Literature DB >> 35334990

Prediction of SARS-CoV-2 Omicron Variant Immunogenicity, Immune Escape and Pathogenicity, through the Analysis of Spike Protein-Specific Core Unique Peptides.

Evangelos Kontopodis1,2, Vasileios Pierros1, Dimitrios J Stravopodis2, George T Tsangaris1.   

Abstract

The recently discovered Omicron variant of the SARS-CoV-2 coronavirus has raised a new, global, awareness. In this study, we identified the Core Unique Peptides (CrUPs) that reside exclusively in the Omicron variant of Spike protein and are absent from the human proteome, creating a new dataset of peptides named as SARS-CoV-2 CrUPs against the human proteome (C/H-CrUPs), and we analyzed their locations in comparison to the Alpha and Delta variants. In Omicron, 115 C/H-CrUPs were generated and 119 C/H-CrUPs were lost, almost four times as many compared to the other two variants. At the Receptor Binding Motif (RBM), 8 mutations were detected, resulting in the construction of 28 novel C/H-CrUPs. Most importantly, in the Omicron variant, new C/H-CrUPs carrying two or three mutant amino acids were produced, as a consequence of the accumulation of multiple mutations in the RBM. These C/H-CrUPs could not be recognized in any other viral Spike variant. Our findings indicated that the virus binding to the ACE2 receptor is facilitated by the herein identified C/H-CrUPs in contact point mutations and Spike cleavage sites, while the immunoregulatory NF9 peptide is not detectably affected. Thus, the Omicron variant could escape immune-system attack, while the strong viral binding to the ACE2 receptor leads to the highly efficient fusion of the virus to the target cell. However, the intact NF9 peptide suggests that Omicron exhibits reduced pathogenicity compared to the Delta variant.

Entities:  

Keywords:  COVID-19; Omicron variant; SARS-CoV-2; Spike protein; Uniquome; core unique peptide; immune escape; infectiveness; mutation; pathogenicity

Year:  2022        PMID: 35334990      PMCID: PMC8955659          DOI: 10.3390/vaccines10030357

Source DB:  PubMed          Journal:  Vaccines (Basel)        ISSN: 2076-393X


1. Introduction

The SARS-CoV-2 virus has a high mutagenesis frequency, hitherto producing 63 different variants with 39 considered as the most predominant forms, including Delta, the dominant variant of the 4th pandemic wave [1]. Recently, a new variant, Omicron (B.1.1.529), was identified in South Africa. Omicron is characterized by 30 amino acid changes, three small deletions, and one small insertion in Spike protein, as compared to the original virus, with 15 of them residing in the Receptor Binding Domain (RBD) from 319 to 541 amino acid residues [2]. In our previous studies, we have defined as Unique Peptides (UPs) the peptides whose amino acid sequence appears only in one protein across a given proteome. We also introduced the term of Core Unique Peptides (CrUPs), which are the peptides with a minimum amino acid sequence length that appear only in one protein across a given proteome, thus having a unique signature for a particular protein identification [3]. Therefore, each peptide of any size that contains a CrUP is considered a UP. Peptides of bigger sizes than CrUPs being constructed by continuous CrUPs are considered as Composite Core Unique Peptides (CmUPs). Hitherto, our results regarding the analysis of CrUPs in different species and organisms strongly suggest that CrUPs constitute a concrete group of peptides within a given proteome, with specialized properties and functions Thereby, we have introduced the new term “Uniquome”, which is defined as the total set of UPs belonging to a given proteome and serving as its unique molecular signature. Hence, to map the UP landscape of a proteome under examination, we have herein developed a novel and advanced bioinformatics tool, including big data analysis, and we have applied this tool for the analysis of Uniquome typifying all model organisms. In Homo sapiens, the analysis of the 20,430 reviewed proteins resulted in the identification of 7,263,888 CrUPs which construct the human Uniquome (hUniquome) ([3] and Kontopodis et al., 2022 (manuscript in preparation)). Most importantly, to elucidate SARS-CoV-2 virus–host organism interactions, we have further designed a novel bioinformatics platform to analyze the Core Unique Peptides (CrUPs) of the SARS-CoV-2 virus against the human proteome (C/H-CrUPs) [1]. C/H-CrUPs represent a completely new set of peptides, which are the shortest in length peptides in a viral proteome that do not exist in the human proteome [3]. Based on their properties, the viral C/H-CrUPs could advance our knowledge regarding virus–host interactions, immune system response(s), and infectiveness and pathogenicity of the virus. Moreover, most importantly, they can be used as antigenic and diagnostic peptides, and likely druggable targets for successful therapeutic treatments. In the present study, we have identified, cataloged, and analyzed Omicron-specific C/H-CrUPs in order to illuminate the mechanisms controlling infectivity, immune escape, and pathogenicity of the new variant.

2. Materials and Methods

2.1. Methods

In our previous, recent studies, we developed a bioinformatics tool that can extract the Core Unique Peptides (CrUPs) from a given proteome, thus creating its Uniquome (Figure S1) [1,3]. We have expanded this tool by introducing a new feature that can extract the CrUPs of each individual protein of a given proteome (target) versus the proteins of a reference proteome. This new feature, like the initial implementation, will split each protein in the target proteome to all possible peptides of length minimum (4 amino acids) to length maximum (100 amino acids), and search them against the reference proteome. Each search will exclude all peptides that contain a smaller peptide already identified as CrUP (Figure S2). For the present study, we have engaged this new feature of our tool. We created a “custom” proteome consisting of sequences from all variants of the SARS-CoV-2 Spike proteins and used it as the target versus the human proteome. The tool produces as output the C/H-CrUPs per protein of the target proteome, thus revealing the CrUPs for each Spike variant versus the human proteome. Once we obtained the desired data, we ran a meta-analysis to identify how many C/H-CrUPs remained the same, or were added or lost on each variant versus the wild-type Spike protein. For this analysis, initially we took the identified C/H-CrUPs of the wild-type sequence and checked their presence against the respective C/H-CrUPs of the other variants. We only cared for the amino acid sequence and not the position this could be found within the protein. If the sequence was found, then we considered the peptide to be the same, otherwise we considered it to be lost on the examined variant. Next, we analyzed the identified C/H-CrUPs of each variant versus the wild-type sequence. If the peptide was detected only on the variant’s C/H-CrUPs, then we considered it as added. This meta-analysis also provided us with the position of each C/H-CrUP within the Spike protein, which we used to determine the area (e.g., RBD, RBM and S-cleavage site, as obtained by the Stanford COVID-19 Database) they resided in.

2.2. Databases

All proteomes and proteins were obtained from Uniprot. SARS-CoV-2 wild-type and variant sequences, and mutations were obtained from the Stanford COVID-19 Database (https://covdb.stanford.edu/page/mutation-viewer/, accessed on 23 December 2021).

3. Results and Discussion

3.1. Mapping the C/H-CrUPs Landscape of Spike Protein of the SARS-CoV-2 Omicron Variant

SARS-CoV-2 virus seems to be highly mutated, so far producing more than 60 distinct variants. Hitherto, the highest pathogenic form is the Delta variant (B.1.617.2), with 10 different sub-variants. Recently, a novel variant called Omicron has been identified. It is characterized by 30 amino acid changes, three small deletions, and one small insertion in the Spike protein area, as compared to the wild-type viral respective sequence (Figure S3) [2]. Out of these genetic changes, 15 reside in the Receptor Binding Domain (RBD) from amino acid position 318 to 541, and two are located around the S-cleavage site(s) (Figure S3). Advanced bioinformatics analysis of the Omicron variant Spike protein showed that it contains 983 C/H-CrUPs, a number that is comparable to the one of wild-type Spike proteins (987 C/H-CrUPs) and to the mean ± SD value of Spike protein-specific C/H-CrUPs (983 ± 2 C/H-CrUPs) (Table 1). Omicron variant Spike protein contains 34 mutations in total, which is the highest number of identified mutations among all virus variants.
Table 1

SARS-CoV-2 Spike protein C/H-CrUPs across variants, as compared to the wild-type virus respective sequence.

Spike Protein
VariantC/H-CrUPsSame C/H-CrUPs% of Same C/H-CrUPsNew C/H-CrUPs% of New C/H-CrUPsLost C/H-CrUPs% of Lost C/H-CrUPs
Wild-type virus 987
Alpha (B.1.1.7) + (Q1-Q4) 98293194.8515.2565.7
Alpha (B.1.1.7 + E484K) 98392894.4555.6596.0
Alpha (B.1.1.7 + L452R) 98193695.4454.6515.2
Alpha (B.1.1.7 + S494P) 98193695.4454.6515.2
Beta (B.1.351) 98195497.2272.8333.3
Beta (B.1.351 + E516Q) 98194996.7323.3383.8
Beta (B.1.351 + L18F) (B.1.351.2-3) 97994896.8313.2393.9
Beta (B.1.351 + P384L) 98094996.8313.2383.9
Gamma (P.1) (P.1.1 - P.1.2) 98593094.4555.6575.8
Gamma (P1 + P681H) 98593094.4555.6575.8
Delta (B.1.617.2) 98494896.3363.7394.0
Delta (B.1.617.2 + E484Q) 98494596.0393.4424.3
Delta (B.1.617.2 + K417N) 98494495.9404.1434.4
Delta (B.1.617.2 + Q613H) 98494796.2373.8404.1
Delta (AY.1) 98494495.9404.7434.1
Delta (AY.2) 98593995.3464.8484.9
Delta (AY.3 - AY.8) + (AY.12) 98395196.7323.3363.7
Delta (AY.9) 98395196.7323.3363.6
Delta (AY.10) 98395196.7323.3363.6
Delta (AY.11) 98395196.7323.3363.6
Eta (B.1.525) 99095696.5343.4313.1
Iota (B.1.526) 98496097.5242.4272.7
Kappa (B.1.617.1) 98596497.8212.1232.3
Lambda (C.37) 98294996.6333.4383.9
Mu (B.1.621) 98395396.9303.1343.4
Omicron (B.1.1.529) 98386888.311511.711912.1

New C/H-CrUPs is the number of new constructed peptides of each variant compared to C/H-CrUPs of wild-type virus; % of new C/H-CrUPs is the % of new constructed peptides compared to the total C/H-CrUPs number of each variant; Lost C/H-CrUPs is the number of peptides lost in each variant compared to C/H-CrUPs of wild-type virus; % of lost C/H-CrUPS is the % of lost peptides compared to the total C/H-CrUPs number of each variant.

These mutations seem to have a dramatic effect on the Spike protein C/H-CrUPs map. Compared to the wild-type Spike sequence, we found that 115 (new) C/H-CrUPs were created and 119 C/H-CrUPs were lost, almost twice as many when compared to the Alpha variant (51 and 56 C/H-CrUPs, respectively), and almost four times as many, compared to the other variants (Table 1). The distribution of these new C/H-CrUPs shows that the majority carry 6 amino acids in length (Figure S4).

3.2. Omicron-Specific C/H-CrUPs That belong to the Receptor Binding Domain

SARS-CoV-2 belongs to the β coronavirus group, which uses the plasma membrane receptor of Angiotensin-Converting Enzyme 2 (ACE2) to recognize and bind to the target cell [4]. The viral Spike protein attaches to ACE2 receptor by a Receptor Binding Domain (RBD) defined from amino acid position F318 to F541 [4,5]. The amino acid residues from W436 to Q506 inside RBD shape the Receptor Binding Motif (RBM), which carries 11 contact positions with ACE2 [5]. The RBD region has received great attention, as it seems to be a major target of antibodies against the virus and other therapeutic interventions [6,7,8]. In the RBD region, the Omicron variant carries 15 mutations, 10 of which are identified in the RBM area (Figure 1A). This results in the identification of the highest number of newly constructed C/H-CrUPs in the RBD/RBM region, as compared to all other previous virus variants examined (Table S1). Table 2 describes all the new, herein identified, C/H-CrUPs of Omicron variant in Spike’s RBD region, in comparison to the Alpha and Delta variants, which represent two of the most predominant variants of the virus in human populations. Hence, it was proven that, in contrast to Alpha and Delta variants, at the end of Omicron variant RBM area from 440 to 508 amino acid position, 8 novel mutations were identified, resulting in the production of 28 new C/H-CrUPs. The most important finding is that in Omicron variant, for the first time, new C/H-CrUPs including two or three mutant amino acids were generated, with the peptides “QAGN*K*P”, “N*K*PCN”, “LK*SYS*F” and “K*SYS*FR*” being characteristic examples, as a result of the accumulation of multiple mutations in the positions 440, 446, 477, 478 and 493–505. These novel C/H-CrUPs that contain several mutated amino acids could not be found in any other virus variants previously. Taking into consideration recent data about virus infectivity, the multimutated, new, C/H-CrUP collection seems to radically change the structure and the epitope regions of end positions of the RBM area in the Omicron variant, causing a serious compromise of its antigenic capacity and facilitating the immune escape of the virus [9].
Figure 1

Mutations in different virus variants. (A) The mutations of the Receptor-Binding Motif (RBM) included in the Receptor-Binding Domain (RBD) are presented. (B) The mutations around the Spike cleavage sites are presented. Purple blocks mark the point mutation sites in the variants. Green colors indicate the Universal Peptides of the Spike proteins from Figure S2. Yellow colors mark the Receptor-Binding Domain of Spike protein interaction with ACE2. Pink colors mark the Receptor-Binding Motif. Cyan colors indicate the NF9 peptide, while light blue colors mark the Bridge between S1 and S2 domains. Red-colored arrows indicate the cleavage sites. With different colors in the upper side of the alignment, the different domains of the Spike protein are presented.

Table 2

C/H-CrUPs constructed aroud the mutations in RBD of Alpha, Delta and Omicron SARS-CoV-2 variants.

Alpha Variant Delta Variant
C/H-CrUP Position Mutation New C/H-CrUPs Position C/H-CrUP Position Mutation New C/H-CrUPs Position
GNYNYL447L452RGNYNYR447PGQTGKI412K417N
NYNYLY448 GQTGKIA413GQTGNI413
YNYRY449 QTGNIA414
NYLYRL450NYRYRL450TGKIAD415TGNIAD415
YLYRLF451YRYRLF451GKIADY416GNIADY416
LYRLFR452
GNYNYL447L452RGNYNYR447
CNGVEG480E484KCNGVKG480NYNYLY448
NGVEGF481NGVKGF481 YNYRY449
GVEGFN482GVKGFN482NYLYRL450NYRYRL450
KGFNC484YLYRLF451YRYRLF451
LYRLFR452
YFPLQS489S494P N501YYFPLQP489
FPLQSY490FPLQPY490YQAGST473T478KYQAGSK473
PLQSYG491PLQPYG491 QAGSKP474
QSYGF493QPYGF493AGSTPC475AGSKPC475
SYGFQP494PYGFQP494 GSKPCN476
GFQPTN496 STPCN477
FQPTNG497 KPCNG478
QPTNGV498
QPTΥ498
PTNGVG499PTΥG499
TNGVGY500TΥGV500
NGVGYQ501ΥGVG501
Omicron variant
C/H-CrUP Position Mutation New C/H-CrUPs Position C/H-CrUP Position Mutation New C/H-CrUPs Position
NLCPFG334G339DNLCPFD334IYQAGS472S477N T478K
LCPFGE335LCPFDE335YQAGST473YQAGN473
PFGEVF337PFDEV337 QAGNKP474
FGEVFN338FDEVFN338AGSTPC475
GEVFNA339DEVFNA339STPCN477NKPCN477
KPCNG478
VLYNSA367S371L S373P S375FVLYNLAP367
LYNSAS368 CNGVEG480E484ACNGVAG480
YNSASF369YNLAPF369NGVEGF481NGVAGF481
NSASFST370 GVEGFN482GVAGFN482
LAPFFT371 VAGFNC483
ASFSTF372APFFTF372
SFSTFK373 CYFPLQ488Q493K G496S Q498R N501Y Y505HCYFPLK488
FFTFK374YFPLQS489YFPLKS489
STFKC375FTFKCY375FPLQSY490FPLKSY490
PLQSYG491
PGQTGKI412K417N LKSYSF492
GQTGKIA413GQTGNI413QSYGF493KSYSFR493
QTGNIA414SYGFQP494SYSFRP494
TGKIAD415TGNIAD415YGFQPT495YSFRPT495
GKIADY416GNIADY416GFQPTN496
FQPTNG497FRPTY497
WNSNN436N440K G446SWNSNKL436QPTNGV498RPTYGV498
SNNLDS438SNKLDS438PTNGVG499
NNLDSK439NKLDSKV439TNGVGY500TYGVGH500
KLDSKVS440NGVGYQ501
LDSKVG441 GVGYQP502GVGHQ502
DSKVGG442DSKVSG442VGYQPY503VGHQPY503
KVGGNY444KVSGNY444GYQPYR504
VGGNYN445VSGNYN445YQPYRV505HQPYR505
GGNYNY446

The original and newly constructed C/H-CrUPs around the native and mutant sites of RBD region of SARS-CoV-2 Spike protein in Alpha, Delta and Omicron variants are presented. With the red colors, the mutant amino acids in wild-type C/H-CrUPs and in the newly constructed peptides are marked.

Remarkably, RBM area contains 11 out of the 12 contact points of viral Spike protein with the ACE2 cellular receptor. Among them, 7 contact points remained intact, while 4 mutations in positions Q493K, Q498R, N501Y and Y505H were identified, resulting in the construction of 17 new C/H-CrUPs (Table 3). N501Y mutation was found to be a major determinant of increased viral transmission, due to the improved binding affinity of Spike protein to ACE2 cellular receptor [10]. These findings indicate that virus binding to ACE2 receptor is notably affected by C/H-CrUP-specific mutations that can likely strengthen Spike-ACE2 protein–protein interaction(s).
Table 3

C/H-CrUPs around SARS-CoV-2 RBD contact positions.

WILD-TYPE OMICRON VARIANT
Contact PositionsC/H-CrUPsMutationsNewly Constructed C/H-CrUPs
N439AWNSNWNSNNSNNLDSNNLDSK
Y449KVGGNYVGGNYNGGNYNYGNYNYLNYNYLY
Y453NYNYLYNYLYRLYLYRLFLYRLFRYRLFRK
F486NGVEGFGVEGFNGFNCYFNCYF
N487GVEGFNGFNCYFNCYF
Y489GFNCYFNCYFCYFPLQYFPLQS
Q493CYFPLQYFPLQSFPLQSYPLQSYGQSYGF Q493K CYFPLK YFPLKSFPLKSYLKSYSFKSYSFR
Q498SYGFQPYGFQPTGFQPTNFQPTNGQPTNGV Q498RKSYSFRSYSFRPYSFRPTFRPTY RPTYGV
T500YGFQPTGFQPTNFQPTNGQPTNGVPTNGVGTNGVGY
N501GFQPTNFQPTNGQPTNGVPTNGVGTNGVGYNGVGYQ N501Y FRPTY RPTYGVTYGVGH
Y505TNGVGYNGVGYQGVGYQPVGYQPYGYQPYRYQPYRV Y505H TYGVGH GVGHQVGHQPYHQPYR

The original and newly constructed C/H-CrUPs residing around the native and contact positions of the SARS-CoV-2 Spike protein RBD region. The C/H-CrUPs of wild-type and Omicron variant are presented. With red colors, the mutant amino acids in wild-type C/H-CrUPs and in the newly constructed peptides are marked.

Interestingly, an important amino acid sequence in the RBM area is the “NYNYLYRLF” peptide (from 448 to 456 position). This Tyrosine (Y)-enriched peptide carries two contact sites (Y449 and Y453), and it is known as the NF9 peptide [11]. It seems to affect antigen recognition, by being an immunodominant HLA*24:02-restricted epitope identified by CD8+ T cells. Of note, NF9 presents immune stimulation activity, and increases cytokine production derived from CD8+ T cells, such as IFN-γ, TNF-α and IL-2 [12]. In contrast to Delta, in the Omicron variant the NF9 amino acid content is not changed by any mutation detected, thus suggesting that the NF9 peptide could induce early immune system activation and efficient cytokine production, leading to a faster immune response, and thus reducing SARS-CoV-2 virus pathogenicity.

3.3. C/H-CrUPs Altered Architecture around the Spike-Cleavage Site(s) of the Omicron Variant

The molecular mechanism of Spike protein’s proteolytic activation has been shown to play a crucial role in the selection of host species, virus–cell fusion, and the viral infection of human lung cells [13,14,15]. Spike protein [SPIKE_SARS2 (P0DTC2)] contains three cleavage sites (known as S-cleavage sites) crucial for the virus fusion to the host cell: the R685↓S and R815↓S positions that serve as direct targets of the Furin protease, and the T696↓M position that can be recognized by the TMPRSS2 protease [16,17,18]. In these cleavage sites, the Omicron variant carries only the critical mutation P681H, which also appears in the Alpha variant (Figure 1B). Strikingly, in contrast to the Delta variant, which contains the P681R mutation, the P681H mutation constructs several new C/H-CrUPs in the Alpha and Omicron variants, thus indicating their dispensable contribution to virus fusion to the host cell (Table 4).
Table 4

C/H-CrUPs arround the Spike protein cleavage sites.

Cleavage SiteMutationVariantPositionNew C/H-CrUPs
R685↓SP681RDelta680SRRRAR↓S
P681HAlpha Omicron677QTNSH
678TNSHR
680SHRRAR
T696↓MA701VBetaNone
R815↓SNoneNoneNone

C/H-CrUPs around the mutant positions of Spike protein cleavage sites are presented. Symbol “↓” indicates the protein cleavage positions.

4. Conclusions

Core Unique Peptides constitute a distinct and important group of peptides within a proteome. The identification of CrUPs in an organism (e.g., virus, microbe, or mutant protein) against a distinct proteome of another organism is a completely novel approach, which could prove useful for the understanding of the action of microorganisms, the association of novel pharmacological targets with therapies, and the design of novel vaccines. It could be employed in many different kinds of diseases, such as cancer, athropozoans diseases, the design of vaccines for pathogenic viruses, and the identification of new antigenic epitopes capable for the development of new diagnostic or therapeutic antibodies. Therefore, we applied this dynamic and novel strategy, for the first time, in the identification of CrUPs derived from SARS-CoV-2 against the human proteome [1]. In that study, we analyzed all the CrUP peptides of all SARS-CoV-2 variants against the proteome of the host organism, which in our case was Human sapiens. Remarkably, this approach clearly revealed the immune escaping capacity, the contagious power and the high pathogenicity of Delta variant, in contrast to other variants. Notably, these findings have been confirmed by epidemiological data concerning the course of the disease. In the present study, we engaged this approach to the analysis of the SARS-CoV-2 Omicron variant. The analysis of C/H-CrUP landscapes in the heavily mutated SARS-CoV-2 Omicron variant Spike protein unveiled that the Omicron variant, by the generation of novel multi-mutated C/H-CrUPs, could escape the immune system defense mechanisms, while these C/H-CrUP-specific mutations could facilitate more efficient virus binding to the ACE2 cellular receptor, and a more productive fusion of the virus to the host cell. Most importantly, in contrast to the Delta variant, the intact NF9 peptide in the Omicron variant, which has a known immunostimulatory effect, suggests that Omicron exhibits reduced pathogenicity as compared to Delta.
  16 in total

1.  Sequence analysis of the emerging SARS-CoV-2 variant Omicron in South Africa.

Authors:  Lulan Wang; Genhong Cheng
Journal:  J Med Virol       Date:  2021-12-27       Impact factor: 2.327

2.  The N501Y spike substitution enhances SARS-CoV-2 infection and transmission.

Authors:  Yang Liu; Jianying Liu; Kenneth S Plante; Jessica A Plante; Xuping Xie; Xianwen Zhang; Zhiqiang Ku; Zhiqiang An; Dionna Scharton; Craig Schindewolf; Steven G Widen; Vineet D Menachery; Pei-Yong Shi; Scott C Weaver
Journal:  Nature       Date:  2021-11-24       Impact factor: 49.962

3.  SARS-CoV-2-specific CD8+ T cell responses in convalescent COVID-19 individuals.

Authors:  Hassen Kared; Andrew D Redd; Evan M Bloch; Tania S Bonny; Hermi Sumatoh; Faris Kairi; Daniel Carbajo; Brian Abel; Evan W Newell; Maria P Bettinotti; Sarah E Benner; Eshan U Patel; Kirsten Littlefield; Oliver Laeyendecker; Shmuel Shoham; David Sullivan; Arturo Casadevall; Andrew Pekosz; Alessandra Nardin; Michael Fehlings; Aaron Ar Tobian; Thomas C Quinn
Journal:  J Clin Invest       Date:  2021-03-01       Impact factor: 14.808

4.  SARS-CoV-2 spike L452R variant evades cellular immunity and increases infectivity.

Authors:  Chihiro Motozono; Mako Toyoda; Jiri Zahradnik; Akatsuki Saito; Hesham Nasser; Toong Seng Tan; Isaac Ngare; Izumi Kimura; Keiya Uriu; Yusuke Kosugi; Yuan Yue; Ryo Shimizu; Jumpei Ito; Shiho Torii; Akiko Yonekawa; Nobuyuki Shimono; Yoji Nagasaki; Rumi Minami; Takashi Toya; Noritaka Sekiya; Takasuke Fukuhara; Yoshiharu Matsuura; Gideon Schreiber; Terumasa Ikeda; So Nakagawa; Takamasa Ueno; Kei Sato
Journal:  Cell Host Microbe       Date:  2021-06-15       Impact factor: 21.023

Review 5.  Comprehensive Structural and Molecular Comparison of Spike Proteins of SARS-CoV-2, SARS-CoV and MERS-CoV, and Their Interactions with ACE2.

Authors:  Ma'mon M Hatmal; Walhan Alshaer; Mohammad A I Al-Hatamleh; Malik Hatmal; Othman Smadi; Mutasem O Taha; Ayman J Oweida; Jennifer C Boer; Rohimah Mohamud; Magdalena Plebanski
Journal:  Cells       Date:  2020-12-08       Impact factor: 6.600

6.  Omicron Variant (B.1.1.529): Infectivity, Vaccine Breakthrough, and Antibody Resistance.

Authors:  Jiahui Chen; Rui Wang; Nancy Benovich Gilby; Guo-Wei Wei
Journal:  J Chem Inf Model       Date:  2022-01-06       Impact factor: 4.956

7.  SARS-CoV-2 spike and its adaptable furin cleavage site.

Authors:  Gary R Whittaker
Journal:  Lancet Microbe       Date:  2021-08-06

8.  Structural basis of receptor recognition by SARS-CoV-2.

Authors:  Jian Shang; Gang Ye; Ke Shi; Yushun Wan; Chuming Luo; Hideki Aihara; Qibin Geng; Ashley Auerbach; Fang Li
Journal:  Nature       Date:  2020-03-30       Impact factor: 49.962

View more
  2 in total

1.  Unique peptide signatures of SARS-CοV-2 virus against human proteome reveal variants' immune escape and infectiveness.

Authors:  Vasileios Pierros; Evangelos Kontopodis; Dimitrios J Stravopodis; George Th Tsangaris
Journal:  Heliyon       Date:  2022-04-04

2.  Vaccination Is Associated With Shorter Time to Target Cycle Threshold Value in Patients With SARS-CoV-2 Omicron Variant.

Authors:  Jiajun Wu; Yong Wei; Feng Shen; Shun Zhu; Yingying Lu; Xue Tian; Pengyu Zhang
Journal:  Front Cell Infect Microbiol       Date:  2022-07-06       Impact factor: 6.073

  2 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.