Literature DB >> 34957460

Complete genome sequence of Clostridium perfringens B20, a bacteriocin-producing pathogen.

Arxel G Elnar1, Geun-Bae Kim1.   

Abstract

Clostridium perfringens B20 was isolated from chicken feces collected from a local farm associated with Chung-Ang University (Anseong, Korea). The whole genome of C. perfringens B20 was sequenced using the PacBio RS II platform and assembled de novo. The genome is 2,982,563 bp long and assembled in two contigs. Annotation analyses revealed 2,668 protein-coding sequences, 30 rRNA genes, and 94 tRNA genes, with 28.2% G + C (guanine + cytosine) content. In silico genomic analysis revealed the presence of genes encoding a class IId bacteriocin, lactococcin A, and associated ABC transporter and immunity proteins, as well as a putative bacteriocin gene. © Copyright 2021 Korean Society of Animal Science and Technology.

Entities:  

Keywords:  Bacteriocin; Clostridium perfringens; Lactococcin A; Pathogen; Virulence; Whole genome sequence

Year:  2021        PMID: 34957460      PMCID: PMC8672250          DOI: 10.5187/jast.2021.e113

Source DB:  PubMed          Journal:  J Anim Sci Technol        ISSN: 2055-0391


INTRODUCTION

Bacteriocin production among lactic acid bacteria is currently a rapidly expanding field of research, which has been stimulated to a large extent by issues regarding the safety of using live probiotics and has, thus, driven a shift toward the development and elaboration of postbiotics [1]. Postbiotics are currently defined as bioactive compounds that are not probiotic, prebiotic, or paraprobiotic, and can include soluble factors, cell compounds, and metabolic products and/or by-products. Compared with live probiotics, some of the advantages of using postbiotics, including bacteriocins, include safer administration, longer shelf-life, and lower probability of the acquisition and spread of resistance genes and other virulence factors [2]. However, although bacteriocin production is considered a favorable trait for potential probiotic strains, the same may not hold true for pathogenic microbes. In order to successfully colonize a host and establish a suitable niche, pathogens require diverse mechanisms that would enable them to evade possible immune responses, replicate, and ensure disease transmission. Clostridium perfringens, a Gram-positive bacterium, is a known causative agent for several disorders in humans (clostridial myonecrosis and food poisoning) and animals (necrotic enteritis in poultry) [3]. The pathogenicity of C. perfringens is associated with the production of major toxins (α-toxin, β-toxin, ι-toxin, and ε-toxin), subsidiary toxins (collagenase, enterotoxin, and perfringolysin O), and antimicrobial peptide resistance genes (e.g., tetracycline resistance efflux protein and specific aminoglycoside resistance genes) [4]. Here, based on genetic analysis, we report evidence of bacteriocin production by a C. perfringens isolate, provisionally designated as strain B20. Bacteriocin production by a pathogen may enhance its pathogenicity through the same mechanisms employed by probiotic strains to becomes more beneficial; specifically, through direct inhibition of competing strains and niche establishment, as well as through modulating the local microbiota [2]. Thus, it is important to deduce how pathogens acquire genes for bacteriocin production and thereby gain a better understanding of how these traits may affect their pathogenicity. C. perfringens B20 was isolated from the feces of chickens maintained in a Chung-Ang University-affiliated farm (Anseong, Korea). Strain B20 was routinely cultured anaerobically in Brain-Heart Infusion (BD Bacto, Sparks, MD, USA) medium at 37°C for 24 h [5]. Genomic DNA was extracted from 12 h cultures using a QIAamp PowerFecal DNA Kit (Qiagen, Hilden, Germany) according to the manufacturer’s instructions. The genomic DNA obtained was sequenced commercially at ChunLab (Korea) using the Pacific Biosciences (PacBio, Menlo Park, CA, USA) RSII Single Molecule Real-Time (SMRT) platform with a 20-kb SMRTbell™ template library. De novo assembly of the PacBio reads was performed using the PacBio SMAR Analysis ver. 2.3.0 program, and genome annotation was performed based on Rapid Annotation using Subsystem Technology (RAST) with default parameters (https://rast.nmpdr.org/) and CLgenomics™ ver. 1.55 software. Transfer RNAs (tRNAs) were identified using tRNAscan-SE ver. 1.3.1 [6], whereas non-coding ribosomal RNAs (rRNAs) were identified using INFERNAL ver. 1.1.3 software in conjunction with the Rfam 12.0 database [7]. The complete genome of C. perfringens B20 (Fig. 1) is 2,982,563 bp long with a G + C (guanine + cytosine) content of 28.2% and is assembled into two contigs with an N value of 2,925,822 bp. The genome contains 2,668 protein-coding sequences, 30 rRNA, and 94 tRNA genes (Table 1). Functional annotation of protein-coding sequences (Fig. 2) was performed using PRODIGAL ver. 2.6.2 software [8] and compared with the selected protein databases (SwissProt, KEGG, SEED, EggNOG).
Fig. 1.

Circular genome map of Clostridium perfringens B20.

Circles represent the following characteristics from the outermost circle to the center: (1) contig information, (2) coding sequences on forward strand, (3) coding sequences on reverse strand, (4) transfer RNAs (tRNAs) and ribosomal RNAs (rRNAs), (5) GC skew, and (6) GC ratio. G, guanine; C, cytosine.

Table 1.

Genome features of Clostridium perfringens B20

AttributeValue
Genome size (bp)2,982,563
GC content (%)28.2
No. of contigs2
Total genes2,792
Protein-coding gene2,668
tRNA94
rRNA30
Plasmids0
GenBank accession No.JAGKIL000000000

G, guanine; C, cytosine.

Fig. 2.

Subsystem category distribution by KEGG annotation (A) and cluster of orthologous groups (B) based on the functional classification of the whole genome of Clostridium perfringens B20.

KEGG, Kyoto Encyclopedia of Genes and Genomes.

Circular genome map of Clostridium perfringens B20.

Circles represent the following characteristics from the outermost circle to the center: (1) contig information, (2) coding sequences on forward strand, (3) coding sequences on reverse strand, (4) transfer RNAs (tRNAs) and ribosomal RNAs (rRNAs), (5) GC skew, and (6) GC ratio. G, guanine; C, cytosine. G, guanine; C, cytosine.

Subsystem category distribution by KEGG annotation (A) and cluster of orthologous groups (B) based on the functional classification of the whole genome of Clostridium perfringens B20.

KEGG, Kyoto Encyclopedia of Genes and Genomes. Functional annotation revealed the presence of several multidrug resistance efflux pumps and tetracycline resistance genes. Putative bacteriocin-encoding gene clusters were determined in silico using the BAGEL4 online tool (http://bagel4.molgenrug.nl/) which revealed two areas of interest in contig 53CPB201_2, corresponding to the core bacteriocin, transport, and immunity genes (Fig. 3). One open reading frame encoding the core peptide of lactococcin A (E value, 4.37 × 10−49) was also detected. The amino acid sequence of the core peptide, deduced from the putative bacteriocin gene, showed a single peptide, non-pediocin-like bacteriocin, thereby indicating that it could be classified as a class IId bacteriocin [9]. Lactococcin A was initially isolated from Lactococcus lactis subsp. cremoris LMG 2130, in which it was located on a plasmid, and showed a narrow spectrum of activity against lactococci [10]. Additionally, LanT and HylD, encoding a bacteriocin ATP binding cassette (ABC) transporter and bacteriocin binding protein, respectively, were detected downstream of the core peptide gene, and they conceivably play functional roles in membrane-associated immunity. Moreover, a putative 63-amino acid-long bacteriocin, which was not identified using BAGEL4, was detected using RAST, with the following amino acid sequence: MENLNLNQLENINGGSTLGWATATATQLGLAAAATAEVPPLSAGLAAAGAV LAGGVAVYEAWH. A BLASTP search revealed identical protein sequences associated with C. perfringens, indicating that the putative bacteriocin gene could be novel. Genomic analyses provide evidence on bacteriocin production by C. perfringens B20 and could potentially enhance its pathogenicity by eliminating the Lactococcus community and other sensitive microorganisms in the chicken gut, thereby making disease control more challenging.
Fig. 3.

Predicted bacteriocin gene cluster in Clostridium perfringens B20 genome showing a single ORF for lactococcin A (green) using BAGEL4 software.

ORF, open reading frame.

Predicted bacteriocin gene cluster in Clostridium perfringens B20 genome showing a single ORF for lactococcin A (green) using BAGEL4 software.

ORF, open reading frame.

NUCLEOTIDE SEQUENCE ACCESSION NUMBER

The sequence obtained in this Whole Genome Shotgun project has been deposited in DDBJ/ENA/GenBank under the accession number JAGKIL000000000. The version described in this paper is version JAGKIL010000000.
  10 in total

1.  Postbiotics produced by lactic acid bacteria: The next frontier in food safety.

Authors:  Mehran Moradi; Seyedeh Alaleh Kousheh; Hadi Almasi; Arash Alizadeh; Jonas T Guimarães; Nurten Yılmaz; Anita Lotfi
Journal:  Compr Rev Food Sci Food Saf       Date:  2020-08-24       Impact factor: 12.811

Review 2.  The expanding structural variety among bacteriocins from Gram-positive bacteria.

Authors:  Jeella Z Acedo; Sorina Chiorean; John C Vederas; Marco J van Belkum
Journal:  FEMS Microbiol Rev       Date:  2018-11-01       Impact factor: 16.408

Review 3.  Postbiotics and paraprobiotics: From concepts to applications.

Authors:  P F Cuevas-González; A M Liceaga; J E Aguilar-Toalá
Journal:  Food Res Int       Date:  2020-06-30       Impact factor: 6.475

4.  tRNAscan-SE: Searching for tRNA Genes in Genomic Sequences.

Authors:  Patricia P Chan; Todd M Lowe
Journal:  Methods Mol Biol       Date:  2019

5.  Prodigal: prokaryotic gene recognition and translation initiation site identification.

Authors:  Doug Hyatt; Gwo-Liang Chen; Philip F Locascio; Miriam L Land; Frank W Larimer; Loren J Hauser
Journal:  BMC Bioinformatics       Date:  2010-03-08       Impact factor: 3.169

6.  Lactococcin A, a new bacteriocin from Lactococcus lactis subsp. cremoris: isolation and characterization of the protein and its gene.

Authors:  H Holo; O Nilssen; I F Nes
Journal:  J Bacteriol       Date:  1991-06       Impact factor: 3.490

7.  Infernal 1.1: 100-fold faster RNA homology searches.

Authors:  Eric P Nawrocki; Sean R Eddy
Journal:  Bioinformatics       Date:  2013-09-04       Impact factor: 6.937

8.  Probing Genomic Aspects of the Multi-Host Pathogen Clostridium perfringens Reveals Significant Pangenome Diversity, and a Diverse Array of Virulence Factors.

Authors:  Raymond Kiu; Shabhonam Caim; Sarah Alexander; Purnima Pachori; Lindsay J Hall
Journal:  Front Microbiol       Date:  2017-12-12       Impact factor: 5.640

9.  Inhibition of Clostridium perfringens using Bacteriophages and Bacteriocin Producing Strains.

Authors:  Sunhak Heo; Min Gon Kim; Mirae Kwon; Hee Soo Lee; Geun-Bae Kim
Journal:  Korean J Food Sci Anim Resour       Date:  2018-02-28       Impact factor: 2.622

  10 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.