Verena Vogel1, Richard Bauer1, Stefanie Mauerer1, Nicole Schiffelholz2, Christian Haupt2, Gerd M Seibold3, Marcus Fändrich2, Paul Walther4, Barbara Spellerberg5. 1. Institute of Medical Microbiology and Hygiene, Ulm University Medical Center, Ulm, Germany. 2. Institute of Protein Biochemistry, Ulm University, Ulm, Germany. 3. Department of Biotechnology and Biomedicine, Technical University of Denmark, Kongens Lyngby, Denmark. 4. Central Facility for Electron Microscopy, Ulm University, Ulm, Germany. 5. Institute of Medical Microbiology and Hygiene, Ulm University Medical Center, Ulm, Germany. barbara.spellerberg@uniklinik-ulm.de.
Abstract
As a conserved defense mechanism, many bacteria produce antimicrobial peptides, called bacteriocins, which provide a colonization advantage in a multispecies environment. Here the first bacteriocin of Streptococcus anginosus, designated Angicin, is described. S. anginosus is commonly described as a commensal, however it also possesses a high pathogenic potential. Therefore, understanding factors contributing to its host colonization and persistence are important. A radial diffusion assay was used to identify S. anginosus BSU 1211 as a potent bacteriocin producer. By genetic mutagenesis the background of bacteriocin production and the bacteriocin gene itself were identified. Synthetic Angicin shows high activity against closely related streptococci, listeria and vancomycin resistant enterococci. It has a fast mechanism of action and causes a membrane disruption in target cells. Angicin, present in cell free supernatant, is insensitive to changes in temperature from - 70 to 90 °C and pH values from 2 to 10, suggesting that it represents an interesting compound for potential applications in food preservation or clinical settings.
As a conserved defense mechanism, many bacteria produce antimicrobial peptides, called bacteriocins, which provide a colonization advantage in a multispecies environment. Here the first bacteriocin of Streptococcus anginosus, designated Angicin, is described. S. anginosus is commonly described as a commensal, however it also possesses a high pathogenic potential. Therefore, understanding factors contributing to its host colonization and persistence are important. A radial diffusion assay was used to identify S. anginosus BSU 1211 as a potent bacteriocin producer. By genetic mutagenesis the background of bacteriocin production and the bacteriocin gene itself were identified. Synthetic Angicin shows high activity against closely related streptococci, listeria and vancomycin resistant enterococci. It has a fast mechanism of action and causes a membrane disruption in target cells. Angicin, present in cell free supernatant, is insensitive to changes in temperature from - 70 to 90 °C and pH values from 2 to 10, suggesting that it represents an interesting compound for potential applications in food preservation or clinical settings.
Streptococcus anginosus is commonly regarded as a commensal of mucosal membranes. Together with Streptococcus constellatus and Streptococcus intermedius it forms the Streptococcus anginosus Group (SAG), which belongs to the viridians streptococci. It is found in the oral cavity, the gastrointestinal and the urogenital tracts[1,2]. However, increasing evidence points to the pathogenic potential of S. anginosus. The incidence rate of (8.65/100.000) of invasive SAG infections is higher than Group A and B streptococci (4.3 and 3.1/100,000 population) combined[3,4]. The species S. anginosus can cause severe purulent infections at all body sites in particular cranial infections[4]. Furthermore, isolation has been reported from invasive infections, abscesses, urine, blood cultures and cystic fibrosis patients[3,5-8].In a natural environment, bacteria are part of multispecies communities, where space and nutrients are a limiting factor[9]. For efficient host colonization, it is important for bacteria to outcompete rival species. A mechanism for dealing with competing species is bacteriocin production. Bacteriocins are small antimicrobial peptides produced by bacteria to inhibit the growth of other, often closely related, bacteria[10,11]. These cationic peptides are ribosomally produced and either undergo major (class I) or nearly no post translational modification (class II). Class I and II bacteriocins are characterized by being thermostable and by possessing a molecular mass of less than 10 kDa. The main mechanism of action is the disruption of cell wall and membrane integrity of target species. Bacteriocin producers are rendered insensitive towards their own bacteriocin by simultaneous expression of immunity proteins. Bacteriocin production is often regulated via quorum sensing (QS) mechanisms[12-15]. QS is a cell density dependent regulation of gene expression.It is a common trait of lactic acid bacteria to produce bacteriocins, and several streptococcal bacteriocins have been described[16-18]. For several streptococci bacteriocin production is not only important for intra- and interspecies competition but also for the acquisition of extracellular DNA. In Streptococcus pneumoniae and Streptococcus salivarius bacteriocin production is coupled to competence[19,20]. By killing target organisms, DNA is released into the extracellular environment and subsequently taken up by the competence machinery. Similar to S. pneumoniae and S. salivarius, S. anginosus is naturally competent[21]. Bacteriocins have been shown to recognize and bind to specific membrane receptors and thereby facilitating the killing of target cells. For several class II bacteriocins the mannose-phosphotransferase system (Man-PTS) was identified as receptor[22-24].So far, bacteriocin production of S. anginosus has not been analyzed in detail. Mendonca et al. investigated the regulation of a putative bacteriocin in Streptococcus intermedius[12]. In this species the Streptococcal invasion locus (sil), has been shown to act as a regulator for bacteriocin production[12,25,26]. The sil locus encodes a QS system consisting of a two–component system (SilA/B), a signaling peptide (SilCR) and an export/processing system (SilD/E). In S. intermedius the putative bacteriocin production was reported to be induced by the addition of SilCR, but the bacteriocin itself has not been characterized experimentally. However, even though similar genes are present in S. anginosus neither bacteriocin production nor the sil locus has been investigated in this species.To study the bacteriocin production of S. anginosus, we screened multiple S. anginosus strains for their ability to inhibit closely related bacterial species. Through targeted mutations, the genetic background for bacteriocin production of S. anginosus was identified. The novel bacteriocin was designated as Angicin and phenotypic traits like spectrum of activity, sensitivity towards heat, pH and enzymes as well as the mechanisms of inducing bacteriocin production are elucidated.
Results
Isolation of the bacteriocin producing S. anginosus strain BSU 1211
Producing bacteriocins is a common trait of streptococci. Screening 95 clinical Streptococcus anginosus isolates for strains inhibiting the growth of the closely related streptococcal species Streptococcus anginosus SK 52, Streptococcus constellatus, Streptococcus intermedius and Streptococcus pyogenes (Supplementary Table S1) led to the identification of the strain S. anginosus BSU 1211. Out of the 95 clinical S. anginosus isolates 44 (46%) were able to inhibit at least one of these streptococcal indicator strains, while strain BSU 1211 appears to be a potent bacteriocin producer that was active against multiple species and caused the biggest inhibition zone of all strains. When tested in a one-layer radial diffusion assay (RDA) it shows activity against the S. anginosus type strain SK52 and other streptococci like S. constellatus, S. intermedius and S. pyogenes (Fig. 1). In addition, the pathogen Listeria monocytogenes as well as other listerial species like Listeria ivanovii and Listeria grayi are strongly inhibited by S. anginosus BSU 1211 (Fig. 1). However, for both L. monocytogenes and L. ivanovii sometimes colonies could be seen in the inhibition zones.
Figure 1
Spectrum of activity of S. anginosus BSU 1211. In a one-layer radial diffusion assay (RDA) S. anginosus BSU 1211 was tested for an effect against several target species. S. anginosus BSU 1211 shows activity against oral streptococci and several listeria species. Depicted is the mean ± standard deviation of at least five experiments.
Spectrum of activity of S. anginosus BSU 1211. In a one-layer radial diffusion assay (RDA) S. anginosus BSU 1211 was tested for an effect against several target species. S. anginosus BSU 1211 shows activity against oral streptococci and several listeria species. Depicted is the mean ± standard deviation of at least five experiments.Subsequently, the clinically relevant ESKAPE pathogens, consisting of Enterococcus faecium, Staphylococcus aureus, Klebsiella pneumoniae, Acinetobacter baumannii and Pseudomonas aeruginosa were investigated for a susceptibility towards bacteriocins of S. anginosus BSU 1211. These species cause nosocomial infections and are associated with high mortality[27,28]. However, no activity against any of these strains was seen. Additionally, neither staphylococci (Staphylococcus aures, Staphylococcus epidermidis), lactobacilli (Lactobacillus gasseri, Lactobacillus acidophilus, Lactobacillus paracasei, Lactobacillus rhamnosus, Lactobacillus casei), other streptococci (Streptococcus agalactiae, Streptococcus mutans, Streptococcus dysagalactiae subsp. equisimilis, Streptococcus suis, Streptococcus porcinus, Streptococcus pneumoniae, Streptococcus mitis, Streptococcus oralis), Escherichia coli nor Bacillus subtilis were inhibited by S. anginosus BSU1211.
Genetic background of bacteriocin production
To identify genes responsible for bacteriocin production in S. anginosus BSU 1211 the sil locus and the surrounding regions of the genome were sequenced. In S. intermedius and other species of the SAG, a putative bacteriocin encoding region is adjacent to the quorum sensing locus sil[12]. We found that all sil genes are present in S. anginosus BSU 1211 and that an adjacent region is present, resembling the putative bacteriocin accessory region described in Mendonca et al. (Fig. 2). The open reading frames (ORF) were designated bacteriocin like peptide3 (blp3) in accordance with similar findings in S. pyogenes (Hertzog et al., 2018.). Bioinformatic analysis of the genes in this region with BLAST (https://blast.ncbi.nlm.nih.gov/Blast.cgi) and Bagel4 (http://bagel4.molgenrug.nl/) predicted three putative class II bacteriocins (blp3.1, blp3.4, blp3.6) (Table 1). By Bagel4 core peptide analysis, the proteins encoded by blp3.1 (MKTKTLEKFEVLNSEMLARVEGGGCNWGDFAKSGIAGGAGNRLRLGIKTITWQGVVAGAVGGAIIGKVGYGATCWW) and blp3.6 (MNTKSLEKFEVLNSEMLASVEGGKIGAGEAAQALAVCTVAGGTIGSVFPGVGTAVGAILGAQYCTGAWAIIRAH) resemble the known bacteriocin BlpU (Table 1). Both contain GxxxG motifs, which are a hallmark for two peptide bacteriocins[29]. A high homology to the Bovicin variant 255 and Garvicin Q is found for Angicin (MKESENFMLNLKGEVVNELSDVQLSEISGGGSGYCKPVMVGANGYACRYSNGRWDYKVTKGIFQATTDVIVKGWAEYGPWIPRH) (encoded by blp3.4). The finding that blp3.1, blp3.4 and blp3.6 all encode a leader peptide with a double glycine motif, further supports the theory of these peptides being putative bacteriocins. All other deduced proteins did not match any of the known bacteriocin. Further sequence analysis with Bagel4 predicted blp3.3 and blp3.5 to encode immunity proteins. For blp3.2 no hypothetical function could be determined, while CAAX showed high similarities (99%) to the CPBP family of intramembrane metalloprotease in BLAST analysis.
Figure 2
Genetic organization of S. anginosus BSU 1211. The sil genes and the blp3 region were sequenced and open reading frames were adapted from Mendonca et al. and labeling was done in line with Hertzog et al.[12,17]. Blp3.1, blp3.4 and blp3.6 are predicted as putative bacteriocins. Blp3.3 and blp3.5 were predicted as putative immunity proteins. SilA, silB, silCR, silD and silE form a quorum sensing system. In red the deleted region of S. anginosus BSU 1211∆blp3 is demonstrated. Schematic overview was constructed with SnapGene.
Table 1
Bioinformatic analysis of blp3 region.
Bagle4
BlastX (query/identitiy)
Blp3.1
BlpU
Bacteriocin [S. anginosus] (98%/100%)
Blp3.2
No function determined
Hypothetical protein [S. anginosus] (99%/99%)
Blp3.3
Putative piscicolin 126 immunity protein, PisI
Bacteriocin immunity protein [S. anginosus] (98%/100%)
Blp3.4
Bovicin variant 255
MULTISPECIES: Garvicin Q family class II bacteriocin [Streptococcus] (90%/ 100%)
Blp3.5
Bacteriocin self-immunity, putative
Hypothetical protein SII_1169 [S. intermedius C270] (98%/100%)
MULTISPECIES: CPBP family intramembrane metalloprotease [Streptococcus] (99%/99.95%)
Genetic organization of S. anginosus BSU 1211. The sil genes and the blp3 region were sequenced and open reading frames were adapted from Mendonca et al. and labeling was done in line with Hertzog et al.[12,17]. Blp3.1, blp3.4 and blp3.6 are predicted as putative bacteriocins. Blp3.3 and blp3.5 were predicted as putative immunity proteins. SilA, silB, silCR, silD and silE form a quorum sensing system. In red the deleted region of S. anginosus BSU 1211∆blp3 is demonstrated. Schematic overview was constructed with SnapGene.Bioinformatic analysis of blp3 region.The blp3-region could be identified in some completely sequence S. anginosus isolates (J4211, C1051, MAS624, C238, FDAARGOS_1155, FDAARGOS_1357) as well as in several other clinical S. anginosus isolates (BSU 1326, BSU 1370, BSU 1401). The blp3-regions of S. anginosus J4211, C1051, BSU 1370 and BSU 1401 contain the same genes and are 99% identical with strain BSU 1211. Blp3.1 of S. anginosus J4211, C1051, BSU 1326 and BSU 1401 has one mutation (R42G) when compared to Blp3.1 of S. anginosus BSU 1211, while the deduced peptide sequence of blp3.4 and blp3.6 is identical in all analyzed strains.The putative regulatory sil locus of S. anginosus BSU 1211 appears to be conserved in S. anginosus strains. The genes silA, silD and silE are identical to the respective genes described in the whole genomes sequence of S. anginosus_1_2_62CV. Furthermore, silB shows 99.85% and silCR 99.32% sequence identity. However, a point mutation was found in silCR leading to an amino acid change (F11L) in the mature autoinducing peptide SilCR, when compared to SilCRSAG-B. Thus, SilCR of S. anginosus BSU 1211 (GWLEDLFSPYFKKYKLGKLGQPDLG) is labeled SilCRSAG-C.
Regulation and induction of bacteriocin production
Even though the strains BSU 1326, 1370 and 1401 encode the same bacteriocins as S. anginosus BSU 1211 no or only moderate inhibition of target strains can be observed in a one-layer RDA (Fig. 3). To investigate if bacteriocin production in these strains is dependent on the sil locus, synthetic autoinducing peptide SilCR was added in a one-layer RDA. Inhibition zones increase as soon as SilCRSAG-C is administered to the bacterial culture (Fig. 3). Without the addition of SilCRSAG-C
S. anginosus BSU 1326 and 1370 are not able to inhibit any target strains. For S. anginosus BSU 1326 inhibition zones with a diameter of 0.36 cm for S. constellatus and 0.47 cm for L. monocytogenes were observed in the presence of 100 ng SilCRSAG-C. Similar effects occurred for the strain BSU 1370 and BSU 1401 (Fig. 3). However, the addition of SilCRSAG-C did not lead to larger inhibition zones for S. anginosus BSU1211, suggesting that maximal bacteriocin expression is already present in this strain. It is possible that in strain BSU 1211 bacteriocins are expressed constitutively. The autoinducing peptide SilCRSAG-C alone did not cause any inhibition of target strains.
Figure 3
Induction of Angicin production by addition of SilCRSAG-C. Result of a one-layer radial diffusion assay. S. constellatus BSU 1213 and L. monocytogenes BSU 1423 were used as target strains. The inhibitory activity of S. anginosus BSU 1211, 1326, 1370 and 1401 was determined either in the presence or absence of 100 ng SilCRSAG-C. Depicted is mean ± standard deviation of at least five independent experiments. A significant difference between SilCRSAG-C supplemented and untreated S. anginosus strains was tested with a Mann–Whitney-U-test (***p < 0.001).
Induction of Angicin production by addition of SilCRSAG-C. Result of a one-layer radial diffusion assay. S. constellatus BSU 1213 and L. monocytogenes BSU 1423 were used as target strains. The inhibitory activity of S. anginosus BSU 1211, 1326, 1370 and 1401 was determined either in the presence or absence of 100 ng SilCRSAG-C. Depicted is mean ± standard deviation of at least five independent experiments. A significant difference between SilCRSAG-C supplemented and untreated S. anginosus strains was tested with a Mann–Whitney-U-test (***p < 0.001).
The blp3 region
Often all genes necessary for bacteriocin production are clustered in one genetic region. To verify that in S. anginosus BSU 1211 the blp3-region is indeed responsible for the bacteriocin production and thereby the inhibition of target strains, a deletion mutant comprising the entire blp3 region was constructed (S. anginosus BSU 1211∆blp3) (Fig. 2). S. anginosus BSU 1211∆blp3 failed to inhibit any strain that was sensitive towards S. anginosus BSU 1211. The inhibition of these strains could be reestablished by complementing S. anginosus BSU 1211∆blp3 with a plasmid (pAT18-blp3) that encoded the deleted blp3 region. Maximum activity of the complementation mutant against L. monocytogenes, L. grayi or L. ivanovii could be observed with adding synthetic SilCRSAG-C (Fig. 4). As controls, the inhibition of L. monocytogenes, L. grayi, L. ivanovii and S. constellatus by S. anginosus SK52 (a strain which lacks the sil and blp3 region) transformed with pAT18-blp3 and S. anginosus BSU 1211∆blp3 transformed with the empty plasmid was investigated. Neither one of these control strains showed an inhibition of target strains. This data clearly shows that the sil as well as the blp3 region are necessary for bacteriocin production, however the question arises which of the predicted bacteriocins is functional and responsible for the activity or if more than one bacteriocin is produced and active, like it is the case in other streptococci[30,31] or if the observed activity arises from synergistic effects of encoded peptides as described for Garvicin KS of Lactococcus garvieae[32]. To investigate this, single putative bacteriocin genes (blp3.1, blp3.4 and blp3.6) were chromosomally deleted and subsequently these mutant strains were assessed for their ability to inhibit the four most prominent target strains (L. monocytogenes, L. ivanovii, L. grayi, S. constellatus). Deleting blp3.4 caused a complete loss of inhibition activity (Fig. 4). Unfortunately, BSU 1211∆blp3.1 contained an additional point mutation in the non-coding area between blp3.1 and blp3.2. However, it is not suspected that this mutation has any influence on bacteriocin production. A deletion of blp3.1 and blp3.6 did not alter antimicrobial activity. Thus, we conclude that Blp3.4, subsequently labeled Angicin, is the bacteriocin responsible for the antimicrobial activity of S. anginosus BSU 1211. By PCR analysis the blp3.4 gene was found in 41% (38 of 92) S. anginosus strains.
Figure 4
Inhibition of target strains by blp3-region mutants. (a) The effect of completely deleting blp3 or only deleting the predicted bacteriocin genes was tested in a one-layer radial diffusion assay against the four most prominent target strains S. constellatus, L. monocytogenes, L. grayi, and L. ivanovii. Furthermore, a S. anginosus BSU 1211∆blp3 was complemented with the blp3-region encoded on plasmid pAT18. The complementation mutant was supplemented with 100 ng SilCRSAG-C. Shown is the mean ± standard deviation of at least five independent experiments. Significant differences between mutant and wildtype strain were calculated with a Mann–Whitney-U-test (*p < 0.05). (b) Result of a one-layer RDA against L. grayi.
Inhibition of target strains by blp3-region mutants. (a) The effect of completely deleting blp3 or only deleting the predicted bacteriocin genes was tested in a one-layer radial diffusion assay against the four most prominent target strains S. constellatus, L. monocytogenes, L. grayi, and L. ivanovii. Furthermore, a S. anginosus BSU 1211∆blp3 was complemented with the blp3-region encoded on plasmid pAT18. The complementation mutant was supplemented with 100 ng SilCRSAG-C. Shown is the mean ± standard deviation of at least five independent experiments. Significant differences between mutant and wildtype strain were calculated with a Mann–Whitney-U-test (*p < 0.05). (b) Result of a one-layer RDA against L. grayi.
Angicin activity
Angicin is produced as an 84 amino acid long prepeptide. Typically, class II bacteriocins possess a leader peptide, which is cleaved off during export, resulting in the mature and active peptide. The first 30 amino acids of the 84 amino acid long prepeptide form a double glycine leader peptide which after processing leads to the 54 aa long mature Angicin. The peptide sequence of Angicin was compared to similar bacteriocins, like Bovicin 255, Garvicin Q and BacSJ. While Bovicin variant 255 has a sequence identity of approximately 64%, Garvicin Q and BacSJ only have approximately 42% sequence identity (Supplementary Fig. S1). To verify that Angicin is accountable for the antimicrobial activity of S. anginosus BSU 1211 it was chemically synthesized. Angicin was synthesized without its respective leader peptide and without any post translational modifications. The experimental mass of synthetic Angicin was 6053.1 Da, as determined by mass spectrometry, closely matching the theoretic mass of this 54 amino acid peptide (6052.9 Da). The isoelectric point of the peptide was determined at 10.2 by PSL Heidelberg, while computational analysis of the amino acid sequence with Bachem gave an isoelectric point at 9.6 and a net charge of 4 at neutral pH (https://www.bachem.com/service-support/peptide-calculator/). The synthetic peptide was dissolved in ultra-pure water, and its activity was examined in a two-layer RDA against L. monocytogenes. Concentrations of 50 μg/ml Angicin caused an inhibition zone of 1.09 ± 0.16 cm, and even concentrations of 1.56 μg/ml Angicin were still able to inhibit growth of L. monocytogenes (Fig. 5a). This value corresponds well to a MIC determination of 3.125 μg/ml against L. monocytogenes and L. grayi (Supplementary Table S2). We then tested as to whether or not Angicin shows the same spectrum of activity as the strain S. anginosus BSU 1211. Based on a two-layer RDA (Fig. 5b) we find that strains of L. monocytogenes, L. grayi, L. ivanovii and S. constellatus, which are susceptible towards S. anginosus BSU1211 (Fig. 1), are also sensitive towards Angicin. However, the inhibition zones of S. constellatus were not completely clear in all experiments. S. anginosus SK52 showed a similar inhibition zone size like S. constellatus. In a second step, we investigated the Angicin susceptibility of a wide range of bacterial species including ESKAPE pathogens. We find that some of these pathogens, such as S. aureus, B. subtilis, are completely insensitive towards Angicin, while others showed a moderate inhibition at Angicin concentrations of 100 μg/ml (E. coli, K. pneumoniae, P. aeruginosa, A. baumannii). Interestingly, among these Angicin-sensitive ESKAPE pathogens was Enterococcus faecium (vancomycin resistant, VRE), which causes nosocomial infections and poses a huge health concern due to rising numbers and limited treatment options[33]. The tested VRE strain was as sensitive in our assay as the listeria species.
Figure 5
Effect of synthesized angicin on target strains. (a) Different Angicin concentrations were tested for activity against L. monocytogenes in a two-layer RDA. (b) Angicin concentrations of 100, 10 and 1 μg/ml were tested against different bacterial species in a two-layer RDA. 6.05 μg/ml equal 1 μM Angicin. VRE indicates Vancomycin resistant Enterococcus faecium, ESBL is an abbreviation for extended spectrum beta-lactamase. Shown is the mean ± standard deviation of five independent experiments.
Effect of synthesized angicin on target strains. (a) Different Angicin concentrations were tested for activity against L. monocytogenes in a two-layer RDA. (b) Angicin concentrations of 100, 10 and 1 μg/ml were tested against different bacterial species in a two-layer RDA. 6.05 μg/ml equal 1 μM Angicin. VRE indicates Vancomycin resistant Enterococcus faecium, ESBL is an abbreviation for extended spectrum beta-lactamase. Shown is the mean ± standard deviation of five independent experiments.
Activity of cell free supernatant
Many bacteriocins are secreted into the culture supernatant. To better understand the physical and chemical properties of Angicin, cell free supernatant (CFS) of BSU 1211 was prepared. A two-layer RDA was carried out to assess the activity of CFS in comparison to the bacteriocin activity of bacterial cells from BSU 1211. In these experiments the previously identified target strain L. monocytogenes showed sensitivity towards CFS (Supplementary Fig. S2). However, no clear inhibition zone was observed. To show that Angicin is indeed the active component in CFS of BSU 1211, CFS of S. anginosus BSU 1211∆blp3.4 was prepared and tested for activity. It showed no antimicrobial activity against L. monocytogenes. In a next step, the activity of CFS of BSU 1211 after exposure to heat or pH- changes was investigated. Results are summarized in Table 2 and demonstrate that the S. anginosus CSF can tolerate up to 1 h of 60 °C, an acidic pH of 2, and can be kept at − 20 °C and − 70 °C for one year without loss of activity. However, exposure to 100 °C for 30 min as well as treatment with proteinase K destroyed the bacteriocin activity of CFS. A treatment with lipase had no effect on CFS activity. As a control, CFS of S. anginosus BSU 1211∆blp3 was challenged with the same treatments, but no inhibition of target strains was observed with BSU 1211∆blp3 CFS. We could show that synthetic Angicin resembled the activity pattern of BSU 1211 CFS when exposed to the above-mentioned heat challenges and enzyme treatments. In contrast to BSU 1211 CFS, however, we find that synthetic Angicin caused clear inhibition zones of L. monocytogenes and it showed no reduced activity upon heating at 90 °C for 1 h.
Table 2
Bacteriocin stability in cell free supernatant against L. monocytogenes after various treatments.
Treatment
Activity CFS
Activity angicin
Temperature
60 °C—1 h
+
+
80 °C—1 h
Reduced
+
90 °C—1 h
Reduced
+
100 °C—30 min
−
ND
pH
2
+
ND
4
+
ND
6
+
ND
8
+
ND
10
+
ND
12
−
ND
Proteinase K
1 mg/ml
−
−
Lipase
1 mg/ml
+
+
Stability after 1 year
− 20 °C
+
ND
− 70 °C
+
ND
“+” indicates no altered activity, “reduced” indicates reduced activity and “−” means a complete loss of activity, ND indicates not determined.
Bacteriocin stability in cell free supernatant against L. monocytogenes after various treatments.“+” indicates no altered activity, “reduced” indicates reduced activity and “−” means a complete loss of activity, ND indicates not determined.To investigate, if the Angicin activity of CFS can also be demonstrated in liquid culture experiments, we measured the growth of L. monocytogenes in the presence of 25% CFS (Supplementary Fig. S3). We find that L. monocytogenes is significantly inhibited in the presence of 25% CFS from the wildtype strain BSU 1211 (p-value: 0.0006-6 h), while 25% CFS from the deletion mutant S. anginosus BSU 1211∆blp3 slightly enhances growth, when compared to medium without CFS. Furthermore, the activity of Angicin was evaluated in a bacterial survival assay. Since 25% CFS was the best concentration in the inhibition experiment, the same concentration was chosen for a survival assay. In this assay L. monocytogenes, L. grayi and L. ivanovii were investigated. An overnight culture of the indicated strains was inoculated freshly in the morning and grown to an O.D.600 nm of 0.1. To the same amount of bacteria, resuspended in phosphate buffer, either 25% of active or inactive CFS was added. The effect on L. monocytogenes was a tenfold reduction. The inhibition of L. ivanovii and L. grayi with a 104-fold and 106-fold reduction respectively was even more pronounced, in phosphate buffer supplemented with the CFS of S. anginosus BSU 1211∆blp3 no reduced survival could be seen (Fig. 6). In contrast, incubation with CFS of S. anginosus BSU 1211 significantly reduced the number of surviving cells (Fig. 6). In a next step, listerial cells treated with 25% CFS of S. anginosus BSU 1211 were analyzed via transmission electron microscopy to investigate the mechanism of action of Angicin. Pictures were thoroughly screened for loss of membrane integrity (Fig. 6). For L. monocytogenes more damaged cells can be seen in the treated group than in the control group. Numbers of intact L. ivanovii cells also seem decreased after treatment with active CFS for 15 min and a lot of cell debris can be seen. Especially for L. grayi membrane disruption is visible in samples treated with active CFS for 15 min. Multiple cells appear lysed and loss of membrane integrity often seems to appear at sites of division. None of these changes can be seen in control cells treated with CFS of S. anginosus BSU 1211∆blp3.
Figure 6
Effect of cell-free supernatant (CFS) of S. anginosus BSU 1211 or S. anginosus BSU 1211∆blp3 on Listeria monocytogenes, L. ivanovi and L. grayi. Survival of L. monocytogenes (a), L. ivanovi (c), L. grayi (e) in the presence of 25% CFS of S. anginosus BSU 1211 or S. anginosus BSU 1211∆blp3 over a time course of 2 h. Transmission electron microscopy (TEM) pictures of L. monocytogenes cells (b) treated with 25% CFS of S. anginosus BSU 1211 or S. anginosus BSU 1211∆blp3 for 2 h at 37 °C. TEM pictures of L. ivanovi (d) and L. grayi (f) were done after 15 min incubation with either 25% CFS of S. anginosus BSU 1211 or S. anginosus BSU 1211∆blp3. Depicted for the survival assay is the mean + standard deviation of five independent experiments. TEM experiments were conducted once. Scale bar of the upper images is 5 μm, scale bar of the lower images represents 1 μm. Significant differences in survival were calculated with a Mann–Whitney-U-test (*p < 0.05).
Effect of cell-free supernatant (CFS) of S. anginosus BSU 1211 or S. anginosus BSU 1211∆blp3 on Listeria monocytogenes, L. ivanovi and L. grayi. Survival of L. monocytogenes (a), L. ivanovi (c), L. grayi (e) in the presence of 25% CFS of S. anginosus BSU 1211 or S. anginosus BSU 1211∆blp3 over a time course of 2 h. Transmission electron microscopy (TEM) pictures of L. monocytogenes cells (b) treated with 25% CFS of S. anginosus BSU 1211 or S. anginosus BSU 1211∆blp3 for 2 h at 37 °C. TEM pictures of L. ivanovi (d) and L. grayi (f) were done after 15 min incubation with either 25% CFS of S. anginosus BSU 1211 or S. anginosus BSU 1211∆blp3. Depicted for the survival assay is the mean + standard deviation of five independent experiments. TEM experiments were conducted once. Scale bar of the upper images is 5 μm, scale bar of the lower images represents 1 μm. Significant differences in survival were calculated with a Mann–Whitney-U-test (*p < 0.05).
Mechanism of action
The most common mode of action of bacteriocins is membrane permeabilization. To investigate this mechanism in the context of Angicin treatment a SYTOX Green Membrane Permeabilization Assay was conducted. SYTOX Green is a fluorescent DNA stain that can enter the bacterial cell after membrane disruption. Therefore, the fluorescence intensity is an indicator of membrane integrity. Treating L. monocytogenes with 100, 50 or 25 μg/ml synthetic Angicin lead to a significant SYTOX enrichment, indicating membrane disruption of the target cells (Fig. 7). Already after 5 min of incubation with either 100 or 50 μg/ml synthetic Angicin the membrane is significantly disrupted, indicating a very fast mechanism of action of the peptide (p-value: 0.0079). Additionally, no significant difference between the ethanol treated cells (positive control) and cells treated with 100 μg/ml of Angicin for 15 min can be detected.
Figure 7
Effect of Angicin on membrane integrity of L. monocytogenes. Bacterial cells were incubated with different Angicin concentrations for 1 h at 37 °C and fluorescence was detected using Tecan Plate Reader (Excitation: 488 nm; Emission: 530 nm) at the indicated time points. 6.05 μg/ml Angicin equal a concentration of 1 μM Angicin. L. monocytogenes treated with 70% Ethanol was used as positive control. Depicted are five independent experiments conducted with three technical replicates. Statistically significant differences to the negative control were calculated with Mann–Whitney-U test (*p < 0.05).
Effect of Angicin on membrane integrity of L. monocytogenes. Bacterial cells were incubated with different Angicin concentrations for 1 h at 37 °C and fluorescence was detected using Tecan Plate Reader (Excitation: 488 nm; Emission: 530 nm) at the indicated time points. 6.05 μg/ml Angicin equal a concentration of 1 μM Angicin. L. monocytogenes treated with 70% Ethanol was used as positive control. Depicted are five independent experiments conducted with three technical replicates. Statistically significant differences to the negative control were calculated with Mann–Whitney-U test (*p < 0.05).
Immunity proteins
For self-protection bacteriocin producers express immunity proteins. To explore, if Blp3.3 protein represents as predicted an immunity protein, a functional assay was performed. The gene blp3.3 was introduced into plasmid pAT28 under the control of an endogenous promotor or without a promotor and transformed into the Angicin sensitive target strains S. anginosus SK52 and S. constellatus BSU 1213. In a next step a one-layer RDA was performed and the effect of S. anginosus BUS 1211 on the target strains was determined. Inhibition zones of mutants were compared to inhibition zones of the wildtype strain harboring empty pAT28 plasmid. Transformation of S. anginosus SK52 with blp3.3 under the control of an endogenous promotor led to a significantly reduced sensitivity towards Angicin (Fig. 8). Whereas blp3.3 without promoter did not alter inhibition zone sizes. Comparable results were obtained for the S. constellatus strain BSU 1213. Introducing the blp3.3 gene with an endogenous promotor led to significantly decreased inhibition zones. However, introducing blp3.3 alone into S. constellatus BSU 1213 had no significant effect. In summary, this data supports a role of Blp3.3 in immunity against Angicin.
Figure 8
Influence of blp3.3 on inhibition zone diameters. Blp3.3 of S. anginosus BSU 1211 was transformed into susceptible target strains (a
S. anginosus SK 52, b
S. constellatus) either alone or under the control of an endogenous promotor. These mutants were used as target strains in a one-layer radial diffusion assay and tested against S. anginosus BSU 1211. Data was collected in at least five independent experiments. A significant difference to target strains transformed with the empty vector was tested with a Mann–Whitney-U-test (*p < 0.05, **p < 0.01 and ***p < 0.001).
Influence of blp3.3 on inhibition zone diameters. Blp3.3 of S. anginosus BSU 1211 was transformed into susceptible target strains (a
S. anginosus SK 52, b
S. constellatus) either alone or under the control of an endogenous promotor. These mutants were used as target strains in a one-layer radial diffusion assay and tested against S. anginosus BSU 1211. Data was collected in at least five independent experiments. A significant difference to target strains transformed with the empty vector was tested with a Mann–Whitney-U-test (*p < 0.05, **p < 0.01 and ***p < 0.001).Subsequently, Blp3.3 protein was recombinantly expressed in E. coli and purified to investigate its effect on the antimicrobial activity of Angicin. To that end, we preincubated Blp3.3 together with Angicin for 1 h at 37 °C before the Angicin activity was tested in a two-layer RDA. We found that Blp3.3 alone already caused a zone of inhibited growth (Supplementary Fig. S4a) and it did not decrease Angicin activity on the target strain L. monocytogenes, irrespective of whether we used equimolar, substoichometric or superstoichometric concentrations of Blp3.3. Moreover, recombinant Blp3.3 protein did not affect the inhibitory activity of S. anginosus BSU1211 against L. monocytogenes when analyzing the inhibition zone size in a one-layer RDA. In addition, there was no inhibition of L. monocytogenes by Blp3.3 protein with or without S. anginosus BSU 1211∆blp3 (Supplementary Fig. S4b).
Discussion
In their natural habitat, bacteria are part of complex multi-species environments. S. anginosus typically resides in the oral cavity which can be colonized with up to 700 different species[34,35]. Closely related species often need similar nutrients or inhabit a similar space, therefore there is an ongoing competition between these species. Secreting antimicrobial substances, like bacteriocins, provides the producing organism with a great colonization advantage[36,37].Putative bacteriocin production of streptococcal species from the S. anginosus group has previously been reported[38,39]. To elucidate the molecular background of this phenomenon, 95 S. anginosus strains were evaluated for inhibitory activity in coculture experiments, which led to the selection of strain BSU 1211 for its potent antimicrobial activity. In this strain the genetic basis of bacteriocin production and regulation was further investigated. Bacteriocin production is often regulated through quorum sensing systems[40]. In streptococci, like S. intermedius and S. pyogenes the sil system controls bacteriocin production[12,17]. A sil locus was also identified and predicted to be functional in many of the surveyed S. anginosus strains. In nearly all these strains inducing the sil two component system (SilAB) by addition of the autoinducing peptide SilCRSAG-C, turns on bacteriocin production. In S. anginosus the sil locus is directly adjacent to putative bacteriocin genes, encoded in the blp3 region. By genetic mutagenesis we could show that this region is indeed responsible for bacteriocin production, since a complete deletion mutant of blp3 was unable to inhibit the growth of any target strains. To identify the bacteriocin the three putative bacteriocin genes of this locus were mutated separately. A deletion of blp3.1 and blp3.6 did not alter bacteriocin activity, while deleting blp3.4 completely abolished the inhibitory effect. Interestingly, the deduced peptides of blp3.1 and blp3.6 both contain a GxxxG motif, which is a key feature of two peptide bacteriocins[29], that function only as a couple. Typically, the structural genes of two peptide bacteriocins are located directly next to each other. But this is not the case in the blp3 region of S. anginosus. It may be possible that due to this spatial gene separation no active bacteriocin can be formed. The putative bacteriocin region of SAG is a known hotspot of genetic diversity[12]. Possibly, the peptides are active when certain environmental conditions are met or other signals are present.The identified S. anginosus bacteriocin was designated Angicin. The Angicin prepeptide is 84 amino acids long of which the first 30 amino acids form the leader peptide. Mature Angicin has a predicted pI of 10.2 and a molecular mass of 6053 Da. In our experiments Angicin showed a good antimicrobial activity against the Gram positive species S. anginosus, S. constellatus, L. monocytogenes, L. grayi, L. ivanovii and VRE. Moderate inhibitory activity could be observed against Gram negative microorganisms such as E. coli, K. pneumoniae, P. aeruginosa, A. baumannii. In some cases, spontaneous Angicin-resistant colonies of S. constellatus, L. monocytogenes and L. ivanovii appeared in the inhibition zones. In further studies, these resistant colonies could be genetically analyzed for mutations and thereby a putative receptor for Angicin might be identified[23]. The appearance of spontaneous bacteriocin-resistant mutants is documented for many bacteriocins[41,42]. This needs to be considered for further applications and to completely inhibit target organisms, often bacteriocins are not administered alone but in combination with other bacteriocins or antibiotics[43,44].Comparing peptide sequences, Angicin shows homology to Bovicin (variant 255) and is grouped into the Garvicin Q family which also includes BacSJ as a member[22,45-47]. Garvicin Q is a class IId bacteriocin of Lactococcus garvieae with a wide spectrum of activity. It is active against all tested strains of carnobacteria, enterococci, lactococci, leuconostoc and listeria and most of the tested Lactobacillus and Pediococcus strains. While all species of the genera Bacillus, Campylobacter, Staphylococcus and Streptococcus as well as P. aeruginosa, Salmonella typhimurium and Candida albicans are not susceptible[23]. BacSJ is produced by Lactobacillus paracasei and shows a very similar spectrum of activity with the only exception being a resistance of Lactococcus garvieae against BacSJ but not Garvicin Q[22]. Bovicin (variant 255), a bacteriocin first isolated from Streptococcus gallolyticus, shows only a narrow spectrum of activity with inhibitiory properties against E. faecium, Butyrivibrio fibrisolvens, Lactobacillus ruminis and Peptostreptococcus anaerobius. All Gram negative species as well as Streptococcus bovis, Bifidobacterium thermophilum or Ruminobacter amylophilus are insensitive towards the peptide[47,48]. In summary, Garvicin Q and BacSJ seem to be mainly important for intra- and interspecies competition. This may also be true for Angicin, which inhibits besides other S. anginosus isolates other streptococci, VRE and listeria.Bacteriocins mostly kill target cells by membrane permeabilization. The electrostatic interaction between the cationic peptide and the negatively charged bacterial membrane is important as well as amphiphilic structures[49]. However to function more efficiently bacteriocins usually utilize a receptor present in the bacterial membrane[23,50]. While for bovicin variant 255 no receptor is identified yet, it was proven that garvicinQ and BacJS target the IIC and IID components of the mannose phosphotransferase system (Man-PTS)[22,23]. The Man-PTS is described as a receptor for many bacteriocins, mainly the class IIa bacteriocins[24]. Due to sequence homology this gives rise to the question if Angicin might use the Man-PTS as a receptor as well. S. anginosus BSU 1211 is not able to inhibit Gram negative species and synthetic Angicin only shows an inhibition of Gram negative bacteria when administered at high concentrations. As already demonstrated for antibiotics, a reason for bacteriocin ineffectiveness against Gram negative species seems to be the outer membrane[51,52]. It inhibits an interaction between bacteriocin and its cognate receptor. Nisin binding to lipid II for example is inhibited by the outer membrane. However, inhibition of Gram negative species can be enhanced by the addition of chelating agents like ethylenediaminetetraacetic acid, that destroys the outer membrane[53,54]. For Angicin a similar situation may be the case.Bacteriocins often kill target cells by membrane permeabilization. The electrostatic interaction between the cationic peptide and the negatively charged bacterial membrane is important as well as amphiphilic structures[49]. By a SYTOX Green membrane permeabilization assay it was demonstrated that Angicin leads to a disruption of the membrane in target cells. Already 5 min after Angicin treatment (Fig. 7) a significant difference in fluorescence signal to untreated cells is visible, indicating a fast mechanism of action. A rapid target cell lysis is not unusual and has also been observed in bacteriocins from enterococci and lactobacilli[55,56]. This data is supported by survival assays and TEM analysis, showing reduced cell numbers and rupture of membranes in listeria cells (Fig. 6). However, membrane permeabilization is mainly seen when high concentrations of Angicin are administered. For other bacteriocins it has been speculated that bacteriocins only work as membrane perturbers at concentrations that exceed what is present in a natural environment[57]. In lower or more natural concentrations, bacteriocin producers can use different mechanisms to inhibit competitors. Subtilisin for example interferes with quorum sensing of target organisms and thereby inhibits biofilm formation[58]. Thus, apart from membrane disruption other mechanisms may also play a role in the antibacterial activity of Angicin. For example, Garvicin A has been shown to interfere with cell division by inhibition of septum formation[59]. In CFS treated L. grayi cells loss of membrane integrity often appears at sites of division, which points in a similar direction. For the other listerial species, TEM experiments were not that clear. However, cells look damaged indicating that Angicin may harm target cells not only by membrane disruption but also other mechanisms.Bacteriocin producers are rendered insensitive towards their own bacteriocin by simultaneous expression of immunity proteins[60]. Immunity proteins have a high specificity towards the bacteriocin and several different modes of action are already described, including loss of bacteriocin binding, sequestering, bacteriocin export or degradation of the bacteriocin[61-64]. By bioinformatic analysis of the blp3 region, blp3.3 was predicted as an immunity protein. It shows similarities to the immunity protein PisI, which protects against the class IIa bacteriocin piscolin 126[65,66]. Heterologous expression of blp3.3 in Angicin target strains led to a decreased sensitivity of these strains. Similar results were obtained for PisI as well as for other bacteriocins[63,67,68]. Already the introduction of the plasmid alone led to an increased sensitivity towards Angicin. Carrying a plasmid increases metabolic burdens on bacteria, often rendering them more sensitive to stress conditions[69,70]. A possible explanation why introduction of an empty plasmid alone may result in a higher sensitivity towards bacteriocins.Immunity proteins may form a tertiary complex with the bacteriocin and the bacteriocin receptor[67,71,72]. Formation of this complex seems to depend on conformational changes after the initial binding of the bacteriocin to its receptor. Preincubation of Angicin with blp3.3 did not alter activity, implying that there is no direct interaction between these proteins, which further supports the theory of a tertiary complex. Immunity was increased but not complete upon heterologous expression of blp3.3, which may indicate the presence of a second immunity protein as it is the case for other bacteriocins[73]. Bagle4 predicted blp3.5 as another immunity protein. Furthermore, a CAAX protease is present in the blp3 locus, representing another protein which may be involved in self-immunity against bacteriocins[74].Some bacteriocins like nisin, pediocin PA-1 and leucocin A are administered as food preservatives. Angicin inhibits L. monocytogenes, a species posing a major health risk for food safety[75]. For an application in food preservation, characteristics like stability over a wide pH and temperature range are important[76]. With remaining active in a pH ranging from 2 to 10 and at temperatures till 90 °C both criteria are met by Angicin. Furthermore, Angicin shows activity against VRE, a pathogen posing a great health risk[33]. VRE can cause infections like endocarditis, bacteremia and urinary tract infections and is one of the main causes of nosocomial infections[77,78]. Treatment options are limited and new ways to deal with this pathogen are needed[79].This is the first study describing and characterizing a bacteriocin of S. anginosus. The small cationically charged Angicin not only inhibits closely related species, but furthermore the important food pathogen L. monocytogenes and the clinically relevant vancomycin resistant E. faecium. This activity complemented with high thermal and wide pH stability render Angicin an interesting compound for food preservation and antimicrobial therapies.
Methods
Bacterial strains and growth conditions
All strains used in this study are summarized in Supplementary Table S3. Escherichia coli was cultivated in lysogeny broth (LB-Miller). E. coli EC101 and DH5α were hosts for plasmids pAT28 and pAT18. E. coli mutants were incubated in the presence of 100 μg/ml spectinomycin (pAT28) or 400 μg/ml erythromycin (pAT18). Liquid cultures were kept aerobically at 37 °C on a shaker (180 rpm), whereas plates were incubated at 37 °C and 5% CO2. All other used bacterial strains were cultivated on sheep blood agar plates, for liquid broth THY medium (Todd-Hewitt Broth supplemented with 0.5% yeast extract) was used. If necessary, streptococci were grown with 120 μg/ml spectinomycin or 10 μg/ml erythromycin, respectively. Plates as well as liquid cultures were incubated at 37 °C and 5% CO2.
General DNA techniques
Commercial kits, following the manufacturer’s protocols were used to isolate DNA (GeneEluteTM Bacterial Genomic DNA, Sigma-Aldrich; QIAamp® DNA Mini Kit, Qiagen) or plasmids (QIAprep® Spin Miniprep Kit, Qiagen). Polymerase chain reaction (PCR) was conducted using standard protocols for Taq polymerase. Default settings for PCR were an initial denaturation at 95 °C for 5 min. Followed by 32 cycles of 1 min at 95 °C, 30 s at 50 °C, 1–3 min at 72 °C rounded up by a final elongation of 7 min at 72 °C. For templates longer than 3000 bp the Expand Long Template PCR system: DNA pol. Mix was used. Clean up of PCR products was performed with NucleoSpin® Gel and PCR Clean-up (Machery-Nagel). Primers used in this study are listed in Supplementary Table S4. Commercial nucleotides sequencing was carried out by Eurofins Genomics (Ebersberg, Germany) and Microsynths Seqlab laboratories (Göttingen, Germany).
Sil and blp3 screen
For obtaining the sil and blp3 sequence information, primers were designed for this region based on the genome sequence of S. anginosus_1_2_62CV (Accession: KY315455.1). PCRs were performed on the chromosomal DNA of S. anginosus strains BSU 1211, BSU 1326, BSU 1370 and BSU 1401 using primer pairs 1/2, 3/4 or 3/7, 5/6, 8/9, 10/17, 11/16, 12/13, 14/15. All PCR products were purified and sequenced. (Accession numbers: BSU 1211: MZ766502, BSU 1326: MZ766503, BSU 1370: MZ766504, BSU 1401: MZ766505). Screening for the presence of blp3.4 in 99 S. anginosus isolates was performed using primers 18/19.
Radial diffusion assay
To measure bacteriocin activity, a modified radial diffusion assay (RDA) was conducted[80]. For testing antagonism of bacteria against other bacteria a one-layer RDA was performed, whereas for investigating the antimicrobial activity of supernatant or peptides a two-layer RDA was done. In both cases, overnight cultures of target strains as well as putative bacteriocin producer strains (BPS) were centrifuged at 3000×g for 10 min and the pellet was solved in 10 mM phosphate buffer. After repeated centrifugation at 3000×g for 10 min the pellet was reconstituted in 5 ml 10 mM phosphate buffer. Following O.D.600 nm determination each plate was seeded with 2 × 107 bacterial cells of the target strains.For a one-layer RDA bacterial cells were inoculated in still liquid Trypticase Soy Agar (Oxoid) and 20 ml plates were poured. After solidification, holes were cut into the agar with sterile wide bore pipette tips (Axygen—a corning brand). These wells were filled with overnight cultures of putative BPS, which were adjusted to an O.D.600 nm of 0.5. Following overnight incubation at 37 °C and 5% CO2, inhibition zones were measured in cm. In some assays 100 ng of the autoinducing peptide SilCRSAG-C (GWLEDLFSPYFKKYKLGKLGQPDLG) were added simultaneously with the bacteria to test its effect on bacteriocin production. The peptide was synthesized by the Core facility of functional peptidomics (UPEP, Ulm University, Ulm, Germany) based on the deduced sequence of SilCRSAG-C of S. anginosus strain BSU 1211. Purity levels of SilCRSAG-C exceeded 95% and were determined via high performance liquid chromatography (HPLC).To carry out a two-layer RDA bacterial cultures were inoculated in 15 ml of still liquid 1% agarose and were poured into a petri dish. Wells were punched into the solidified agarose and filled with the test substance. After 3 h of aerobic incubation at 37 °C an overlay with 10 ml Trypticase Soy Agar was performed. Following solidification plates were incubated at 37 °C and 5% CO2 overnight. Inhibition zones were quantified in cm. This assay was used to assess the antimicrobial activity of differently treated cell free supernatant (CFS). Furthermore, the peptide sequence of Angicin was deduced from the S. anginosus BSU 1211 DNA sequence. In a next step the 54 amino acid sequence without leader peptide (GSGYCKPVMVGANGYACRYSNGRWDYKVTKGIFQATTDVIVKGWAEYGPWIPRH) was synthesized by Peptide Specialty Laboratories GmbH (PSL GmbH, Heidelberg, Germany). Angicin was purified using HPLC and afterwards purity was analyzed with HPLC and MS-MALDI. The determined purity was > 98%. The molecular mass was calculated at 6053.1 g/mol, thus 6.05 μg/ml equal 1 μM. It was solved in ultra-pure water. The activity of this peptide was investigated via a two-layer RDA.
Construction of mutants
Construction of blp3.3 mutants
Based on the plasmid pAT28 two different blp3.3 constructs were created and cloned into E. coli EC101. One vector contained blp3.3 alone and a second vector encoded blp3.3 with its endogenous promoter (promblp3.3). Blp3.3 without promoter was amplified with primers 20/22 and promblp3.3 with primers 21/22. All primers that were used introduced EcoRI and BamHI restriction sites, for cloning purposes. In a next step these constructs were transformed into S. anginosus strain SK52 and S. constellatus BSU 1213 by electroporation as described elsewhere[81]. In brief, bacterial cells were made competent by several washing steps in 10% glycerol. Then 1 μg of plasmid DNA was added and cells were exposed to an electrical pulse. Clones were selected on THY-plates containing 120 μg/ml spectinomycin. Correct insertions were confirmed by nucleotide sequencing.
Construction of blp3 and angicin deletion mutants
A S. anginosus BSU 1211∆blp3 strain was created via splicing by overlap extension PCR (SOE) and competence related transformation as described in Bauer et al.[21]. In brief, blp3 flanking regions of S. anginosus BSU 1211 were amplified with primer pairs 23/24 for Fragment 1 (F1) and 25/26 for Fragment 2 (F2). The primers introduced an overlap to either a lox66 or a lox71 site. The spectinomycin resistance gene was amplified from pGA14-Spc with primers 27/28, which also introduced a lox66 or lox71 site, respectively, adjacent to the spectinomycin gene. Thereby, an overlap of all fragments was achieved. All fragments were fused via SOE-PCR. Subsequently, the linear DNA construct was transformed into S. anginosus strain BSU 1211 by inducing natural competence with CSP-1[21]. BSU 1211 was incubated with 100 ng CSP-1 and after 40 min the DNA construct was added. After two hours of incubation bacteria were plated on THY-spectinomycin plates. To eliminate the spectinomycin resistance gene, spectinomycin positive clones were transformed with a cre-recombinase encoding plasmid (pAT18-cre-rectufA), which recombines the two lox-sites to a singular lox72 site. By incubating the resulting clones without antibiotics, plasmid loss was induced to create a markerless deletion strain.The same method was used for creating single gene deletion mutants of the blp3 region. For a deletion of blp3.1 primers 5/29 (F1) and 30/31 (F2), for blp3.4 primers 7/32 (F1) and 33/3 (F2), for blp.3.6 primers 34/35 (F1) and 36/37 (F2) were used.To control a successful transformation all constructs were sequenced therefore primers 1/5 (blp3) 38/39 (blp3.1), 40/41 (blp3.4) and 42/43 (blp3.6) were applied.
Complementation of S. anginosus BSU 1211∆blp3
To complement the deletion mutant, S. anginosus BSU 1211∆blp3 was transformed with pAT18-blp3 by using the natural competence system as previously described[21]. The blp3 region was amplified using primers 44/45 and cloned into pAT18. Transformed cells were plated on sheep blood agar plates containing 10 μg/ml erythromycin and incubated anaerobically at 37 °C.
Cell free supernatant (CFS)
Putative bacteriocin producing strains were grown in THY supplemented with 10% FBS for 24 h. After centrifugation for 30 min at 4 °C and either 4000×g (50 ml) or 11,900×g (UZ) (350 ml) a sterile filtration was performed. Cell free supernatant (CFS) was precipitated with 35% Ammonium sulfate under stirring conditions for 1 h at 4 °C. Following centrifugation for 30 min, at 4 °C and 4000×g the supernatant was discarded and the pellet was resuspended in 10 mM phosphate buffer in one tenth of the original culture volume. In a next step, samples were concentrated via 3 K filters (Amicon® Ultra Centrifugal Filters). The concentrate contained the active fraction of the peptide. CFS activity was afterwards tested via a two-layer radial diffusion assay.
Effect of environmental factors on angicin activity
The stability of bacteriocins was investigated in regard to pH, temperature, degradation by enzymes and time. CFS was adjusted to pH values ranging from 2 to 10. Following overnight incubation at the adjusted pH at room temperature (RT), pH was neutralized and the CFS tested for antibacterial activity. Furthermore, CFS was incubated at 40, 60, 80, 90 °C for 1 h or at 90 and 100 °C for 30 min. After cooling down to RT activity was measured. To assess bacteriocin degradation either proteinase K (Sigma) or Lipase of Aspergillus niger (Sigma) was added to CFS to a final concentration of one mg/ml and incubated for 1 h at 37 °C. After inactivation of the enzymes for 1 h at 70 °C and cooling to RT antimicrobial activity was quantified. To further assess stability at low temperatures CFS was stored at 4 °C, − 20 °C and − 70 °C for one year and then inhibitory activity was analyzed. Activity of 50 μg/ml Angicin was tested after incubation at 60, 80 and 90 °C for 1 h. Furthermore, treatment of 5 μg/ml Angicin with 1 mg/ml lipase or proteinase K was conducted and afterwards activity was tested. All measurements were carried out in triplicate. If the test compound was inactive and not used as a control only two independent experiments were conducted.
Determination of minimal inhibition concentration
The O.D. 600 nm of an overnight culture of L. monocytogenes and L. grayi was determined and adjusted to 0.1 in Müller-Hinton broth and afterwards diluted 1:4. 5 μl of this bacterial solution were mixed with 95 μl of Angicin ranging in concentrations from 100 to 0.0122 µg/ml. After 24 h incubation at 37 °C and 5% CO2 O.D. 600 nm was determined.
Inhibition assay
In a 96-well plate a serial dilution of CFS from either S. anginosus BSU 1211 or the deletion mutant was prepared in THY broth ranging from 100% CFS to 6.25%. THY broth without CFS supplementation served as control. 5 μl of target bacteria, adjusted to an O.D.600 nm of 0.1, were added to each well in a final volume of 100 μl. The plate was incubated at 37 °C and 5% CO2 for 24 h. Absorbance 600 nm was measured every hour for 9 h and after 24 h in a Tecan microplate reader M infinite 200. At least five independent experiments were conducted. Measurements were done in triplicates.
Survival assay
An overnight culture of L. monocytogenes, L. ivanovii or L. grayi was diluted to an O.D.600 nm of 0.02 in 10 ml THY. When an O.D.600 nm of 0.1 was reached, 1 ml was transferred to a 1.5 ml Eppendorf tube and centrifuged at 8800×g for 2 min. The supernatant was discarded and the pellet reconstituted in 750 μl 10 mM phosphate buffer with 10% Tryptic Soy broth (TSB). 250 μl CFS of either S. anginosus BSU 1211 or S. anginosus BSU 1211∆blp3 was added and mixed. Cells were incubated at 37 °C and after 0 h, 30 min, 1 h and 2 h serial dilutions were performed and plated on THY. After overnight incubation at 37 °C and 5% CO2 colony forming units per ml were determined. At least five independent experiments were performed with technical duplicates.
Electron microscopy
Transmission electron microscopy was performed to investigate the effect of active CFS on target bacteria. Therefore, overnight cultures of target bacteria (S. constellatus, L. monocytogenes, L. ivanovii and L. grayi) were adjusted to an O.D.600 nm of 0.02 and grown to an O.D.600 nm of 0.1 and then 1 ml was transferred into a 1.5 ml Eppendorf tube and centrifuged at 8800×g for 2 min. The pellet was resuspended in 750 μl 10 mM phosphate buffer with 10% TSB. 25% (250 μl) CFS from either the S. anginosus BSU 1211 or S. anginosus BSU 1211∆blp3 were added and subsequently incubated at 37 °C. S. constellatus and L. monocytogenes were incubated with CFS for 2 h. In contrast, L. grayi and L. ivanovii were only incubated for 15 min, since killing of target cells happend very fast. After centrifugation at 8800×g for 2 min the supernatant was removed. Cells were reconstituted in 40 μl 10 mM phosphate buffer with 10% TSB. Then 40 μl of double concentrated fixing solution was added, consisting of 3.5% glutharaldehyde, 1% Saccharose in phosphate buffer). Afterwards samples were postfixed in osmium tetroxide, dehydrated in a graded series of propanol, embedded in Epon, and ultrathin sectioned according to standard procedures. Samples were analyzed with a Jeol 1400 Transmission Electron Microscope. At least 20 images per sample were taken. Experiment was conducted once.
Recombinant expression of the immunity protein Blp3.3
Blp3.3 protein was recombinantly expressed in Escherichia coli RV308. The coding region of Blp3.3 was synthesized (Eurofins) and cloned to the C terminus of a 11 His-tagged maltose-binding protein in a pMAL-C5X vector (New England Biolabs) separated by a cleavage site for tobacco etch virus protease. Protein expression was performed in mineral salt medium M9 by addition of 1 mM IPTG. Protein purification was done in eight steps: (1) amylose resin high flow (New England Biolabs) chromatography using a step elution from 0 to 10 mM maltose in Tris buffer A (20 mM Tris/HCl, pH 7.5, 200 ml NaCl), (2) Ni Sepharose fast flow resin (GE Healthcare) chromatography using a step elution from 50 to 200 mM Imidazol in Tris buffer B (20 mM Tris/HCl, pH 8.0, 150 mM NaCl), (3) fusion protein cleavage by overnight incubation with tobacco etch virus protease at 34 °C, (4) Ni Sepharose fast flow resin chromatography to separate Blp3.3 from the fusion protein and maltose-binding protein, (5) Source 15 RPC resin (GE Healthcare) chromatography using a linear gradient from 0 to 86% (v/v) of acetonitrile in 0.1% (v/v) trifluoroacetic acid, (6) lyophilization with an alpha 2–4 LD plus freeze dryer (Christ) and redissolving in Tris buffer B, (7) Superdex 75 resin (GE Healthcare) chromatography using an isocratic elution in Tris buffer B and (8) Source 15 RPC resin chromatography (same condition as 5). The purified Blp3.3 was lyophilized and stored at − 80 °C until further use. The chemical identity of Blp3.3 was verified by electrospray ionisation mass spectrometry. The determined monoisotopic mass (11,247.0 Da) corresponds well to the theoretical monoisotopic mass expected from the amino acid sequence (11,246.9 Da).
SYTOX green membrane permeabilization assay
A SYTOX Green Membrane Permeabilization Assay was used to assess the effect of synthesized Angicin against L. monocytogenes. Therefore, an overnight culture was adjusted to an O.D.600 nm of 0.05 and incubated at 37 °C and 5% CO2 till an O.D. 600 nm of 0.1 was reached. One ml of the bacterial culture was transferred into an Eppendorf tube and centrifugation at 10,000×g for 2 mins followed. The pellet was solved in one volume of 10 mM phosphate solution with 0.2 μM Sytox (Invitrogen). 90 μl of the bacteria-Sytox solution were mixed with Angicin with final concentrations ranging from 100 to 6.25 μg/ml. A Tecan microplate reader M infinite 200 reader was used to measure fluorescence intensity. Excitation/Emission wavelength were 488/530 nm, respectively. Cells treated with 70% Ethanol for five minutes were used as positive control. Measurements were performed in triplicates and in five independent measurements.
Bioinformatic and statistical analysis
As a source for nucleotide sequences the GenBank database (http://www.ncbi.nlm.nih.gov/) was used. Homology searches were conducted using Basic Local Alignment Search Tool (http://www.ncbi.nlm.nih.gov/Blast/)[82]. For further genetic investigations SnapGene 5.0 (https://www.snapgene.com/) was accessed. Genetic alignments were done using CLC Main Workbench v7.7.3 (http://www.clcbio.com) with default settings (gap open cost value 10.0, gap extension cost value 1.0). Bioinformatical analysis of the blp3 region was done with Bagel4 (http://bagel4.molgenrug.nl/)[83]. Analysis of Angicin peptide sequence was performed with Bachem (https://www.bachem.com/service-support/peptide-calculator/). Endogenous promotor search was carried out with Softberry-BPROM (http://www.softberry.com/berry.phtml?topic=bprom&group=programs&subgroup=gfindb). GraphPad Prism V6 was used to create graphs and do statistical analysis. If not otherwise specified, all experiments were conducted independently at least five times. Experiments with inactive compounds were repeated at least twice. Depicted is always mean ± standard deviation.Supplementary Information.
Authors: Jon Nissen-Meyer; Camilla Oppegård; Per Rogne; Helen Sophie Haugen; Per Eugen Kristiansen Journal: Probiotics Antimicrob Proteins Date: 2009-11-03 Impact factor: 4.609
Authors: Michelle L Mendonca; Jake C Szamosi; Anne-Marie Lacroix; Michelle E Fontes; Dawn M Bowdish; Michael G Surette Journal: Front Microbiol Date: 2017-01-10 Impact factor: 5.640
Authors: Auke J van Heel; Anne de Jong; Chunxu Song; Jakob H Viel; Jan Kok; Oscar P Kuipers Journal: Nucleic Acids Res Date: 2018-07-02 Impact factor: 16.971
Authors: Verena Vogel; Lia-Raluca Olari; Marie Jachmann; Sebastian J Reich; Michelle Häring; Ann-Kathrin Kissmann; Frank Rosenau; Christian U Riedel; Jan Münch; Barbara Spellerberg Journal: Front Microbiol Date: 2022-09-06 Impact factor: 6.064