Literature DB >> 35300486

Molecular Characterization of Penicillin-Binding Protein2x, 2b and 1a of Streptococcus pneumoniae Causing Invasive Pneumococcal Diseases in China: A Multicenter Study.

Menglan Zhou1,2, Lulu Wang3, Ziran Wang1,2, Timothy Kudinha4,5, Yao Wang1,2, Yingchun Xu1,2, Zhengyin Liu6.   

Abstract

Streptococcus pneumoniae is a common human pathogen that can cause severe invasive pneumococcal diseases (IPDs). Penicillin-binding proteins (PBPs) are the targets for β-lactam antibiotics (BLAs), which are the common empirical drugs for treatment of pneumococcal infection. This study investigated the serotype distribution and antibiotic resistance patterns of S. pneumoniae strains causing IPD in China, including exploring the association between penicillin (PEN) susceptibility and PBPs variations. A total of 300 invasive S. pneumoniae isolates were collected from 27 teaching hospitals in China (2010-2015). Serotypes were determined by Quellung reaction. Serotypes 23F and 19F were the commonest serotypes in isolates from cerebrospinal fluid (CSF), whilst serotypes 19A and 23F were most commonly seen in non-CSF specimens. Among the 300 invasive S. pneumoniae strains, only one strain (serotype 6A, MIC = 0.25 μg/ml) with PEN MIC value ≤ 0.25 μg/ml did not have any substitutions in the PBPs active sites. All the strains with PEN MIC value ≥ 0.5 μg/ml had different substitutions within PBPs active sites. Substitutions in PBP2b and PBP2x active sites were common in low-level penicillin-resistant S. pneumoniae (PRSP) strains (MIC = 0.5 μg/ml), with or without PBP1a substitution, while all strains with PEN MIC ≥ 1 μg/ml had substitutions in PBP1a active sites, accompanied by PBP2b and PBP2x active site substitutions. Based on the three PBPs substitution combinations, a high degree of diversity was observed amongst the isolates. This study provides some new insights for understanding the serology and antibiotic resistance dynamics of S. pneumoniae causing IPD in China. However, further genomic studies are needed to facilitate a comprehensive understanding of antibiotic resistance mechanisms of S. pneumoniae.
Copyright © 2022 Zhou, Wang, Wang, Kudinha, Wang, Xu and Liu.

Entities:  

Keywords:  Streptococcus pneumoniae; invasive pneumococcal disease; penicillin susceptibility; penicillin-binding protein; serotype

Year:  2022        PMID: 35300486      PMCID: PMC8921733          DOI: 10.3389/fmicb.2022.838790

Source DB:  PubMed          Journal:  Front Microbiol        ISSN: 1664-302X            Impact factor:   5.640


Introduction

Streptococcus pneumoniae is one of the most common Gram-positive cocci that is mainly transmitted through the respiratory tract. The organism usually colonizes the human nasopharynx and can migrate to the middle ear and lungs causing local non-invasive pneumococcal disease (NIPD) such as otitis media and pneumonia in immune-deficient people (Lynch and Zhanel, 2009; Henriques-Normark and Tuomanen, 2013). Data from the World Health Organization (WHO) shows that pneumonia killed 808, 694 children under five years old in 2017, accounting for 15% of all deaths in children. S. pneumoniae is the most common pneumonia pathogen in children worldwide, with a mortality rate in children much higher than other diseases such as AIDS, malaria, and measles (Lynch and Zhanel, 2009). In Europe and America, S. pneumoniae is also the most common cause of community-acquired pneumonia in adults (World Health Organization [WHO], 2007). In addition to respiratory tract infections, S. pneumoniae can also migrate to the blood and brain and cause severe invasive pneumococcal disease (IPD), such as bacteremia, meningitis etc., causing a huge economic and medical burden on both developed and developing countries (Mehr and Wood, 2012). The major empirical antimicrobial drugs used in the treatment of S. pneumoniae infections are β-lactam antibiotics (BLAs), which act on the bacterial cell wall. Penicillin-binding proteins (PBPs) are crucial enzymes in the biosynthesis of peptidoglycan (PG), a major cell wall component that surrounds the cytoplasmic membrane and is required to maintain the shape and osmotic stability of bacteria (Hakenbeck et al., 2012). The target of BLAs are PBPs, and function by covalently binding to the active site serine of PBPs through the β-lactam ring, thereby interfering with the synthesis of bacterial cell walls and eventually leading to bacterial cell death. With the widespread use of antibiotics, penicillin-intermediate S. pneumoniae (PISP) and penicillin-resistant S. pneumoniae (PRSP), commonly referred to as penicillin-non-susceptible S. pneumoniae (PNSP), have emerged and are detected continually worldwide. Data from the Asian Network for Surveillance of Resistant Pathogens (ANSORP) shows that the isolation rate of PNSP from 2012 to 2017 (9.0%) was significantly higher than that from 2008 to 2009 (4.9%), and the detection rates of PNSP from patients in China was 1.9% (2012-2017, oral breakpoint) (Kim et al., 2012, 2020). The main mechanism of BLAs resistance by S. pneumoniae is through PBPs substitutions. Alterations in PBPs via substitutions reduce their reactivity for β-lactam attachment to the binding site and thereby reduce their effectiveness (Zapun et al., 2008). S. pneumoniae has six PBPs, but only three PBPs, PBP2x, PBP2b and PBP1a play a main role in BLAs resistance. Alterations in all other PBPs have been described occasionally (Zapun et al., 2008). Mosaicity is the product of homologous recombination that causes the sequence diversity in S. pneumoniae. In most resistant clinical S. pneumoniae isolates, the sequencing revealed that the mosaic genes encode PBP2x, PBP2b, and PBP1a (Laible et al., 1991; Martin et al., 1992; Sibold et al., 1994). The active sites of PBPs comprises three conserved sequences SXXK, SXN and KT(S)G. The serine of the SXXK motif is the active site residue that reacts with BLAs. They are located in PBP2x: 337STMK340, 395SSN397, 547KTG549; in PBP2b: 386STMK389, 443SSN445, and 615KTG617; and in PBP1a: 370STMK373, 428SRN430, 557KTG559 (Hakenbeck et al., 2012). Changes in these active site motifs and their adjacent sequences lead to a decrease in the affinity of PBPs to penicillin resulting in antibiotic resistance (Zhanel et al., 2006; Hakenbeck et al., 2012). Few studies have been carried out to understand the association between penicillin susceptibility and PBPs variations in S. pneumoniae isolates from patients with IPD in mainland China. Due to the widespread use of antimicrobial drugs, and the fastidious nature of S. pneumoniae, the number of isolates from IPD specimens is very low, and hence a scarcity of relevant research studies (Xue et al., 2010; Yao et al., 2011; Quan-Cheng et al., 2016). This study aimed to analyze the serotype distribution and antibiotic resistance pattern of S. pneumoniae strains causing IPD in China, and to explore the association between penicillin susceptibility and PBPs variations.

Materials and Methods

Bacterial Isolates

A total of 300 non-duplicate invasive S. pneumoniae isolates from 27 teaching hospitals in 13 provinces of China (2010-2015) were studied (Supplementary Table 1). The isolates were transported to the Department of Clinical Laboratory in Peking Union Medical College Hospital for re-identification and further analysis. The most common specimen type was blood, accounting for 72.7% (218/300) of the isolates, followed by cerebrospinal fluid (CSF) (19.0%, 57/300) and pleural effusion (5.7%, 17/300). Other specimen types included ascites, joint drainages, pleural drainage and lung tissue, each accounting for ≤ 2.0% of the isolates. The majority of the patients were males, accounting for 65.7% (197/300) of the isolates. The average age of patients was 46 ± 26.69 years old.

Serotyping

All the S. pneumoniae isolates were serotyped by Quellung reaction (Maha et al., 2014). The serotype was first determined by latex agglutination test using the checkerboard typing system. Then specific type antiserum was mixed with the bacterial suspension to determine the final serotype. Capsular swelling was observed under oil immersion microscope. If the test strain was negative with all antisera, it was classified as non-typeable (NT).

Antimicrobial Susceptibility Testing

The minimum inhibitory concentrations (MICs) of S. pneumoniae against penicillin (PEN), amoxicillin/clavulanic (AMC), cefuroxime (CXM), ceftriaxone (CRO), cefepime (FEP), ertapenem (ETP), imipenem (IPM), meropenem (MEM), levofloxacin (LEV), trimethoprim/sulfamethoxazole (SXT), clindamycin (DA), clarithromycin (CLA), erythromycin (E), linezolid (LZD) and vancomycin (VA), were determined by broth microdilution method as recommended by the Clinical and Laboratory Standards Institute (CLSI) M07-A10 (Clinical and Laboratory Standards Institute (CLSI), 2012). S. pneumoniae ATCC49619 and Escherichia coli ATCC25922 were used as the quality control strains, and were tested along each batch. Results were considered valid when the MIC values of the quality control strains were within the expected range. Antimicrobial susceptibility testing results were interpreted according to CLSI 2019 guidelines (Clinical and Laboratory Standards Institute (CLSI), 2019).

Penicillin-Binding Protein Gene Amplification and Sequencing

The isolates were cultured on blood agar plates and incubated overnight at 35°C in a 5% CO2 atmosphere. DNA was extracted using the AxyGen amp DNA Mini Extraction Kit (Axygen, United States) according to the manufacturer’s instructions. The final pure DNA was stored at −20°C until use. The nucleotide sequence of an around1-kb region encoding the penicillin-binding domain of pbp2x, pbp2b and pbp1a genes were amplified and sequenced based on published primers (Table 1; Zhanel et al., 2006). PCR products were sent to Beijing RuiBiotech Co., Ltd., for sequencing.
TABLE 1

Primers for amplification and sequencing for the region encoding the penicillin-binding domain of pbp2x, pbp2b and pbp1a genes.

Gene namePrimer namePrimer sequences (5′-3′)Target fragment length (bp)
pbp2x FTATGAAAAGGATCGTCTGGG or1148
TATGAAAAAGACCGTGTAGG
RAGAGAGTCTTTCATAGCTGAAGC
pbp2b FGGCTATTCTCTAAATGACCGT1317
RAGCTTAGCAATAGGTGTTGG
pbp1a FTGGGATGGATGTTTACACAAATG1197
RGTCGTACTATTATTTGTGCTTGG
Primers for amplification and sequencing for the region encoding the penicillin-binding domain of pbp2x, pbp2b and pbp1a genes. CLC Sequence Viewer software (CLC, Denmark) was used to manually correct the sequencing peaks and sequences to ensure the sequencing quality, and a two-way splicing was carried out. The spliced sequences were translated to simulated protein sequences and compared with PBP2x, PBP2b, and PBP1a corresponding to S. pneumoniae reference strain R6 (PSSP, GenBank accession No. NC003098) for variation analysis.

Data Analysis and Statistical Analysis

Differences in antimicrobial susceptibility were analyzed by MIC range, MIC50 and MIC90, and statistical analysis was performed by chi-square test or Fisher’s exact probability test using SPSS software (version 22.0, SPSS Inc., Chicago, IL, United States). P value < 0.05 was considered statistically significant.

Results

Serotype Distribution

Based on the Quellung reaction, a total of 299 S. pneumoniae isolates were identified to the serotype level accurately and one strain was considered as non-typeable (NT). Among the 299 serotypeable isolates, 41 serotypes were detected. The top five serotypes were: 23F (14.3%, 43/300), 19F (13.7%, 41/300), 19A (13.7%, 41/300), 3 (10.3%, 31/300) and 14 (9.0%, 27/300). The main serotypes in CSF isolates were 23F and 19F, both accounting for 15.8% (9/57) each, whilst in non-CSF specimens, serotypes 19A and 23F were the most common, accounting for 14.8% (36/243) and 14.0% (34/243) of the isolates, respectively (Table 2).
TABLE 2

Serotype distribution of 300 invasive S. pneumoniae isolates in different specimens.

SerotypeCSF
Non-CSF
Total percentage (%)
No.Percentage (%)No.Percentage (%)
23F915.83414.014.3
19F915.83213.213.7
19A5  8.83614.813.7
34  7.02711.110.3
14712.320  8.2  9.0
6A3  5.39  3.7  4.0
6B1  1.810  4.1  3.7
Others1933.37530.931.3
Total57100243100100
Serotype distribution of 300 invasive S. pneumoniae isolates in different specimens.

Antimicrobial Susceptibility

Concerning non-BLAs drugs, all the S. pneumoniae isolates were susceptible to LEV, VA and LZD, with MIC90 values of 1 μg/ml, 0.5 μg/ml, and 1 μg/ml. The prevalence of resistance of the isolates to SXT was 65.3%. Resistance rates to CLA, E and DA were extremely high, all above 90%. PISP accounted for 4.3% of the isolates based on the non-meningitis (R ≥ 8 μg/ml) breakpoint while none, 67.7% and 44.7% of the isolates were classified as PRSP based on non-meningitis, meningitis (R ≥ 0.12 μg/ml) and oral administration (R ≥ 2 μg/ml) breakpoints, respectively. Susceptibility to AMC was about 97.7%. The prevalence of resistance of the isolates to the second-generation cephalosporins CXM was about ≥60%. The third- and fourth-generation cephalosporins CRO and FEP had the same MIC90 value of 2 μg/ml. The resistance rates of the isolates to IPM and MEM was only 3.7 and 2.7%, respectively, but the intermediate rates were much higher at 37.7 and 46.0%, respectively (Table 3).
TABLE 3

Antimicrobial susceptibility results of 300 S. pneumoniae isolates.

Antimicrobial agentBreakpoint type%R%I%SMIC50 (μg/ml)MIC90 (μg/ml)MIC range (μg/ml)
PENnon-meningitis04.395.712≤ 0.015 - 4
PENmeningitis67.7032.312≤ 0.015 - 4
PENoral44.72332.312≤ 0.015 - 4
MCnon-meningitis0.3297.70.520.015 - 8
CXMparenteral64.3233.74160.06 - 64
CXMoral604.335.74160.06 - 64
CROnon-meningitis7.318.374.30.520.007 - 8
CROmeningitis25.723.3510.520.007 - 8
FEPnon-meningitis425.770.3120.03 - 8
FEPmeningitis29.73337.3120.03 - 8
ETP001000.1250.250.004 - 1
IPM3.737.758.70.1250.250.008 - 8
MEM2.74651.30.250.50.004 - 1
LEV001000.510.007 - 2
SXT65.31321.78160.12 - 128
DA95.71.72.71281280.12 - 256
CLA9604> 1024> 10240.06 - 2048
E9604> 1024> 10240.06 - 2048
VA001000.50.50.015 - 1
LZD00100110.5 - 1

PEN, penicillin; AMC, Amoxicillin-clavulanic acid; CXM, cefuroxime; CRO, ceftriaxone; FEP, cefepime; ETP, ertapenem; IPM, imipenem; MEM, meropenem; LEV, levofloxacin; SXT, trimethoprim-sulfamethoxazole; DA, clindamycin; CLA, clarithromycin; E, erythromycin; VA, vancomycin; LZD, Linezolid.

Antimicrobial susceptibility results of 300 S. pneumoniae isolates. PEN, penicillin; AMC, Amoxicillin-clavulanic acid; CXM, cefuroxime; CRO, ceftriaxone; FEP, cefepime; ETP, ertapenem; IPM, imipenem; MEM, meropenem; LEV, levofloxacin; SXT, trimethoprim-sulfamethoxazole; DA, clindamycin; CLA, clarithromycin; E, erythromycin; VA, vancomycin; LZD, Linezolid.

Association Between Serotypes, Penicillin Susceptibility and Variations in Penicillin-Binding Proteins Active Sites

Among the 300 isolates studied, 106 isolates, including all strains of serotypes1-5, 6C, 7F, 9A, 9N, 9V, 8, 17, 34, 10A, 11A, 12F, 15F, 17A, 18C, 24F, 25A, 25F, 28A, and 28F, one strain each of serotypes 6A, 7C, 19A and 23F, and two strains each of serotypes 6B, 13, 29, and 15A, exhibited PEN MIC values of ≤0.25 μg/ml. None of these isolates had PBPs substitution in the three conserved motifs and nearby sites, except one isolate of serotype 6A (PEN MIC = 0.25 μg/ml), in which TAA6A substitution was detected in the active sites of PBP2b. The remaining 194 isolates all had different amino acid substitutions in the PBPs active sites. In the PBP2x conserved motifs or nearby sites, 181 isolates had T338A substitution (threonine → alanine), 175 isolates had L546V substitution (leucine → valine), and 39 isolates had M339F substitution (methionine → phenylalanine), 4 isolates had H394L substitution (histidine → leucine), and the substitution rates were 60.3, 58.3, 13, and 1.3%, respectively. In the PBP2b conserved motifs or nearby sites, 190 isolates had T446A substitution (threonine → alanine), 3 isolates had T446S substitution (threonine → serine), and 72 isolates had A619G substitution (alanine → glycine), with substitution rates of 63.3, 1, and 24%, respectively. In the PBP1a conserved motifs or nearby sites, 53 isolates had T371A substitution (threonine → alanine), 122 isolates had T371S substitution (threonine → serine), and 175 isolates had P432T substitution (proline → threonine), with substitution rates of 17.7, 40.7, and 58.3%, respectively (Table 4).
TABLE 4

Association of serotypes, penicillin susceptibility and variations of conserved motifs forming or surrounding active penicillin-binding proteins (PBPs) binding sites in PBP2x, PBP2b, PBP1a among 300 S. pneumoniae isolates.

SerotypeMIC (μg/ml)No.PBP2x
PBP2b
PBP1a
T338M339H394L546T446A619T371P432
1≤ 0.0155
2≤ 0.0151
3≤ 0.015-0.0331
4≤ 0.0151
5≤ 0.0152
6A0.251A
6B0.252
6C≤ 0.015-0.252
7C0.031
7F≤ 0.0152
9A≤ 0.0152
9N≤ 0.0152
9V≤ 0.0153
8≤ 0.0154
13≤ 0.015-0.122
17≤ 0.0151
20≤ 0.0153
29≤ 0.015-0.032
34≤ 0.015-0.037
10A≤ 0.015-0.063
11A≤ 0.0154
12F≤ 0.0154
15A≤ 0.0152
15F≤ 0.015-0.252
17A≤ 0.0151
18C≤ 0.0151
19A≤ 0.0151
23F≤ 0.0151
24F≤ 0.0153
25A0.12-0.252
25F0.251
28A≤ 0.0152
28F≤ 0.0153
33B0.032
6A0.51AVAT
6A0.51AV
6A11AVAGAT
6A28AVAAT
6B0.51AFVAAT
6B0.51AVAAT
6B0.52AVAST
6B0.51AVSST
6B0.51AA
6B0.51L
6B12AVAAT
7C21AVAAT
130.51AA
140.51AVAAT
140.51LAS
140.51AA
1412AVAAT
1411AVAST
14220AVAST
1441AVAST
200.54AA
290.51LVA
15A0.51A
15B11AVAGST
15B11AVAST
15B11AVAST
15B11AVAG
15C16AVAST
19A25AFVAGST
19A228AVAGST
19A21AGST
19A46AVAGST
19F0.52AVAST
19F0.51A
19F11AFVAAT
19F18AVAST
19F224AFVAGST
19F43AFVAGST
19F41AVAGST
19F41AFVSGST
22F0.51A
23A0.51AAT
23A0.51LA
23A12AVAAT
23F0.53A
23F11AFVAST
23F13AVAST
23F23AFVAAT
23F227AVAAT
23F21AAT
23F23AVAST
23F41AVAAT
NT11AVSST
Total300181394175A/S: 190/372A/S: 53/122175
Mutation rate (%)60.3131.358.3A/S: 63.3/124A/S: 17.7/40.758.3
Association of serotypes, penicillin susceptibility and variations of conserved motifs forming or surrounding active penicillin-binding proteins (PBPs) binding sites in PBP2x, PBP2b, PBP1a among 300 S. pneumoniae isolates. Based on the serotype and PEN MIC distribution among the isolates, ten isolates had only one PBP gene active site or nearby sites substitution, including two isolates each of serotype 6A and 6B, one isolate each of serotypes 19F, 22 F and 23A, and three isolates of serotype 23F. Seven of these isolates had PBP2b active sites or nearby sites substitutions; two had only PBP2x active sites or nearby sites substitutions, while none had any substitution in single PBP1a active sites or nearby sites. Save for one isolate of serotype 6A with PEN MIC of 0.25 μg/ml, all these strains had an MIC of 0.5 μg/ml. Thirteen isolates had substitutions in two of the PBPs gene active sites or nearby sites, including four isolates of serotype 20, two isolates of serotype 23A, and one isolate each for serotypes 6B, 13, 14, 29, 15B, 19A, and 23F. Among them, three isolates had substitutions in both PBP2b and PBP1a genes (serotypes 19A, 23F, and 23A), and the rest had substitution in PBP2x and PBP2b. The PEN MIC of most isolates in the group with two substitutions in the PBPs gene active sites or nearby sites was 0.5 μg/ml. The remaining 171 isolates had substitutions in the active sites or nearby sites of all the three PBPs genes, mainly distributed in serotypes 14 (n = 26), 19A (n = 39), 19F (n = 40) and 23F (n = 38). Taken together, all isolates of serotypes 1, 2, 3, 4, 5, 6C, 7F, 9A, 9N, 9V, 8, 17, 34, 10A, 11A, 12F, 15F, 17A, 18C, 24F, 25A, 25F, 28A, 28F, and 33B, had no amino acid changes in the three active sites or nearby sites of PBPs (MIC ≤ 0.25 μg/ml), and all isolates of serotypes 14, 15B, 15C, 19F, 22F, and 23A, had at least one substitution in the active sites or nearby sites of PBPs (0.5 μg/ml ≤ MIC ≤ 4 μg/ml).

Association Between Specimen Types and Variations in Penicillin-Binding Proteins Active Sites

Among the 300 invasive S. pneumoniae isolates, 57 (19.0%) were isolated from CSF, and the rest (81.0%) from other sterile body fluids, mostly in blood. Antimicrobial susceptibilities were interpreted according to meningitis and non-meningitis break points. PRSP and PSSP from CSF accounted for 70.2 and 29.8% of the isolates, respectively. PISP and PSSP from non-CSF accounted for 4.5 and 95.5% of the isolates, respectively. Although the proportion of PRSP derived from CSF was significantly higher than that from non-CSF sources (P < 0.0001), the proportion of CSF derived isolates with PEN MIC ≥ 1μg/ml (59.6%) was similar to that from non-CSF sources (54.3%) (P = 0.5644) (Figure 1).
FIGURE 1

Susceptibility and MIC distribution against penicillin in 300 S. pneumoniae isolates. Green: susceptible, orange: intermediate, red: resistant. CSF: PSSP 29.8%, PISP 0%, PRSP 70.2%; Non-CSF: PSSP 95.5%, PISP 4.5%, PRSP 0%.

Susceptibility and MIC distribution against penicillin in 300 S. pneumoniae isolates. Green: susceptible, orange: intermediate, red: resistant. CSF: PSSP 29.8%, PISP 0%, PRSP 70.2%; Non-CSF: PSSP 95.5%, PISP 4.5%, PRSP 0%. Analysis of PBPs active sites of strains from CSF showed that all PSSP, and one strain of PRSP, with PEN MIC of 0.25 μg/ml, had no substitution in the PBPs active sites. PBP2x and PBP2b substitutions were common in low-level PRSP strains (MIC = 0.5μg/ml), with or without PBP1a substitution. The strains with PEN MIC ≥ 1 μg/ml all had substitutions in the PBP1a active site or nearby sites, accompanied by substitutions in the PBP2x and PBP2b regions (Table 5).
TABLE 5

Association of penicillin susceptibility and variations of conserved motifs forming or surrounding active penicillin-binding proteins (PBPs) binding sites in PBP2x, PBP2b and PBP1a in S. pneumoniae isolates from CSF.

SIRMIC (μg/ml)No.PBP2x
PBP2b
PBP1a
T338M339H394L546T446A619T371P432
PSSP≤ 0.0317
PRSP0.251
0.51AAT
0.52AVAST
0.52AA
11AVAGAT
11AVAGST
16AVAST
22AFVAAT
26AVAAT
26AFVAGST
23AVAGST
27AVAST
41AVAAT
41AVAGST

PSSP, penicillin-susceptible S. pneumoniae; PISP, penicillin-intermediate S. pneumoniae; PRSP, penicillin-resistant S. pneumoniae.

Association of penicillin susceptibility and variations of conserved motifs forming or surrounding active penicillin-binding proteins (PBPs) binding sites in PBP2x, PBP2b and PBP1a in S. pneumoniae isolates from CSF. PSSP, penicillin-susceptible S. pneumoniae; PISP, penicillin-intermediate S. pneumoniae; PRSP, penicillin-resistant S. pneumoniae. Analysis of PBPs active sites or nearby sites of strains derived from non-CSF sources revealed that all PSSP with PEN MIC ≤ 0.25 μg/ml had no substitutions in PBPs active sites or nearby sites, except one serotype 6A strain, in which a T446A substitution nearby the active site of PBP2b was detected. Various substitutions in the PBPs active sites or nearby sites of PSSP strains with PEN MIC ≥ 0.25 μg/ml were detected. Similar to CSF derived strains, the substitutions in active sites or nearby sites of PBP2x and PBP2b were common in strains with low PEN MIC level, with or without PBP1a active site substitution. In contrast, strains with PEN MIC ≥ 1 μg/ml all had substitutions in PBP1a active sites or nearby sites, accompanied by PBP2x or PBP2b substitutions (Table 6).
TABLE 6

Association of penicillin susceptibility and variations of conserved motifs forming or surrounding active penicillin-binding proteins (PBPs) binding sites in PBP2x, PBP2b, PBP1a in S. pneumoniae isolates from non-CSF specimens.

SIRMIC (μg/ml)No.PBP2x
PBP2b
PBP1a
T338M339H394L546T446A619T371P432
≤ 0.1282
0.251A
0.255
PSSP0.51AFVAAT
0.55AVAAT
0.51LAS
0.51AVAT
0.55AA
0.51LVA
0.51LA
0.56A
0.51AV
0.51L
11AFVAAT
16AVAAT
11AFVAST
115AVAST
11AVAG
21AFVAAT
230AVAAT
21AAT
223AFVAGST
225AVAGST
21AGST
216AVAST
43AFVAGST
46AVAGST
PISP41AVAST
41AFVSGST

PSSP, penicillin-susceptible S. pneumoniae; PISP, penicillin-intermediate S. pneumoniae; PRSP, penicillin-resistant S. pneumoniae.

Association of penicillin susceptibility and variations of conserved motifs forming or surrounding active penicillin-binding proteins (PBPs) binding sites in PBP2x, PBP2b, PBP1a in S. pneumoniae isolates from non-CSF specimens. PSSP, penicillin-susceptible S. pneumoniae; PISP, penicillin-intermediate S. pneumoniae; PRSP, penicillin-resistant S. pneumoniae.

Variations of the pbp2x Gene

Compared with the reference strain R6 (GenBank accession No. NC003098), a total of 338 amino acids from positions 259 to 596 of the PBP2x protein were analyzed. A total of 98 different substitutions at 73 amino acid positions were detected in the PBP2x sequence, among which D567N (Asp → Asn) was the most common substitution, accounting for 69.3% (208/300), followed by D488N (Asp → Asn) and S576N (Ser → Asn), each accounting for 64.0% (192/300). Strains with L565S (Leu → Ser) and R384G (Arg → Gly) substitutions each accounted for 62.7% (188/300) and 61.3% (184/300), respectively. According to the distribution of various substitutions in PBP2x, all strains could be divided into 43 groups. The number of substitution sites in each group ranged from 1 to 42, accounting for 0-12.4% of the total number of amino acids analyzed. Group 2X37 was the commonest, accounting for 16.3% of all strains (49/300). There were 38 substitutions detected in all strains within the group, and the substitution rate was 11.2%. The second common group was 2X01, accounting for 13.3% of all strains (40/300), and the PBP2x sequence of strains in this group was exactly the same as that of R6 strain. There were 33 strains in the 2X41 group, accounting for 11.0% of the strains. Forty substitutions were detected in all strains of this group and the substitution rate was 11.8% (Table 7). Compared with PBP2b and PBP1a sequences, PBP2x had the least number of total substitutions (98 vs. 112 vs. 105). According to the distribution of PEN MIC, the number of detectable substitution sites in strains with PEN MIC ≤ 0.25 μg/ml ranged from 10-32, while for strains with PEN MIC = 0.5, 1, 2, and 4 μg/ml the number of detectable substitutions were 86, 46, 57, and 48, respectively (Supplementary Table 2).
TABLE 7

Deduced amino acid sequences of PBP2x in 300 S. pneumoniae isolates.

PBP2x groupNPercent (%)Number of substitution sitesSubstitution rate (%)2222233333333333333333333344444444444444444455555555555555555555555555555
6677811233444556666778888900113444566888899900001111122233333445566667779
5889118089367580469182459401074479925136801815670346702315678462735782465
IPDAQDIETMMAAGVNLLAIEGRMSHMTANANQSTIFSIPDTAINKDALTNVLTPVSPTVTVLQKVLDYASSY
2X 014013.300.0
2X 02289.310.3V
2X 0320.710.3S
2X 0441.310.3T
2X 0510.310.3K
2X 0610.310.3D
2X 0710.310.3R
2X 08144.720.6NV
2X 0910.320.6TL
2X 1020.782.4NVSNNVAN
2X 1110.382.4NVSNNVAN
2X 1231.082.4IVTENNVH
2X 1310.382.4VVSNNVAN
2X 1410.392.7GI-VTENNVH
2X 1572.3103.0TTA-VSNNVAN
2X 1610.3103.0TNLKATVVGN
2X 1741.3113.3TNLKATVTGLN
2X 1810.3144.1SYVDTLLSTVHKNN
2X 1910.3154.4TNLKTDVTLHITNHN
2X 2010.3164.7TNLKTDTGLSSMAINN
2X 2110.3185.3LLNTSSSYVDTLLSTINN
2X 2241.3185.3LLSVASEHMNNVTENNVH
2X 2310.3195.6MLLSVASEHMNNVTENNVH
2X 2410.3195.6SMATLNVQHRANVSNNVAN
2X 2510.3195.6SYDTGLSMALLIVSNNVAN
2X 2610.3257.4TNLKTVLLTNSVKEILQIIVSNVTN
2X 2720.7319.2LVKATSYASGTSMLLSVASDYMNNVTENNVH
2X 283210.73510.4LLNATSSSYFTTGLSKSLTNSVKETILYIIVSNTN
2X 2910.33610.7LLNATSSSYFTTGLSKSILTNSVKETILYIIVSNTN
2X 3062.03610.7LLNATSSSYFTTGLSKSLTNSVETNHILYIIVSNTN
2X 3131.03610.7TLNATSSSYFTTGLSKSLTNSVETNHILYIIVSNTN
2X 3210.33610.7TLNKATSYFTATGLSKSLTNSVETNHILYIIVSNTN
2X 3320.73710.9LLNATSSSYFTTGLSKSLTNSVETNHILYIIVSNVTN
2X 3472.33710.9LNATSSSYFTDTGLSKSLTNSVETNHILYIIVSNVTN
2X 35113.73710.9TNLKATSSSYFTTGLSKSLTNSVETNHILYIIVSNTN
2X 3610.33811.2TNNATSSSYFTTGLSKSLTNSVKETTNHILYIIVSNTN
2X 374916.33811.2LLNATSSSYFTDTGLSKSLTNSVETNHILYIIVSNVTN
2X 38217.03811.2LLNATSSSYFTDTGLSTSLTNSVETNHILYIIVSNVTN
2X 3941.33811.2LLNAFSSSYFTTGTSKSLTNSVETNHILYIIVSNVTNF
2X 4010.33811.2NAFSSSYFTATGLTSKSLTNSVETNHILYIIVSNVTNF
2X 413311.04011.8LLNAFSSSYFTATGLTSKSLTNSVETNHILYIIVSNVTNF
2X 4210.34212.4LLNAFSSSYFMVTGTGLTSKSLTNSVETNHILYIIVSNVTNF
2X 4310.33911.5LLNATSSSYFTDTGLSKSLTNSVEVTNHILYIIVSNVTN
Deduced amino acid sequences of PBP2x in 300 S. pneumoniae isolates.

Variations of the pbp2b Gene

Compared with the reference strain R6 (GenBank accession No. NC003098), a total of 372 amino acids from positions 305 to 676 of the PBP2b protein were analyzed for the isolates. A total of 111 different substitutions and two insertion variations at 88 amino acid positions were detected in the PBP2b sequence. The two insertion variations were only found in two strains, both located between amino acids 424-425, and the insertion sequences were YIW (Tyr–Ile-Try) and YTW (Tyr-Thr-Try). The most common substitution was E476G (Glu → Gly), accounting for 64.7% (194/300) of the isolates, followed by T446A (Thr → Ala), Q438E (Gln → Glu), L455I (Leu → Ile), which accounted for 63.3% (190/300), 61.7% (185/300) and 61.0% (183/300), respectively. According to the distribution of various substitutions in PBP2b, all strains could be divided into 46 groups. Except for group 2B45 and 2B46, each containing one insertion variation, the other groups all had amino acid substitutions in PBP2b protein. The number of substituted amino acid sites ranged from 0 to 45, accounting for 0-12.1% of the total number of amino acids (n = 372) analyzed. Group 2B01 was the most common, accounting for 17.3% of the strains (52/300), and had exactly the same sequence of PBP2b as reference strain R6. The second common group was 2B20, accounting for 14.3% of the strains (43/300). A total of 13 amino acid substitutions were detected in the PBP2b sequence of the strains in this group, and the substitution rate was 3.5% (Table 8). According to the distribution of PEN MICs, the number of substitution sites in strains with MIC ≤ 0.12μg/ml were less than ten, while the number of detectable substitution sites in strains with MIC = 0.25, 0.5, 1, 2, and 4μg/ml were 12, 75, 61, 52, and 54, respectively (Supplementary Table 3).
TABLE 8

Deduced amino acid sequences of PBP2b in 300 S. pneumoniae isolates.

PBP2b groupnPercent (%)Number of substitution sitesSubstitution rate (%)3333333333334444444444444444444444444444445555555555555555555555555555555666666666666666
1122356666780111122222233333344566777888990000111233445556666667778888999001222244566777
5912371469236124924678901278969579036039072367206038252561567891481235257699458701904456
ASDAESIDKEPVQQSVANInsTQAYGSFVQATVLGSNSESGTADFVESYAAFANVRGDKDQLQPTMVDMSIHATGNLAADQTSDNGSQKY
2B 015217.300.0
2B 0231.010.3I
2B 0331.010.3P
2B 04279.010.3E
2B 0510.310.3N
2B 0641.310.3I
2B 0710.310.3S
2B 0820.710.3T
2B 0941.310.3N
2B 1031.020.5DE
2B 1141.320.5DE
2B 1210.320.5DI
2B 1310.320.5EE
2B 1410.361.6GLKGSD
2B 1510.392.4AGADNFDVE
2B 1610.3123.2EAILNGAASIND
2B 1772.3123.2GLPKEAIGSFDI
2B 1810.3123.2PYKLEAITGAAD
2B 1910.3123.2GPYKLEAITGAA
2B 204314.3133.5GPYKLEAITGAAS
2B 2110.3133.5PYKLETAITGAAD
2B 2262.0133.5EAILNGAASINDV
2B 2310.3133.5GAFSRPMAGSIDV
2B 24103.3143.8GLPYKLEAITGAAD-
2B 2510.3143.8GPPYKLEAITGAAS-
2B 26227.3154.0GNQPYKLEAITGAAD-
2B 2741.3154.0GPYKLEAITGAADDE
2B 2820.7225.9GLNQPYKLEAGSDDAEGENNQH
2B 2920.74512.1GLNQPYKLEAITGAADDLHDEAIDTKIEASPDTGGENTEKNANQH
2B 3010.3174.6GPYKLEAITGAADAGEN
2B 3120.7174.6PYKLEAITGAAINFDVE
2B 3210.3174.6AFSVPAGSIDGENNQH
2B 3320.7184.8AFSVPAGSINFD– -VAGEN
2B 3420.7184.8GLPYKLEAITGAADAGEN
2B 3551.7184.8SSTANEDPYKLEAITGAA-
2B 3620.7184.8LPYKLEAITGAASDAGEN
2B 3710.33810.2PEAILNGAASINGIHEQNSVESKIEVQGASEGENNQH
2B 3810.3195.1LHPYKLEAITGAASD– - -AGEN
2B 3910.3328.6GLDPYKLEAITGAADEAIDTKIEASEGENNQH
2B 4010.3328.6GLIPYKLEAITGAAYDPDTGGENTEKNANQH
2B 4110.3379.9GLTFKSIGSLTDEAIDTKIEAPDTGGDSTEKNANQH
2B 4210.33810.2GPYKLEAITGAADEAIDTKIEAPDTGGENTEKNANQH
2B 43279.04010.8GLDPYKLEAITGAADEAIDTKIEAPDTGGEDTEKNANQH
2B 444013.34010.8GLNPYKLEAITGAADEAIDTKIEAPDTGGENTEKNANQH
2B 4510.392.4LSYTWSGSDVE
2B 4610.382.2GLSYIWSGSD-
Deduced amino acid sequences of PBP2b in 300 S. pneumoniae isolates.

Variations of the pbp1a Gene

Compared with the reference strain R6 (GenBank accession No. NC003098), a total of 344 amino acids from positions 312 to 655 of the PBP1a protein were analyzed for the studied isolates. A total of 105 different substitutions at 85 amino acid positions were detected in PBP1a. The E388D substitutions (Glu → Asp) was detected in all the 300 isolates. Apart from this, the most common substitution was S540T (Ser → Thr), accounting for 66.7% (200/300), followed by N546G (Asn → Gly), A550P (Gly → Pro), T574N (Thr → Asn), S575T (Ser → Thr), Q576G (Gln → Gly), F577Y (Phe → Tyr), N609D (Asn → Asp), each being detected in 60.0% (180/300) of the strains. According to the distribution of various substitutions in PBP1a, all strains could be divided into 25 groups. The number of substituted amino acids in each group ranged from 1 to 55, accounting for 0.3 −16.0% of the total number of amino acids analyzed. Based on the above substitution classification, group 1A15 was the most common, accounting for 28.7% (86/300) of the strains. All strains in this group had 43 amino acid substitution sites, with the substitution rate of 12.5% of the total number of amino acids analyzed, followed by group 1A04, accounting for 14.7% (44/300) of all the strains (Table 9). Based on the distribution of PEN MIC, the number of substitution sites in strains with MIC ≤ 0.12 μg/ml were less than ten. The number of substitution sites in strains with MIC = 0.25, 0.5, 1, 2, and 4 μg/ml were 17, 97, 88, 71, and 68, respectively (Supplementary Table 4).
TABLE 9

Deduced amino acid sequences of PBP1a in 300 S. pneumoniae isolates.

PBP1a groupnPercent (%)Number of substitution sitesSubstitution rate (%)3333333333333333333334444444444444445555555555555555555555555566666666666666666666666
1111222334557888899990001123456777990011111123444556677777788900011112222333334444455
2678016377181256823575683412392345573524567803036036801456735267912562389025680135904
DTDEVAEISASITLGVETIHENTVRGLPNISDKKTYHVEEFSNVTDSTNAPEINHTSQFLASLVNLTAKMTGSNENIELYNEKNS
1A 014013.310.3D-
1A 0251.720.6DR
1A 0351.720.6DQ-
1A 044414.720.6DT-
1A 05113.720.6ID-
1A 0682.720.6DE-
1A 0762.030.9IDT-
1A 0810.3102.9DDLLTDIQQP
1A 0910.3154.4DVIGPKYNTGYMVAD
1A 1010.3185.2DDLVIGPKYNTGYMVADV
1A 1120.7257.3NTDDINIHNIDAEVIGPKYNTGYDV
1A 1210.3277.8NTSDDILQTGPKYNTGYMVIIDFLVDI
1A 1310.33610.5SSDVATAIDMNISATDMANQKTGPVNTGYMVIDFL
1A 1410.33710.8SSDVATSDSVDLHVITDMANQKTGPVNTGYMVIDFL
1A 158628.74312.5SSDVATSDSVDLHVITDMANIHNIDAETGPKYNTGYMVIDFL
1A 1693.04312.5SSDVATSDMNISATDMAAGPDKNTGYMVIDFLISDDQGTMDF
1A 1731.04412.8SSDVATSDSVDLHVITDMANIHNIDAIETGPKYNTGYMVIDFL
1A 183511.74513.1SSDVATAIDMNISATDMANQKTGPVNTGYMVIDFLIDTHTMDFP
1A 1993.04613.4VATAIDMNISATDMANQIHNDEAGPADKNTGYMVIDFLIDTHTMDF
1A 2020.74914.2SADIDSVDLKVITDMANIHNISYADPEAGPDYNTGYMVIDFYDNGTMSK
1A 2110.35014.5ISADIDSVDLKVITDMANIHNISYADPEAGPDYNTGYMVIDFYDNGTMSK
1A 2251.75114.8SSDVATAIDMNISATDMANQIHNKDEAGPADKNTGYMVIDFLIDTHTMDF
1A 2310.35215.1SESDVATIDMNISATDANHIHNIDAEAGPDKNTGYMVIDFLISDDQGTMDF
1A 24217.05315.4SSDVATSDSVDLHVITDMANIHNIDAETGPKYNTGYMVIIDFLGRDNHGTMS
1A 2510.35516.0SSDVATSDSVDLHVITDMANIHNIDAETGPKYNTGYMVIIDFLGRDNHGTMSQN
Deduced amino acid sequences of PBP1a in 300 S. pneumoniae isolates.

Association Between Serotypes, Penicillin Susceptibility and Penicillin-Binding Proteins Substitution Patterns

Based on a comprehensive analysis of the substitutions of PBP2x, PBP2b and PBP1a, the 300 S. pneumoniae isolates could be divided into 101 PBPs substitution combinations: PBP001- PBP101 (Table 10).
TABLE 10

Association of serotypes, penicillin susceptibility and substitution patterns of variations in PBP2x, PBP2b and PBP1a in 300 S. pneumoniae isolates.

SerotypeMIC (μg/ml)No.Substitution patterns of PBPsGroup of PBP2xGroup of PBP2bGroup of PBP1a
1 ≤ 0.0155P0312X022B 041A 04
2 ≤ 0.0151P0222X012B 011A 03
3 ≤ 0.0159P0012X012B 011A 01
≤ 0.0151P0032X042B 011A 01
≤ 0.0153P0112X012B 061A 01
≤ 0.0151P0122X052B 061A 01
≤ 0.0151P0132X012B 071A 01
≤ 0.0154P0142X012B 091A 01
≤ 0.0152P0252X042B 011A 04
≤ 0.0151P0262X092B 011A 04
≤ 0.0152P0282X222B 011A 04
≤ 0.0151P0422X022B 041A 05
≤ 0.0151P0432X062B 041A 05
≤ 0.0151P0462X022B 131A 05
≤ 0.015-0.034P0472X012B 011A 06
4 ≤ 0.0151P0242X012B 011A 04
5 ≤ 0.0151P0012X012B 011A 01
≤ 0.0151P0032X042B 011A 01
6A0.51P0072X372B 021A 01
0.251P0542X202B 151A 09
28P0902X372B 201A 19
11P0912X372B 421A 19
0.51P0992X332B 391A 23
6B0.251P0052X152B 011A 01
0.51P0192X162B 321A 01
0.251P0272X152B 011A 04
0.51P0532X182B 141A 08
0.52P0662X372B 311A 15
0.51P0772X342B 451A 15
0.51P0952X412B 301A 22
12P0972X312B 361A 22
0.51P0982X312B 381A 22
6C0.251P0042X102B 011A 01
≤ 0.0151P0362X022B 111A 04
7C0.031P0102X222B 041A 01
21P0962X302B 341A 22
7F ≤ 0.0152P0152X012B 111A 01
8 ≤ 0.0154P0232X022B 011A 03
9A ≤ 0.0151P0412X082B 011A 05
≤ 0.0151P0442X082B 041A 05
9N ≤ 0.0151P0272X152B 011A 04
≤ 0.0151P0422X022B 041A 05
9V ≤ 0.0152P0412X082B 011A 05
≤ 0.0151P0452X112B 041A 05
10A0.061P0272X152B 011A 04
≤ 0.0151P0492X012B 011A 07
≤ 0.0151P0512X012B 051A 07
11A ≤ 0.0151P0062X022B 021A 01
≤ 0.0153P0522X022B 101A 07
12F ≤ 0.0154P0202X082B 041A 02
13 ≤ 0.0151P0292X232B 011A 04
0.121P0332X142B 041A 04
0.51P0562X272B 331A 11
140.51P0562X272B 331A 11
0.51P0572X212B 241A 12
11P0582X372B 201A 13
11P0652X302B 281A 15
11P0832X372B 191A 18
0.51P0892X302B 281A 18
2-421P1002X382B 261A 24
15A ≤ 0.0152P0322X082B 041A 04
0.51P0392X242B 221A 04
15B11P0482X352B 291A 06
12P0782X352B 171A 16
11P0792X352B 291A 16
15C15P0782X352B 171A 16
11P0802X352B 341A 16
15F0.251P0362X022B 111A 04
≤ 0.0151P0472X012B 011A 06
17 ≤ 0.0151P0472X012B 011A 06
17A ≤ 0.0151P0312X022B 041A 04
18C ≤ 0.0151P0422X022B 041A 05
19A ≤ 0.0151P0242X012B 011A 04
21P0712X012B 441A 15
2-432P0722X282B 441A 15
21P0732X292B 441A 15
21P0742X352B 441A 15
24P0752X392B 441A 15
21P0762X412B 441A 15
19F0.51P0162X022B 221A 01
0.51P0602X372B 181A 15
0.51P0612X372B 211A 15
11P0622X302B 241A 15
11P0632X322B 241A 15
16P0642X372B 241A 15
41P0682X362B 401A 15
41P0692X402B 411A 15
2-427P0702X412B 431A 15
11P0862X412B 201A 18
200.54P0182X172B 271A 01
≤ 0.0153P0322X082B 041A 04
22F0.51P0372X222B 161A 04
23A0.51P0552X192B 371A 10
0.51P0922X252B 231A 20
11P0932X302B 261A 20
11P0942X302B 241A 21
23F0.53P0382X122B 221A 04
≤ 0.0151P0402X012B 011A 05
11P0592X342B 351A 14
23P0672X342B 351A 15
12P0812X342B 201A 17
11P0822X412B 351A 17
21P0842X022B 201A 18
2-427P0852X372B 201A 18
22P0862X412B 201A 18
21P0872X432B 201A 18
21P0882X422B 251A 18
24F ≤ 0.0151P0012X012B 011A 01
≤ 0.0152P0242X012B 011A 04
25A0.251P0212X072B 121A 02
0.121P0352X132B 081A 04
25F0.251P0342X082B 081A 04
28A ≤ 0.0152P0082X022B 041A 01
28F ≤ 0.0153P0302X022B 031A 04
29 ≤ 0.0151P0022X032B 011A 01
0.031P0092X032B 041A 01
0.51P0172X262B 221A 01
33B0.032P0272X152B 011A 04
34 ≤ 0.0153P0242X012B 011A 04
0.031P0272X152B 011A 04
0.031P0312X022B 041A 04
≤ 0.0151P0472X012B 011A 06
0.031P0502X102B 021A 07
NT11P1012X332B 461A 25
Association of serotypes, penicillin susceptibility and substitution patterns of variations in PBP2x, PBP2b and PBP1a in 300 S. pneumoniae isolates. Serotype 3 had the most PBPs substitution combinations, with a total of 13 groups. Except for the P047 combination, in which strains had PEN MICs ranging between 0.015-0.03 μg/ml, strains in the other 12 groups all had a PEN MIC of ≤0.015 μg/ml. The next serotype with the most PBPs substitution combinations was 23F with 11combinations. Save for the PEN MIC of 3 strains in group P038 and 1 strain in group P040 which were 0.5 μg/ml and ≤ 0.015 μg/ml, respectively, the PEN MIC of 42 strains in the other nine PBPs substitution combinations were between 1- 4 μg/ml. A total of 10, 8, 7, 7, 5, 5 PBPs substitution combinations were detected in serotypes 19F, 6B, 14, 19A, 6A, and 34, respectively. The number of the corresponding substitution combinations in other serotypes were ≤4. The strains of serotypes 1 (n = 5, P031), 2 (n = 1, P022), 4 (n = 1, P024), 7F (n = 2, P015), 8 (n = 4, P023), 12F (n = 4, P020), 17 (n = 1, P047), 17A (n = 1, P047), 18C (n = 1, P042), 28A (n = 2, P008), 28F (n = 3, P030) all had a PEN MIC ≤ 0.015 μg/ml and all strains within one serotype belonged to the same PBPs substitution combination. Serotypes 22F, 25F, and NT only had one strain in each group and PEN MICs were 0.5, 0.25, and 1 μg/ml respectively, corresponding to the unique substitution combination P037, P034, and P101, respectively.

Discussion

In this study, 300 S. pneumoniae strains isolated from IPD were analyzed for serotype distribution, antimicrobial susceptibility and PBPs substitutions. To our knowledge, this is the largest multicenter study involving invasive S. pneumoniae strains in China, in terms of number and diversity of origin of the isolates studied. Based on the Quellung reaction, 40 different serotypes were detected amongst 299 typeable S. pneumoniae strains, with the five most common serotypes being 23F, 19A, 19F, 3, and 14. The serotype distribution in the current study is consistent with those from other studies in China, although the isolation rates varied (Zhao et al., 2013, 2020). All strains were susceptible to ETP, LEV, LZD, and VA, which is consistent with most studies in our region and abroad (Zhanel et al., 2006; Zhao et al., 2013), (Zhou et al., 2016; Cai et al., 2018; Fu et al., 2019; Golden et al., 2019; Shi et al., 2019). AMC was the second most active antimicrobial drug with a non-susceptibility rate of 2.3%, which is significantly lower than that reported in the national data for 2006 – 2008 in which the non- susceptibility rate was 5.3%, and the one from Beijing for the period 2012 and 2017 (10.2%) (Zhanel et al., 2006; Shi et al., 2019). A meta-analysis of invasive S. pneumoniae strains from Chinese children (2000 to 2016) also showed a very high proportion of AMC resistance among the isolates at 16.1%, which may be due to the higher proportion of PCV7-related serotype strains in these studies of 60.8%, compared to 42.3% in the present study (Fu et al., 2019). It has been previously reported that invasive S. pneumoniae strains of PCV7-related serotypes are more resistant to AMC than non-PCV7 serotype strains (15.7% vs. 1.7, P = 0.013) (Liu et al., 2010). PRSP accounted for 70.2% of CSF derived strains in this study, which is lower than in previous studies based on invasive S. pneumoniae strains from children only, ranging from 76.6 to 95.7%, but higher than that reported in isolates from IPD cases in both adults and children, at 51.5% (Xue et al., 2010; Zhou et al., 2016; Shi et al., 2019). No PRSP was detected in strains from non-CSF specimens, and PISP accounted for 4.5% of the isolates, which was higher than that reported in IPD isolates from both adults and children at 3.8% (Zhao et al., 2013), but significantly lower than reported in children isolates from Shenyang (2010 to 2014), in which the resistance rate was very high at 32.3% (Fu et al., 2019). According to the oral breakpoint interpretation for all strains studied, PISP and PRSP accounted for 23.0% and 44.7% of the isolates, respectively, which were higher than reported in the comprehensive meta-analysis study of invasive S. pneumoniae strains from children (oral break points PISP: 42.6%, PRSP: 32%) (Fu et al., 2019). Data from the SENTRY program of the global multi-center surveillance study (1997-2016) showed that the Asia-Pacific region had the lowest S. pneumoniae penicillin susceptibility rate (52.4%, oral breakpoint) but the highest multi-drug (49.8%) and pan-drug resistance (17.3%) rates, compared with North America, Europe, and Latin America. However, the SENTRY program did not include data from mainland China (Sader et al., 2019). Previous data based on 881 S. pneumoniae isolates from 23 teaching hospitals across China from 2011 to 2016, showed that PRSP accounted for 51.6% of the isolates (oral breakpoint), a rate which is slightly higher than in the present study, but only 11.6% of the isolates were considered invasive in that previous study (Zhao et al., 2017). The resistance mechanism of S. pneumoniae to penicillin and other BLAs is mainly affected through the modification of PBPs (Hakenbeck et al., 2012). There are 6 different PBP types described in S. pneumoniae, including PBP1a, PBP1b, PBP2a, PBP2b, PBP2x and PBP3. They can be divided into three categories according to their molecular weights and functions; type A: high molecular weight PBP containing PBP1a, PBP1b and PBP2a with transglycosidase activity and transpeptidase activity; type B: high molecular weight PBPs containing PBP2b and PBP2x with transpeptidase activity; type C: low molecular weight PBPs containing PBP3 with carboxypeptidase activity (Zapun et al., 2008; Hakenbeck et al., 2012). Three types of PBPs play a major role in BLAs resistance, namely PBP2x, PBP2b, and PBP1a (Zapun et al., 2008). Normally, BLAs can combine with serine at the PBPs active site to form serine esters, thereby inhibiting the synthesis of bacterial cell walls, and leading to bacterial death. When there is PBPs substitution, the reactivity for BLAs drugs is reduced resulting in limited effectiveness of the drugs and eventual development of drug resistance (Zapun et al., 2008). Studies have shown that substitutions in the active sites of PBP2x and PBP2b, and their adjacent sites only cause low levels of BLAs resistance (Laible et al., 1991; Grebe and Hakenbeck, 1996; Sifaoui et al., 1996). However, combination substitutions involving PBP1a and those of PBP2b and PBP2x, can cause high levels of BLAs resistance, but PBP1a substitution alone cannot cause an increase in BLAs resistance levels (Zerfass et al., 2009). Substitutions in the PBP2b active sites mainly cause bacteria to be resistant to penicillin, but have nothing to do with cephalosporin resistance. On the contrary, substitutions in the PBP2x active sites are mainly related to cephalosporin resistance, and can result in high-level resistance to third-generation cephalosporin when combined with PBP1a substitutions (Zapun et al., 2008; Hakenbeck et al., 2012). Although many studies have been performed on PBPs, both domestically in Asia and abroad, there are limited studies on S. pneumoniae isolates from IPD in mainland China. Our study mainly focused on the gene substitutions of pbp2x, pbp2b, and pbp1a among 300 invasive S. pneumoniae strains and their relationship with PEN MIC and serotype. In this study, the variations in the PBPs gene active sites were highly diverse, and the number of substitutions were higher than those in previous studies (Zhou et al., 2016; Chu et al., 2018). Among the invasive S. pneumoniae isolates studied, strains with PEN MIC ≤ 0.25 μg/ml had no PBPs active site substitutions, except for one strain of serotype 6A (MIC = 0.25 μg/ml). On the other hand, strains with PEN MIC ≥ 0.5 μg/ml all had PBPs active site substitutions, while strains with high PEN MIC levels (MIC ≥ 1 μg/ml) all had PBP1a substitutions, which were accompanied by PBP2x and PBP2b substitutions. Even if the antimicrobial susceptibility phenotype of invasive S. pneumoniae derived from non-CSF was interpreted as susceptible by the meningitis breakpoint, the strains still had substitutions in different PBPs active sites. Thus the PBPs substitution of the strains was mainly related to PEN MICs, and less influenced by specimen type and antibiotic breakpoints. We analyzed a total of 338 amino acids from positions 259-596 of PBP2x, and 98 different substitutions at 73 amino acid positions were detected. According to the distribution of PEN MIC, the number of substitution sites of strains with PEN MIC ≤ 0.12 μg/ml were more than that of PBP1a and PBP2b, ranging from 10-32. With the increase in PEN MIC, the number of substitution sites increased also, and the strains with MIC = 0.5 μg/ml had the maximum number of substitutions. In the study of Zhou et al., the average number of substitutions in PSSP strains was much higher for PBP2x than for PBP2b (29.26 vs. 8.22). Interestingly, they also found a significantly higher number of substitution sites in PRSP (65.55 ± 2.93) and PISP (63.37 ± 2.51) compared to PSSP (29.26 ± 27.88) (Zhou et al., 2016). Thus, it could be presumed that the MIC value of PEN was associated with the number of substitution sites in PBP2x. Specifically, common substitutions in PBP2x active sites included T338A, M339F, H394L, and L546V, which have also been reported in previous studies (Smith and Klugman, 1995; Zhou et al., 2016; Cai et al., 2018). In the present study, 181 strains had the T338A substitution and 39 strains also contained the M339F substitution. The PEN MIC of most strains was 2-4 μg/ml. The M339F substitution was first discovered in a highly resistant clinical strain in France, and then successively detected in the USA and Japan (Coffey et al., 1995; Asahi et al., 1999; Nagai et al., 2002). Previous crystal structure studies showed that the active center 337STMK of PBP2x which had the T338A and M339F double-site substitution was deformed. Furthermore, the serine active site Ser337 also presented another conformational change, resulting in reduction in the acylation efficiency of penicillin and cefotaxime by more than 20 times (Lu et al., 2001; Chesnel et al., 2003). T338A and M339F substitutions have also been described in research reports from Taiwan, Japan, South Africa and other places, and were related to resistance in penicillin, amoxicillin and third-generation cephalosporins (Smith and Klugman, 1995; Du Plessis et al., 2002; Sanbongi et al., 2004; Davies et al., 2012; Liu et al., 2016; Zhou et al., 2016). Previous studies have shown that the L546V substitution is associated with high level resistance in BLAs, especially cephalosporins, but this substitution has also been reported in PSSP and cephalosporin-susceptible strains, suggesting that a single L546V substitution is not sufficient enough to cause high level resistance of BLAs (Nichol et al., 2002; Davies et al., 2012; Liu et al., 2016). Both crystal structure studies in vitro and transformation experiments in vivo have confirmed that R384G could affect the susceptibility of bacterial strains to penicillin and cefotaxime (Smith and Klugman, 2005; Maurer et al., 2008; Liu et al., 2016). A crystal structure study of PBP2x has found that the amino acid substitutions at position 371 and 384 affected the mobility of loop between amino acids 365-394 and were important for BLAs resistance (Carapito et al., 2006). In our study, strains with PBP2b sequences belonging to Group 2X27−2X43 all harbor the T338A substitution along with some other relevant substitutions, such as I371T, R384G, and M400T, but it is unknown which substitutions contribute to the resistance of the strains. Further experiments are needed to figure out the inner association between resistance and various substitutions. The Q552E substitution was located near the third catalytic motif 547KTG549 at the end of strand β3 loop, thus substitutions can led to an increase of the acylation efficiency for BLAs (Pernot et al., 2004; Zapun et al., 2008). In previous studies, Q552E was widely reported while in this study Q552V substitution was frequently detected in strains with PEN MIC ≤ 0.5 μg/ml. D567N substitution was previously detected in S. pneumoniae strains with high penicillin resistance in Taiwan, but has also been described in PSSP, which is consistent with the findings of this study (Liu et al., 2016). A total of 372 amino acids from positions 305-676 of PBP2b were analyzed, and a total of 111 substitutions and 2 insertion variations at 88 amino acid sites were detected. Similar to PBP1a, the number of substitution sites in strains with PEN MIC ≤ 0.12 μg/ml was no more than 10. Furthermore, the number of substitution sites increased with MIC increase, but the most substitution sites were detected in strains with PEN MIC = 0.5 μg/ml. The two insertion variations YIW and YTW were found in two strains, located between 386SVVK and 443SSN in the active site of PBP2b, which have never been reported elsewhere. Previously, Japanese researchers reported that there was a duplication of the amino acid sequence WYT at the positions 429-431 between the amino acid positions 431-432 of PBP2b (Yamane et al., 1996). The insertion sequence was detected in 13 strains, of which 10 were of serotype 19, and three were serotype 6. In that study, the MIC of PEN and cefotaxime of S. pneumoniae strains carrying the above insertion variation (WYT amino acid sequence) were 0.125-2 μg/ml and 0.063-1 μg/ml, respectively (Yamane et al., 1996). In the present study, the two strains were of serotype 6B and NT and the PEN MIC were 0.5 μg/ml and 1 μg/ml respectively. Previous studies have shown that the insertion of amino acid sequence between the conserved sequences of PBP2b in Neisseria gonorrhoeae reduced its affinity to PEN, further studies are needed to confirm its function in S. pneumoniae (Brannigan et al., 1990). Substitutions in the PBP2b active sites included T446A, T446S, and A619G, which have been reported in previous studies (Yamane et al., 1996; Sanbongi et al., 2004; Granger et al., 2005; Izdebski et al., 2008; Tian et al., 2008). In vitro experiments have shown that the affinity of T446A substitution strain to penicillin was 60% lower than that of the wild strain (Pagliero et al., 2004). However, researchers in the United States (USA), South Korea and Canada also found this substitution site in PSSP strains (Nagai et al., 2002; Baek et al., 2004; Granger et al., 2006), a finding which was also confirmed in one serotype 6A PSSP strain derived from blood (MIC = 0.25 μg/ml) in the present study. The A619G substitution has also been reported in strains in United States, Spain, Mexico, and other regions, and has been shown to be associated with high level amoxicillin resistance (Kosowska et al., 2004; Cafini et al., 2006). Other common substitutions identified in this study included E476G, Q438E, and L455I. Among them, Q438E and E476G have been reported in studies in Taiwan, France and Japan, and these substitutions were related increased levels of bacterial resistance to BLAs (Sanbongi et al., 2004; Chesnel et al., 2005; Liu et al., 2016). To the best of our knowledge, the L455I substitution is reported for the first time in this study. A total of 344 amino acids from positions 312-655 of PBP1a were analyzed, and 105 different substitutions at 85 amino acid positions were detected. Based on PEN MIC distribution, isolates with MIC ≤ 0.12 μg/ml had no more than 10 substitution sites, and the substitution sites increased with increasing MIC. However, the maximum number of substitution sites was found in strains with MIC = 0.5 μg/ml. Substitutions in the PBP1a active sites, including T371A, T371S, and P432T, have been reported in multinational studies, and are related to high level resistance in penicillin and cephalosporin (Smith and Klugman, 1998; Liu et al., 2016; Zhou et al., 2016; Chu et al., 2018). In vitro site-directed mutagenesis experiments showed that T371A substitution reduces the acylation efficiency of PBP1a to cefotaxime and penicillin by 2.4 and 26 times, respectively, and TSQF574-577NTGY substitution reduces the acylation efficiency of PBP1a to cefotaxime and penicillin by 5.5 and 49 times, respectively (Job et al., 2008). In vivo transformation studies showed that only when the two substitutions exist at the same time, the resistance level of substitution strains to BLAs would increase significantly (Smith and Klugman, 1998; Job et al., 2008). In addition, the sites with high substitution rates in this study included S540T, N546G, A550P, T574N, S575T, Q576G, F577Y, and N609D, and part of these sites have been reported in some strains in Shenyang (Zhou et al., 2016). Classification of isolates based on combination of substitution patterns in the three PBPs revealed a high degree of diversity among the isolates. Strains with the same serotype and PEN MIC exhibited different PBPs substitution combinations due to differences in the three PBPs substitution sites. For example, most strains of serotype 3 had a PEN MIC ≤ 0.015 μg/ml, but there were as many as 13 corresponding PBPs substitution combinations, although the difference between the different PBPs sites was small. Likewise, isolates with similar PBPs substitution combinations did not necessarily have the same PEN MIC levels, and this was reflected in serotypes 14, 19A, 19F, and 23F. The substitution combinations P100, P072, P070, and P085 were detected in isolates with PEN MICs between 2-4 μg/ml. A similar finding has also been reported previously, where five strains of serotype 23F with exactly the same PBPs substitutions and murM had PEN MICs ranging between 0.25-2 μg/ml (Chesnel et al., 2005). In summary, we investigated the variations in pbp2x, pbp2b, and pbp1a genes, and serotype distribution of IPD S. pneumoniae isolates collected between 2010 and 2015 in China. We analyzed the serotype distribution, resistance to PEN and PBPs substitutions amongst these strains. There was a great diversity detected in PBPs substitutions patterns among the strains, suggesting that the PEN MIC level of S. pneumoniae may be affected by several other factors. Therefore, a comprehensive understanding of antibiotic resistance mechanism of S. pneumoniae needs to be further examined at the genomic level.

Data Availability Statement

The original contributions presented in the study are included in the article/Supplementary Material, further inquiries can be directed to the corresponding author/s.

Author Contributions

YX and ZL conceived and designed the work. MZ, LW, and ZW performed the experiments, data analysis, and wrote the manuscript. YW and TK revised the manuscript. All authors read and approved the final manuscript. All authors contributed to the article and approved the submitted version.

Conflict of Interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Publisher’s Note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
  58 in total

1.  Molecular characteristics of pbp1a and pbp2b in clinical Streptococcus pneumoniae isolates in Quebec, Canada.

Authors:  Dominic Granger; Geneviève Boily-Larouche; Pierre Turgeon; Karl Weiss; Michel Roger
Journal:  J Antimicrob Chemother       Date:  2005-11-09       Impact factor: 5.790

2.  Genetic analysis of pbp2x in clinical Streptococcus pneumoniae isolates in Quebec, Canada.

Authors:  Dominic Granger; Geneviève Boily-Larouche; Pierre Turgeon; Karl Weiss; Michel Roger
Journal:  J Antimicrob Chemother       Date:  2005-05-04       Impact factor: 5.790

3.  [Study of serotype distribution, antimicrobial resistance patterns and molecular epidemiology in 148 isolates of invasive Streptococcus pneumoniae].

Authors:  Chun-Lin Liu; Chun-Jiang Zhao; Yu-Dong Liu; Hui Wang
Journal:  Zhonghua Yi Xue Za Zhi       Date:  2010-06-08

4.  Alterations of penicillin-binding proteins 1A, 2X, and 2B in Streptococcus pneumoniae isolates for which amoxicillin MICs are higher than penicillin MICs.

Authors:  K Kosowska; M R Jacobs; S Bajaksouzian; L Koeth; P C Appelbaum
Journal:  Antimicrob Agents Chemother       Date:  2004-10       Impact factor: 5.191

5.  Biochemical characterization of Streptococcus pneumoniae penicillin-binding protein 2b and its implication in beta-lactam resistance.

Authors:  Estelle Pagliero; Laurent Chesnel; Julie Hopkins; Jacques Croizé; Otto Dideberg; Thierry Vernet; Anne Marie Di Guilmi
Journal:  Antimicrob Agents Chemother       Date:  2004-05       Impact factor: 5.191

6.  Interspecies recombinational events during the evolution of altered PBP 2x genes in penicillin-resistant clinical isolates of Streptococcus pneumoniae.

Authors:  G Laible; B G Spratt; R Hakenbeck
Journal:  Mol Microbiol       Date:  1991-08       Impact factor: 3.501

7.  Penicillin-binding proteins 2b and 2x of Streptococcus pneumoniae are primary resistance determinants for different classes of beta-lactam antibiotics.

Authors:  T Grebe; R Hakenbeck
Journal:  Antimicrob Agents Chemother       Date:  1996-04       Impact factor: 5.191

8.  Molecular Characterization and Correlation with β-lactam Resistance of Streptococcus pneumonia Isolates in Hangzhou, China.

Authors:  Mei Fen Chu; Xiao Xiang Liu; Shao Ni Zhang; Yan Ying Huang; Peng DU; Li Fang Wang; Lei Ji; Jie Yan; Ai Hua Sun
Journal:  Biomed Environ Sci       Date:  2018-05       Impact factor: 3.118

9.  Antimicrobial Susceptibility of Streptococcus pneumoniae from North America, Europe, Latin America, and the Asia-Pacific Region: Results From 20 Years of the SENTRY Antimicrobial Surveillance Program (1997-2016).

Authors:  Helio S Sader; Rodrigo E Mendes; Jennifer Le; Gerald Denys; Robert K Flamm; Ronald N Jones
Journal:  Open Forum Infect Dis       Date:  2019-03-15       Impact factor: 3.835

10.  Phenotypic and genotypic characteristic of invasive pneumococcal isolates from both children and adult patients from a multicenter surveillance in China 2005-2011.

Authors:  Chunjiang Zhao; Feifei Zhang; Yunzhuo Chu; Yong Liu; Bin Cao; Minjun Chen; Yunsong Yu; Kang Liao; Liyan Zhang; Ziyong Sun; Bijie Hu; Jin'e Lei; Zhidong Hu; Xiaobing Zhang; Hui Wang
Journal:  PLoS One       Date:  2013-12-11       Impact factor: 3.240

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.