and the final concentrations of ADPA and C60 in the mixture were ∼80 μM and ∼20 μM, respectively. Then the mixed solution was placed into a 1 cm quartz black cuvette and was irradiated with 488 nm cw laser light (140 mW). The absorption spectrum of the solution was measured at each photoirradiation time.The yield of the generation of singlet oxygen (ΦROS) was estimated from the magnitude of the decrease in the absorption of ADPA at 399 nm (8300 M−1 cm−1). The ΦROS value of Aβ40-C60 was estimated from that of rose bengal (ΦROS = 0.76 (ref. 37)) as a reference.
Spectroscopic analyses
UV-vis absorption spectra were recorded using a U-3300 spectrophotometer (HITACHI) with a 1 cm quartz cuvette with black wall. Dynamic light scattering was measured using DynaPro-99 (Wyatt/ProteinSolutions) with a quartz cuvette of 3 mm optical path. CD spectra were recorded by a J-820 spectropolarimeter (JASCO, Japan) with a 0.5 mm quartz cell.Electrospray ionization (ESI) mass spectra were measured using a solariX mass spectrometer (Bruker Daltonics). The lyophilized powder formed by the aqueous solution of Aβ40-C60 with or without photoirradiation was dissolved in CH3CN–H2O (1 : 1, v/v) and their mass spectra were measured with the ESI method. The photoirradiation of the aqueous Aβ40-C60 solution was performed in a 1 cm quartz cuvette with black wall with 488 nm cw laser light at 140 mW for 1 h as mentioned above.The images of transmission electron microscope (TEM) were measured using a HF-2000 field-emission TEM (FE-TEM) (Hitachi) operating at 200 kV. The measurement sample was prepared by placing droplets of the sample aqueous solution on a copper grid and drying it in air.
Viability of cells
100 μL aliquots of the cell suspension (5 × 103 cells/100 μL) were dispensed into the wells of two 96 well plates (thermo scientific). After incubation of the two plates at 37 °C for 24 h in 5% CO2, DMEM was replaced with 100 μL Hanks' balanced salt solution (HBSS; H8264, Sigma) containing Aβ40-C60 and/or Aβ40, whose pH was adjusted to 8.1. The final concentration of Aβ40 in each well for the test of Aβ40 only was ∼16 μM. For the test of Aβ40-C60, the final concentration of C60 was 20 μM in each well. The molar absorption coefficient of C60 in o-dichlorobenzene was used for evaluating the concentration of C60, as mentioned above. One plate was irradiated with 30 W LED light for 2 h at 30 °C in the incubator (i.e., the photoirradiated condition), while the other plate was shaded in a box and left at 30 °C for 2 h (i.e., the dark condition). After the 2 h treatment, HBSS in each well was replaced with DMEM and the two plates were incubated for additional 18 h at 37 °C in 5% CO2. Then, 10 μL of the solution of WST-8 dye (Cell count reagent SF, Nacalai Tesque) was added to each well and the cell viability was examined according to the protocol of the manufacturer. Absorbance at 450 nm was recorded using a plate reader (SpectraMax Paradigm, Molecular devices).
Results
We have used Aβ40 (1DAEFRHDSGYEVHHQKLVFFAEDVGSNK-GAIIGLMVGGVV[40]) as the amyloid peptide in the present study. This peptide constitutes ∼90% of the secreted Aβ peptides and is abundant in the brain.[38,39] Fig. S1 in ESI† shows the photograph of the aqueous solution of C60 solubilized with Aβ40. Water-soluble C60 was prepared only by adding C60 into aqueous solution of purified Aβ40 at pH 10.5 and stirring the mixture for 5 days at 4 °C. Then the mixture was centrifuged and the supernatant solution with pale-yellow color (Fig. S1†) was obtained. Since C60 is not dispersed in water without Aβ40, C60 is solubilized in water with the interaction with Aβ40.Fig. 1 shows the absorption spectra of prepared Aβ40-C60 in water. All the observed bands arise from C60 and the two bands at around 260 and 340 nm are the symmetry-allowed transitions to 61T1u and 31T1u from the ground state (11Ag), respectively.[40,41] The shape of the absorption spectrum is similar to that of C60; however, the band shape becomes broader compared with that of the monomer species in heptane (Fig. S2†). The broadening of the absorption bands is generally observed with the formation of C60 clusters in water prepared by the laser-ablation method,[7,17] encapsulation with natural protein surfactants,[16] and extended mixing.[41] The present result therefore indicates that Aβ40-C60 molecules also exist as clusters encapsulated with Aβ. The broadness of the cluster may come from the increase in electronic transition densities due to C60–C60 and C60-water interactions and heterogeneity of the size and the shape of the cluster.[41] The visible absorption band that is assignable to intermolecular interactions between neighboring molecules in C60 clusters[17] is also observed around 450 nm. It has been reported that the intensity of the visible band around 500 nm relative to that of the transition to 31T1u (∼340 nm) increases with particle size.[41] The size of Aβ40-C60 was estimated by dynamic light scattering to be 50–60 nm. The presence of Aβ40-C60 clusters was also confirmed by TEM (Fig. S3†). The particles with a diameter of ∼50 nm were observed in the TEM image. The number of C60 constituting the cluster is ∼3.5 × 105 when the cluster has a diameter of 50 nm and a sphere.
Fig. 1
Absorption spectra of Aβ40-C60 in water just after preparation (red) and after one month at 4 °C (blue), together with the absorption spectrum of C60 only in water (green).
The prepared Aβ40-C60 was stable and even found to remain unchanged after one month at 4 °C, as shown by the constant shape and the intensity of the absorption spectrum after one month (Fig. 1). Aβ40-C60 can also be used as a pale-yellow powder by lyophilization, and the powder can be re-dissolved in water (Fig. S1†).Aβ40 has both hydrophobic and hydrophilic parts in a single chain and, therefore, it is conceivable that the hydrophobic part of Aβ40 interacts with C60 and the hydrophilic part surrounds C60, resulting in solubilization and stabilization of C60 in distilled water (Fig. S4†). The interactions between Aβ peptides and fullerene were theoretically analyzed and it was proposed from molecular dynamics (MD) simulation that C60 preferentially binds to a sequence of hydrophobic residues 16-20 KLVFF from the N terminus of Aβ40 or Aβ42.[42,43] Aβ40 in the prepared Aβ40-C60 exists as monomer species having random structure, which was clarified by CD spectroscopy, as shown below.We then investigated the application of Aβ40-C60 to the phototherapy of disease. It should be noted that visible light at around 400–550 nm can be used as a photoirradiation source since C60 clusters exhibit absorption in this region (Fig. 1). The photo-induced effects on the fibrillization of Aβ40 were investigated by the measurements of the CD spectra. Aβ40 forms the random structure in monomer species and the β-sheet structure in fibril, which can be distinguished by the shape of the CD spectrum. Aβ40 monomers turn into their fibril form when pH of the aqueous solution is set from basic (pH 10.5) to neutral (pH 7). Therefore, the effect of photoirradiation was examined by irradiation of 488 nm laser light to aqueous solution of Aβ40 just after changing pH to neutral. The irradiation time was 1 h.The results of CD spectra of Aβ40 only are shown in panels A and B of Fig. 2. The secondary structure of a peptide can be determined by the shape of the CD spectrum: the CD spectrum exhibits a negative band at 195–200 nm in the random, a negative band around 215 nm and a positive band at 195–200 nm in the β-sheet, and a positive band at 195–200 nm and two negative peaks at 208 and 222 nm in the α-helix. After ∼1 h from the change to neutral condition, the CD spectrum of Aβ40 only exhibited the negative peak at ∼198 nm irrespective of photoirradiation, which arises from the random structure of Aβ monomer (Fig. 2A). On the other hand, after incubation at 37 °C for 5 days, the shape of the CD spectrum resembled that of the β-sheet structure with positive values at less than 200 nm and a negative peak at ∼210 nm (Fig. 2B). This result indicates that the fibril structure completely occurred after the incubation of 5 days. The fibril formation of Aβ40 only was not affected by photoirradiation at 488 nm after the 5 days incubation.
Fig. 2
CD spectra of Aβ40 only (A and B) and Aβ40-C60 (C and D) after ∼1 hour from the preparation (A and C) and after the incubation of 5 days (B and D) at 37 °C without photoirradiation (blue) and with photoirradiation at 488 nm (red).
Panels C and D of Fig. 2 show the CD spectra of Aβ40-C60 with and without photoirradiation. The CD spectrum of aqueous solution containing Aβ40-C60 also exhibited the negative peak at ∼198 nm after 1 h from the change to neutral condition (Fig. 2C), indicating the dominance of random structure in Aβ40. After incubation for 5 days at 37 °C (Fig. 2D), the CD spectrum of Aβ40-C60 without photoirradiation was changed to that of β-sheet structure, which is the same as that of Aβ40 only. However, upon photoirradiation, Aβ40-C60 exhibited a different CD spectrum having negative values shorter than 200 nm and a negative peak at ∼205 nm (Fig. 2D). This result indicates that the Aβ fibril was not efficiently generated in the aqueous solution including Aβ40-C60 upon photoirradiation at 488 nm. It can be considered that the random structure of Aβ40 still exists in the photoirradiated Aβ40-C60 solution. Fig. 3 shows the decomposition analysis of the CD spectrum of Aβ40-C60 after photoirradiation. The CD spectrum after photoirradiation was well fitted with the linear combination of those of the random and the β-sheet structure (Fig. 3). These results lead us to a conclusion that the fibril formation of Aβ40 is inhibited by Aβ40-C60 upon photoirradiation. Since the Aβ fibril was smoothly generated in the Aβ40-C60 solution without photoirradiation (Fig. 2D), Aβ40-C60 alone has no ability to inhibit the fibril formation with the present C60 concentration, and photoirradiation is necessary to block the fibril formation using Aβ40-C60.
Fig. 3
The observed (red) and fitted (blue) CD spectra of Aβ40-C60 after the incubation for 5 days at 37 °C with photoirradiation at 488 nm, together with the deconvoluted CD spectra of the random (black) and β-sheet (green) structures obtained by the fitting procedure. The CD spectrum of Aβ40-C60 just after the preparation with photoirradiation and that of Aβ40-C60 after the incubation of 5 days at 37 °C without photoirradiation were used as those of the random and β-sheet structures, respectively.
The inhibition on the fibril formation by photoirradiated Aβ40-C60 is also confirmed by ThT fluorescence that exhibits strong fluorescence when Aβ peptides form fibril structures. We have measured the intensity of ThT fluorescence of the solutions of Aβ40 only and Aβ40-C60, respectively, after incubation for 5 days at 37 °C (Fig. 4). The ThT fluorescence of the solution of Aβ40 only remained unchanged upon photoirradiation, confirming the negligible effect of the photoirradiation in absence of C60. The ThT fluorescence of the solution of Aβ40-C60 without photoirradiation exhibited the similar intensity to those of Aβ40 only. This result indicates that the fibril formation was not affected solely by the addition of Aβ40-C60 in the present concentration. On the other hand, the intensity of Aβ40-C60 upon photoirradiation was markedly weaker than those of the other solutions, confirming the suppression of the fibril formation by photoirradiated Aβ40-C60. In conclusion, all the obtained results indicate that Aβ40-C60 inhibits the formation of the amyloid fibril with photoirradiation.
Fig. 4
ThT fluorescence after 5 days incubation of Aβ40 or Aβ40-C60. The experiments without photoirradiation are shown as (−). The wavelength of photoirradiation was 488 nm.
We further studied the induction of cell death using Aβ40-C60. HeLa cells were incubated in a 96-well plate with Aβ40 or Aβ40-C60 and the extent of cell death was evaluated by the WST-8 assay. A visible diode lamp was used as a photoirradiation source. Fig. 5 shows the cytotoxicity results for Aβ40 and Aβ40-C60, which were evaluated by estimating the number of living cells relative to the untreated control with or without photoirradiation. The viability of HeLa cells remained almost unchanged upon introducing Aβ40 or Aβ40-C60, indicating that the toxicity of Aβ40-C60 itself was similar to that of Aβ40 only. The effect of photoirradiation was only observed in Aβ40-C60; the viability decreased to ca. 60% upon application of Aβ40-C60 with photoirradiation. This result indicates that Aβ40-C60 induces cell death only with the photoirradiation. The photo-induced reduction of the viability of cells demonstrates the applicability of Aβ40-C60 to PDT.
Fig. 5
Viability of HeLa cells treated with Aβ40 or Aβ40-C60 relative to untreated control with or without photoirradiation. The experiments without photoirradiation are shown as (−). The wavelength range of photoirradiation was 400–700 nm.
Discussion
In the present study, we have shown that C60 is solubilized in water only by mixing with Aβ40 and that the prepared water-soluble Aβ40-C60 exhibits the efficient inhibition of the fibril formation and the cytotoxicity inducing cell death upon photoirradiation with visible light. These phenomena are considered to arise from singlet oxygen generated via photoexcitation of Aβ40-C60, which comes from the fact that singlet oxygen is generated by photoexcitation of C60, as mentioned in Introduction. The existence of oxidized species after photoirradiation can be confirmed by mass spectrometry.Fig. 6 shows the ESI mass spectra of Aβ40-C60 before and after photoirradiation. In Fig. 6A, the peak at 866.44 both before and after photoirradiation is assigned to the pentavalent charged peptide (C194H295N53O58S + 5H+) and the other main peaks at 722.20 and 1082.79 are assigned to the different charge states, +6 and +4, respectively. In the spectrum after the photoirradiation (Fig. 6B), the monoisotopic mass of 4341.2 is ascribed to the oxidized peptide (C194H295N53O58S + O − 2H) and those of 4355.2 and 4373.2 are the peptides where two sites (C194H295N53O58S + 2O − 4H) and three sites (C194H295N53O58S + 3O − 2H) are oxidized, respectively. All these peaks were not observed in the spectrum without photoirradiation. The peaks assignable to oxidized species in Fig. 6B were not observed in the mass spectra of Aβ40 only after photoirradiation (Fig. S5†). These results lead us to a conclusion that the oxidized Aβ40 peptide exists only in Aβ40-C60 solution with the photoirradiation. It is conceivable that the oxidized species with (−2H + O) and (−4H + 2O) come from the oxidation of the serine and histidine residues that are easily oxidized among amino acids; however, non-specific oxidation of other residues should also be considered because of the existence of the species with (−2H + 3O). These oxidation processes result in the suppression of the fibril formation.
Fig. 6
ESI-mass spectra of Aβ40-C60 without (blue) and with (red) photoirradiation at m/z 200–1500 (A) and 865.5–879.5 (B). The wavelength of photoirradiation was 488 nm.
Only one residue alternation in Aβ has been shown to affect the ability of the fibrillation.[34,44-46] It has been systematically studied for the effect of one mutation of Aβ on the fibril formation:[44,45] the magnitude of the fibrillation depends on the position and the amino acid of the mutation. The oxidation of methionine was also reported to inhibit Aβ fibrillation.[46] The fibrillation is proceeded via hydrophobic and electrostatic interactions among peptides, and the fibrillation rate depends on the absolute value of the charges.[45] Therefore, it is conceivable that the change in the interaction among peptides due to oxygen addition results in the change in the rate or the magnitude of the Aβ fibrillation.We also performed the ROS assay of Aβ40-C60 using the absorption of anthracene-dipropionic acid (ADPA). The absorption of anthracene moiety of ADPA is reduced by the oxidation of ADPA with ROS species, and can be used to quantify ROS.[15] The ΦROS value of Aβ40-C60 was estimated from the magnitude of the decrease in the absorption of ADPA with photoexcitation of Aβ40-C60 (Fig. 7). The same experiment was also performed for rose bengal with the same excitation wavelength as a reference (ΦROS = 0.76 (ref. 37)), and ΦROS of Aβ40-C60 was calculated from the number of absorbed photon and the magnitude of the photo-induced decrease for both the solutions. A decrease in the absorbance of ADPA was observed with the inclusion of Aβ40-C60 and photoirradiation. Since the absorbance of ADPA without Aβ40-C60 remained constant upon photoirradiation, the observed decrease in the ADPA absorption can be ascribed to the generation of ROS via photoexcitation of Aβ40-C60. The yield of the ROS generation was qualitatively estimated to be ∼0.05 (Fig. 7), which is lower than that of C60 monomer. The magnitude of photo-induced cell death of the present Aβ40-C60 was lower than those of other water-soluble fullerenes,[47,48] which may also be due to the small value of ΦROS. The low yield of the ROS generation is thought to arise from the cluster structure; the yield of intersystem crossing of C60 remarkably decreases with cluster formation.[7,17] The yield of the triplet formation may depend on the cluster size[7] and the decrease in the lifetime of the singlet state with the cluster formation prevents the relaxation to the triplet state.[17] The consumption of ROS to the oxidation of the attached peptides should also be considered. We are in progress to prepare Aβ40-C60 with smaller sizes by controlling the mixture time and the stirring speed to increase the efficiency of the ROS generation.
Fig. 7
Absorption spectra of ADPA with Aβ40-C60 (A) and rose bengal (B) after the photoirradiation. The irradiation time was shown on the right of each figure. Absorption spectra of ADPA only are also shown in (C) as a control. The wavelength of photoirradiation was 488 nm for both (A) and (B).
The present result for solubilizing C60 in water provides a method of preparation of a sufficient amount of water-soluble Aβ40-C60. The water-soluble C60 clusters are also prepared by the laser ablation[7,17] and the solvent substitution methods.[18] However, the C60 clusters prepared by laser ablation are not generally protected by macromolecules such as the present Aβ40, and therefore the precipitation of C60 inevitably occurs in buffer solutions (the solutions including large amounts of electrolytes). In the solvent substitution method, trace amounts of residual organic solvent may affect the condition of cultured cells. The present method is applicable to buffer solutions and no organic solvent is used during the preparation, which are the advantage of the present method. Furthermore, the most important point of the present method with regards to the fibril inhibition is that Aβ peptide itself acts as a surfactant for the C60 clusters. No other compound is necessary and Aβ peptide smoothly interacts with other Aβ peptides. The present Aβ40-C60 can be considered to strongly interact with other Aβ peptides, resulting in the photo-induced inhibition of the fibril formation.
Conclusion
It has been shown that C60 becomes soluble in water by forming the complex with Aβ peptides. The prepared complex exhibits the photo-induced activity to induce the inhibition of the Aβ fibrillation and cell death by the generation of singlet oxygen upon photoirradiation. It is also conceivable that other peptides with hydrophobic and hydrophilic parts in a chain can be used to solubilize C60 in water. In future studies, the preparation of very small C60 clusters using other peptides will be examined. Finally, we believe that the present water-solubilization method using peptides will expand the application potential of the photo-induced phenomena of fullerenes and other carbon materials to a variety of biological systems.
Authors: Cecilia Månsson; Paolo Arosio; Rasha Hussein; Harm H Kampinga; Reem M Hashem; Wilbert C Boelens; Christopher M Dobson; Tuomas P J Knowles; Sara Linse; Cecilia Emanuelsson Journal: J Biol Chem Date: 2014-09-12 Impact factor: 5.157