Literature DB >> 34671754

Targeted mass spectrometry-based assays enable multiplex quantification of receptor tyrosine kinase, MAP Kinase, and AKT signaling.

Jeffrey R Whiteaker1, Kanika Sharma2, Melissa A Hoffman3, Eric Kuhn4, Lei Zhao1, Alexandra R Cocco5, Regine M Schoenherr1, Jacob J Kennedy1, Ulianna Voytovich1, Chenwei Lin1, Bin Fang3, Kiah Bowers3, Gordon Whiteley6, Simona Colantonio6, William Bocik6, Rhonda Roberts6, Tara Hiltke7, Emily Boja7, Henry Rodriguez7, Frank McCormick2,8, Matthew Holderfield2,9, Steven A Carr4, John M Koomen3, Amanda G Paulovich1.   

Abstract

SUMMARY: A primary goal of the US National Cancer Institute's Ras initiative at the Frederick National Laboratory for Cancer Research is to develop methods to quantify RAS signaling to facilitate development of novel cancer therapeutics. We use targeted proteomics technologies to develop a community resource consisting of 256 validated multiple reaction monitoring (MRM)-based, multiplexed assays for quantifying protein expression and phosphorylation through the receptor tyrosine kinase, MAPK, and AKT signaling networks. As proof of concept, we quantify the response of melanoma (A375 and SK-MEL-2) and colorectal cancer (HCT-116 and HT-29) cell lines to BRAF inhibition by PLX-4720. These assays replace over 60 Western blots with quantitative mass spectrometry-based assays of high molecular specificity and quantitative precision, showing the value of these methods for pharmacodynamic measurements and mechanism of action studies. Methods, fit-for-purpose validation, and results are publicly available as a resource for the community at assays.cancer.gov.
MOTIVATION: A lack of quantitative, multiplexable assays for phosphosignaling limits comprehensive investigation of aberrant signaling in cancer and evaluation of novel treatments. To alleviate this limitation, we sought to develop assays using targeted mass spectrometry for quantifying protein expression and phosphorylation through the receptor tyrosine kinase, MAPK, and AKT signaling networks. The resulting assays provide a resource for replacing over 60 Western blots in examining cancer signaling and tumor biology with high molecular specificity and quantitative rigor.

Entities:  

Keywords:  AKT; Cancer signaling; MAP kinase; RAS; RTK; assay resource; immuno-MRM; pharmacodynamics; quantitative proteomics; targeted therapy

Year:  2021        PMID: 34671754      PMCID: PMC8525888          DOI: 10.1016/j.crmeth.2021.100015

Source DB:  PubMed          Journal:  Cell Rep Methods        ISSN: 2667-2375


Introduction

Cancer signaling plays a key role in tumor biology and has both scientific and clinical relevance to the development and clinical application of targeted therapeutics, especially kinase inhibitors (Gross et al., 2015). Signaling drives cancer growth and proliferation through different protein families, including receptor tyrosine kinases (RTK), mitogen-activated protein kinases (MAPK), the Src homology 2-like serine/threonine-protein kinase B family (AKT), and their upstream and downstream effectors. These pathways play critical roles in cancer formation and progression by altering biological switches in cell signaling networks (Downward, 2003; Roberts and Der, 2007; Young et al., 2009). For example, RAS is the most frequently mutated oncogene in cancer and plays an important role in cell proliferation. Despite decades of work, therapeutic targeting of RAS has proved challenging, although novel targeting strategies and new drug classes are renewing hope (Khan et al., 2020). A primary goal of the RAS Initiative at the Frederick National Laboratory for Cancer Research is to develop assays for RAS activity, localization, and signaling and to adapt those assays so they can be used for finding new drug candidates to treat cancer (https://www.cancer.gov/research/key-initiatives/ras). To quantify protein expression and phosphorylation, biologists are currently reliant on established technologies, primarily western blotting (WB) or immunohistochemistry (IHC). WB and IHC are widely used and easily distributed but suffer from many well-known limitations. Specifically, proteins are assessed one at a time (Gown, 2016; Janes, 2015; Kumar et al., 2018; Walker, 2006) in a semi-quantitative fashion susceptible to interferences, and generally cannot be multiplexed. The method is also limited by the lack of highly qualified antibodies for targets of interest (Kumar et al., 2018), poor specificity of many antibodies (Saper, 2009), lot-to-lot variation, and the excessive cost and/or lead time of development, which often relies on a trial-and-error approach to qualify antibodies for an intended assay. A platform capable of standardized, precise, specific, multiplexed quantification of proteins and post-translational modification (PTM) would provide the community with better tools to study basic mechanisms of cell signaling, identify novel drug targets, determine the molecular basis for combination therapies, and help translate relevant findings into clinical use. Multiple reaction monitoring mass spectrometry (MRM) is a targeted form of proteomics that provides rigorous quantification of proteins and PTMs (Boja and Rodriguez, 2012; Gillette and Carr, 2013; Picotti et al., 2013; Wang et al., 2009) and overcomes limitations associated with conventional immunoassays. The technique has an extensive history of use for quantification of small molecules (Chace and Kalas, 2005; Want et al., 2005) and has been extended to proteins by measuring peptides as stoichiometric surrogates for the protein of interest (Lange et al., 2008). In this approach proteins are digested to peptides, and the peptides are measured by liquid chromatography (LC) coupled to tandem mass spectrometry (LC-MS/MS). The mass spectrometer is tuned to measure specific precursor/fragment ion pairs, termed transitions, which enhance the signal-to-noise ratio (i.e., sensitivity) and confer high specificity. The MRM approach is quantitative through applying isotopically labeled standards that can be spiked into samples at a known concentration. Assays are readily multiplexed by combining multiple MRM transitions into a single MS method. MRM provides near absolute specificity by combining detection of multiple MS/MS fragment ions, alignment of the relative abundance of detected ions with expected ratios from synthetic standards, and alignment of retention times of analyte peptides and internal standards. Furthermore, these measurements allow for detection and avoidance of interferences through the choice of fragment ions to monitor. Finally, the use of standards allows for harmonization across laboratories. The success of the MRM approach has been demonstrated by application to quantification of cancer-associated proteins (Huttenhain et al., 2012) and PTMs (Gerber et al., 2003), use in assessment of multiple components of biological pathways (Chen et al., 2010; Rebecca et al., 2014; Whiteaker et al., 2018), implementation as part of large-scale assay development efforts for hundreds of analytes (Burgess et al., 2014; Kennedy et al., 2014), and validation in inter-laboratory studies (Addona et al., 2009; Kuhn et al., 2012). Furthermore, these MRM-based strategies can be used to identify novel pharmacodynamic biomarkers of kinase inhibition (Jones et al., 2018) or immunomodulatory agents as examples of cancer therapy (Sperling et al., 2019). The direct LC-MRM approach is complemented by enrichment strategies to enable measurement of low-abundance analytes. Enrichment strategies include immobilized metal affinity chromatography (Kennedy et al., 2016) (IMAC) for phosphopeptides and peptide immunoaffinity enrichment (Anderson et al., 2004; Gerber et al., 2003; Ippoliti et al., 2016; Kuhn et al., 2012; Whiteaker et al., 2011) (immuno-MRM, also known as SISCAPA [Anderson et al., 2004]) for specific unmodified and modified peptides using antibodies developed specifically for the MRM target peptides. Like conventional immunoassays, the immuno-MRM approach depends on antibodies with high affinity for the peptide target. However, the near absolute specificity of the mass spectrometer allows for some off-target binding while maintaining high selectivity. Here, we describe the development, validation, and proof-of-concept application of a suite of MRM-based assays to quantify proteins and phosphosites involved in the RTK, MAPK, and AKT signaling networks. The quantitative assays were developed in three formats: (1) direct LC-MRM (direct-MRM) analysis for expression analysis of high-abundance proteins without enrichment; (2) IMAC enrichment prior to LC-MRM (IMAC-MRM) for quantification of phosphopeptides; and (3) antibody enrichment of unmodified and phosphorylated peptides prior to MRM (immuno-MRM). Assays were characterized in accordance with fit-for-purpose guidelines (Whiteaker et al., 2014, 2016) corresponding to tier 2 level validation (Carr et al., 2014). As a proof of concept, we examined differences in response to BRAF inhibition in melanoma and colorectal cancer cell lines. Targeted inhibitors have been developed against the tumor driver, BRAFV600E, which is found in 50% of melanomas (Davies et al., 2002) and 10% of colorectal cancers (Prahallad et al., 2012). BRAF inhibitors have been shown to be effective against 80% of BRAFV600E-mutated melanomas, but response rates are just 5% in BRAFV600E-mutated colorectal cancer (CRC) (Prahallad et al., 2012). Furthermore, BRAF inhibitors are ineffective in RAS-mutated cells because of a well-described phenomenon: paradoxical activation of ERK1/2 (Cox and Der, 2010, 2012; Holderfield et al., 2014; Poulikakos et al., 2010). Cancer biologists frequently use the BRAF inhibitor (BRAFi), PLX4720, (Tsai et al., 2008), which is a non-clinical tool compound similar to vemurafenib (Bollag et al., 2010) to investigate the signaling underlying this unmet medical need; PLX4720 is highly effective in BRAFV600E-driven melanomas (Flaherty et al., 2010) but elicits only weak therapeutic response in BRAFV600E-mutated CRCs (Prahallad et al., 2012). Therefore, we have chosen this test case for our assay platforms, given that these phenomena have been well characterized in multiple cell line models providing the capability to verify the results of these MRM-based assays. Finally, to enable distribution in the research community, the information and resources needed to implement the assays (e.g., standard operating protocols, metrics, instrument parameters, and antibody reagents) are publicly available through the National Cancer Institute's Clinical Proteomics Tumor Assessment Consortium (CPTAC) Assay Portal (assays.cancer.gov) (Whiteaker et al., 2014, 2016), and the CPTAC Antibody Portal (antibodies.cancer.gov). Application of these assays will aid exploration in aspects of cellular signaling in cancer biology and targeted therapy.

Results

Target selection and MRM assay development

Proteins and phosphorylation sites that sustain cell growth and proliferation in the RTK, MAPK, and AKT signaling networks were identified as targets for assay development by members of the US National Cancer Institute's RAS Initiative (https://www.cancer.gov/research/key-initiatives/ras; see Table S1 and Figure 1A). Selecting from this target list, we developed MRM-based assay platforms to assess key nodes in cancer signaling as a proof of concept in an initial step toward a comprehensive panel to elucidate tumor biology, assist with development of targeted therapy, and streamline assay implementation for companion diagnostics. Peptides amenable to MS were identified by mining existing LC-MS/MS proteomic and phosphoproteomic datasets (Bhowmick et al., 2018; Kusebauch et al., 2016; Remily-Wood et al., 2011; Whiteaker et al., 2014, 2016), including data from breast, ovarian, and CRC tissues, cancer cell lines, and public databases, for empirical evidence of LC-MS/MS detectability. After ranking peptides on the basis of observational, chemical, and physical properties, further review focused on known mutation sites by using CBioPortal (Cerami et al., 2012), PTMs by using PhosphoSitePlus (Hornbeck et al., 2012, 2019), and assessment of potential interference by using the in silico Peptide Interference Predictor (Remily-Wood et al., 2014).
Figure 1

Development of quantitative assay panels targeting cancer signaling to promote cellular growth and proliferation

(A) RTK, MAPK, and AKT signaling networks were targeted for MS-based assay development to quantify expression and phosphorylation of proteins that drive cellular growth and proliferation in cancer. Proteins targeted by the MRM assay panels are colored blue; additional signaling nodes not included in the assay panel are shown in gray; the BRAF inhibitor, PLX4720, is shown in red.

(B) The different sample processing workflows culminate in LC-MRM of tryptic peptides using a spiked-in stable isotope-labeled standard (SIS) for each analyte. Direct-MRM targets higher-abundance proteins, IMAC-MRM targets phosphopeptides (i.e., pSTY) for enrichment prior to MRM, and immuno-MRM uses custom monoclonal antibodies for peptide immunoaffinity enrichment of selected unmodified and phosphorylated peptides. Peptides measured in common between methods are shown in the Venn diagrams. The protocols, reagents, and assay characterization data, as well as demonstration of utility of the methods for pharmacodynamic and proof-of-mechanism studies, are presented in this article.

Development of quantitative assay panels targeting cancer signaling to promote cellular growth and proliferation (A) RTK, MAPK, and AKT signaling networks were targeted for MS-based assay development to quantify expression and phosphorylation of proteins that drive cellular growth and proliferation in cancer. Proteins targeted by the MRM assay panels are colored blue; additional signaling nodes not included in the assay panel are shown in gray; the BRAF inhibitor, PLX4720, is shown in red. (B) The different sample processing workflows culminate in LC-MRM of tryptic peptides using a spiked-in stable isotope-labeled standard (SIS) for each analyte. Direct-MRM targets higher-abundance proteins, IMAC-MRM targets phosphopeptides (i.e., pSTY) for enrichment prior to MRM, and immuno-MRM uses custom monoclonal antibodies for peptide immunoaffinity enrichment of selected unmodified and phosphorylated peptides. Peptides measured in common between methods are shown in the Venn diagrams. The protocols, reagents, and assay characterization data, as well as demonstration of utility of the methods for pharmacodynamic and proof-of-mechanism studies, are presented in this article. On the basis of this information, 167 peptides (including multiple peptides per protein) were selected for assay development, representing 29 proteins and 34 phosphorylation sites. Peptide sequences selected for assay development are listed in Table S1. Several MRM-based multiplexed assay panels were developed for the selected peptides, including one direct-MRM, one IMAC-MRM, and two immuno-MRM, which all require upfront protein digestion with trypsin and use spiked-in stable isotope standard (SIS) peptides for precise relative quantification. The three assay types are distinguished by the extent and type of enrichment performed prior to measurement (Figure 1B). The direct-MRM assay measures peptides present in a tryptic digest without enrichment or fractionation prior to analysis; this assay is suitable for measurement of expression of moderately to highly abundant proteins. IMAC-MRM enriches phosphopeptides by using immobilized metal affinity chromatography prior to LC-MRM analysis, so only phosphopeptides will be detected and quantified. Immuno-MRM uses anti-peptide antibodies (Schoenherr et al., 2019) for enrichment prior to LC-MRM and is applicable for quantifying expression of high- and low-abundance proteins as well as phosphopeptides. For the two immuno-MRM assay panels, the monoclonal antibodies developed specifically for this purpose have already been characterized (Schoenherr et al., 2019). Fit-for-purpose validation was performed to characterize each assay panel; results for individual peptide performance are reported in Table S2 and a summary of validation data are available in Figures S1A–S1E. In total, we validated assays targeting 113 unmodified peptides by direct-MRM, 47 phosphopeptides by IMAC-MRM, and 96 (unmodified and phosphorylated) peptides by immuno-MRM (Figure 1B). Each assay group had a median linear response range of over three orders of magnitude. The median lower limit of quantification (LLOQ) was 200 fmol/mg (or 200 amol/μg) for direct-MRM, 12.5 fmol/mg for IMAC-MRM, and 6.12 fmol/mg for immuno-MRM. Finally, percent coefficient of variation (%CV) from characterization of within-day repeatability (intra-assay %CV) were 2%, 2%, and 9%, and the between-day repeatability (inter-assay %CV) were 3%, 2%, and 18% for the direct-MRM, IMAC-MRM, and immuno-MRM assays, respectively. Assay portability of the immuno-MRM platform is shown in Figure S1F by an inter-laboratory evaluation at three different sites showing good correlation (R2 > 0.92) and agreement (1.09 > slope values > 0.79).

The MRM methods are capable of quantifying cell signaling dynamics

We conducted proof-of-principle experiments to demonstrate application of the quantitative multiplexed assays in profiling changes in protein expression and phosphorylation in melanoma and CRC cell lines harboring either BRAF or RAS mutations ± PLX4720 treatment. BRAF-mutated melanomas are sensitive to the initial treatments of PLX4720; in BRAF-mutated CRC, epidermal growth factor receptor (EGFR) signaling reactivates the MAPK pathway (Tse and Verkhivker, 2016). In RAS-mutated melanomas and CRC, PLX4720 paradoxically activates the MAPK pathway through CRAF, leading to excessive proliferation and rendering PLX4720 ineffective. We used four cell lines, including BRAF inhibitor-sensitive A375 (BRAFV600E) and inhibitor-resistant SK-MEL-2 (NRASQ61R) melanoma cell lines, as well as resistant HT-29 (BRAFV600E) and HCT-116 (KRASG13D) (Ahn et al., 2015; Corcoran et al., 2012) colon cancer cell lines (CCLE Drug Data, 2015; Barretina et al., 2012), as a test case in drug sensitivity and resistance based on their response to BRAF inhibition with 3 μM PLX4720. We confirmed the differential sensitivity of A375 (BRAFV600E melanoma), HT-29 (BRAFV600E CRC), HCT-116 (KRASG13D CRC), and SK-MEL-2 (NRASQ61R melanoma) to PLX4720 by measuring proliferation in a 72-h assay (Figure S2A). Mirroring expectations of known biology and clinical observations, BRAFV600E melanoma cells (A375) demonstrated greater sensitivity to PLX4720 than BRAFV600E CRC cells (HT-29), and the RAS-mutant melanoma and CRC cells (SK-MEL-2 and HCT-116, respectively) showed resistance to PLX4720. Protein from whole-cell lysates (treated with DMSO vehicle control or PLX4720, harvested at 1.5, 24, and 48 h of drug exposure; two biological replicates) were proteolyzed with trypsin, and peptides were quantified by direct-MRM or used for enrichment prior to IMAC- or immuno-MRM analysis (data are provided in Table S3). Most peptides were detected above the LLOQ in more than half of the samples (60 out of 113 peptides for direct-MRM, 23 out of 47 phosphopeptides for IMAC-MRM, and 80 out of 96 unmodified and phosphopeptides for immuno-MRM). For comparison between assay platforms, 48 out of 64 unmodified peptide signals were above LLOQ in both direct-MRM and immuno-MRM assays, while 18 out of 31 phosphopeptide signals were detected above LLOQ by both IMAC-MRM and immuno-MRM assays (Table S4 and Figure S2B). Overall, widespread profiling of protein expression and phosphorylation was obtained using the MRM methods, demonstrating efficient multiplexed measurement of cellular signaling. To examine the breadth of information obtained by the multiplexed assay, we analyzed expression levels from each assay by unsupervised (Figure 2) and supervised clustering (Figure S3). As expected, unsupervised clustering of the MRM data grouped samples according to cell line and mutation status. Furthermore, the peptides from the same protein were classified together. In addition, aspects of known biology could also be observed; for example, E-cadherin (CADH1) was quantified at higher levels in CRC cells that are epithelial in nature, whereas N-cadherin (CADH2) was observed at higher levels in melanomas that are mesenchymal (Figures 2A and 2C). Baseline differences in protein expression and phosphorylation (Figure 2) could also be used to distinguish the cell lines (e.g., AKT3 is expressed more highly in melanoma than in CRC cell lines, GSK3B is expressed at the highest levels in SK-MEL-2 cells, EGFR phosphorylation is higher in CRC than these melanoma cell lines) and to differentiate RAS and BRAF mutant cells (e.g., MP2K1 or MEK1 expression is higher in BRAF than in RAS mutant cell lines).
Figure 2

Unsupervised clustering of quantitative MRM data groups primarily by biological differences in cell types

(A–B) Unsupervised clustering of protein expression measured by direct-MRM (A), phosphorylation measured by IMAC-MRM (B), and protein expression and phosphorylation measured by immuno-MRM (C) show that protein expression and phosphorylation predominantly cluster by cell line with secondary clusters grouped by response to PLX treatment. Row heatmap values are Z score of the median response for each peptide analyte using the log2 transformed peak area ratio (light/heavy) values from the MRM data (n = 2 biological replicates); missing values were imputed with LLOQ values.

Unsupervised clustering of quantitative MRM data groups primarily by biological differences in cell types (A–B) Unsupervised clustering of protein expression measured by direct-MRM (A), phosphorylation measured by IMAC-MRM (B), and protein expression and phosphorylation measured by immuno-MRM (C) show that protein expression and phosphorylation predominantly cluster by cell line with secondary clusters grouped by response to PLX treatment. Row heatmap values are Z score of the median response for each peptide analyte using the log2 transformed peak area ratio (light/heavy) values from the MRM data (n = 2 biological replicates); missing values were imputed with LLOQ values.

Multiplexed quantitation of protein expression and phosphorylation elucidate response to PLX4720 treatment

To further demonstrate the utility of the multiplexed assay and examine the pharmacodynamic profiling of the activation of growth and proliferation signaling, we plotted the relative expression of unmodified and phosphorylated peptides for several specific relevant targets determined by MRM-based assays for comparison with confirmatory WB in Figure 3. These targets were selected to demonstrate the effectiveness of the quantitative, multiplexed assay in examining central nodes of MAPK (RAS-RAF-MEK-ERK) signaling as well as proteins and phosphorylations involved in previously published mechanisms of BRAFi resistance (e.g., EGFR/ERBB activation, increased CRAF activation, and AKT signaling). A decrease in p-ERKT202/Y204 was observed in A375 at 1.5 h with a rebound of phosphorylation at later time points because of rewired ERK1/2 (MAPK1/MAPK3) signaling after PLX4720 treatment that gives rise to resistance (Lito et al., 2012). Consistent with the proliferation data, HT-29 cells showed little change of p-ERKT202/Y204 and were unresponsive to PLX4720 at 1.5 h, although shorter time points do show mitigation of signaling by decreases in p-ERKT202/Y204 (data not shown). BRAFV600E CRCs are known to be unresponsive to PLX4720 when compared with BRAFV600E-mutated melanomas (Corcoran et al., 2012; Prahallad et al., 2012). The levels of p-EGFRY1092 (position Y1092 in full-length EGFR corresponds to Y1068 after removal of 24 amino acids from the N terminus during processing) in A375 were found to be low (because melanomas typically express low levels of EGFR) (Corcoran et al., 2012; Prahallad et al., 2012); however, p-EGFRY1092 decreased in HT-29 at later time points, indicating that EGFR was not driving resistance in this model. Phosphorylation of BRAFT401 also decreased in A375 when compared with HT-29 (Ritt et al., 2010). ERBB2 and ERBB3 have been previously implicated in resistance mechanisms in melanomas treated with RAF/MEK inhibitors and are observed to be upregulated in both A375 and HT-29. This observation highlights non-EGFR RTK-based resistance mechanisms in both melanomas and CRCs (Abel et al., 2013; Herr et al., 2018). Furthermore, p-AKT1/2/3S473 activation, likely driven by Rictor/MTOR activation (Sarbassov et al., 2005), was also prevalent in both cell lines (Gopal et al., 2010), and activation of the p-AKT1T308 site was observed at 48 h in both cells after PLX treatment (Table S3), consistent with expectations (Espona-Fiedler et al., 2012; Homsi et al., 2009). Of note, PTEN expression increased at later time points in both BRAF-mutated cell lines (Figure 3); PTEN is required to upregulate Bcl-2-like protein 11 (i.e., BIM) to cause BRAFi-driven apoptosis in melanoma (Paraiso et al., 2011). As expected, the recovery of Cyclin D1 (CCND1) levels in HT-29 at the 48-h time point highlights the difference in sensitivity between A375 and HT-29 (Diao and Chen, 2007). Overall, our MRM-based results indicate the molecular basis for BRAFV600E melanoma (A375) sensitivity to PLX4720 compared with the lesser effect on BRAFV600E-mutated CRC (HT-29) and show signaling effects consistent with previous reports (Corcoran et al., 2012; Lee et al., 2010; Prahallad et al., 2012).
Figure 3

MRM assays show quantitative changes in signaling in melanoma and colorectal cancer cell lines after PLX4720 treatment

Heatmaps of selected quantitative MRM measurements of proteins and phosphosites to examine central nodes of MAPK (RAS-RAF-MEK-ERK) signaling and demonstrate previously published mechanisms of BRAFi resistance in four cancer cell lines. MRM results shown are from immuno-MRM assays with the exceptions of p-EGFRY1092 and p-CTNB1S552 (which are IMAC-MRM results). For MRM assays, p-AKT1S473 and AKT2 peptide LLPP were chosen for correlation with pan AKT1/2/3 western blots (WB). Each cell in the heatmap is colored according to normalized values for individual analytes across all samples. The quantitative values were correlated with analysis by WB (STAR Methods). Analyte nomenclature was based on the sequence of the peptide analyzed by MRM (left side, “MRM assay” label) and the reported WB antibody specificity (right side, “Western blot” label). Vinculin was used as a loading control for WB. Bar plots are the mean of duplicate biological replicates. Error bars show the range of duplicate biological replicates.

MRM assays show quantitative changes in signaling in melanoma and colorectal cancer cell lines after PLX4720 treatment Heatmaps of selected quantitative MRM measurements of proteins and phosphosites to examine central nodes of MAPK (RAS-RAF-MEK-ERK) signaling and demonstrate previously published mechanisms of BRAFi resistance in four cancer cell lines. MRM results shown are from immuno-MRM assays with the exceptions of p-EGFRY1092 and p-CTNB1S552 (which are IMAC-MRM results). For MRM assays, p-AKT1S473 and AKT2 peptide LLPP were chosen for correlation with pan AKT1/2/3 western blots (WB). Each cell in the heatmap is colored according to normalized values for individual analytes across all samples. The quantitative values were correlated with analysis by WB (STAR Methods). Analyte nomenclature was based on the sequence of the peptide analyzed by MRM (left side, “MRM assay” label) and the reported WB antibody specificity (right side, “Western blot” label). Vinculin was used as a loading control for WB. Bar plots are the mean of duplicate biological replicates. Error bars show the range of duplicate biological replicates. Similar observations were made in the RAS-mutated cell lines, HCT-116 and SK-MEL-2 (Figure 3). Phosphorylation of EGFRY1092 and total EGFR both increased in HCT-116 cells. As expected, we were unable to measure the expression of EGFR in SK-MEL-2 cells, consistent with low expression levels of EGFR in melanomas (Corcoran et al., 2012; Prahallad et al., 2012). Phosphorylation of BRAFT401, which decreases CRAF binding and results in negative feedback regulation by ERK1/2, was increased in HCT-116 cells. HCT-116 not only had EGFR-dependent MAPK activation but also an increase in p-AKT1/2/3S473 caused by RAS-dependent phosphatidylinositol 3-kinase (PI3K)/AKT activation (Figure 3). The activation of p-AKT1/2/3S473 in HCT-116 was associated with an induction of p-CTNNB1S552, which promotes tumor invasion (Fang et al., 2007); this result is consistent with the increased aggressiveness of RAS-mutant tumors after BRAF inhibition. The protein expression pattern in HCT-116 shows that there are multiple resistance mechanisms occurring in RAS-mutated CRC, which are absent in melanomas. Our data derived from immuno-MRM assays were consistent with WB carried out in parallel and similar to previously published literature, which demonstrate that PLX4720 paradoxically activates p-ERKT202/Y204 signaling in both RAS-mutated SK-MEL-2 melanoma and HCT-116 CRC, causing resistance to BRAFi (Holderfield et al., 2014). Furthermore, these results integrate the outcomes of several previous studies and demonstrate the effectiveness of measuring protein expression and phosphorylation for multiple targets by using MRM assays, demonstrating the utility of the MRM-based methods for pharmacodynamic and mechanism-of-action studies, as well as defining mechanisms of drug resistance that alter cell signaling.

MRM results expand the understanding of protein regulation and phosphorylation involved in PLX4720 resistance

The quantitative nature and high specificity of MRM assays offer additional molecular details, as exemplified by analyzing phosphorylation of ERK1/2. Using the specificity of the MRM assays (Figure S4), individual measurements of the monophosphorylated and doubly phosphorylated ERK peptides provide molecular insight into the activation of this kinase. For example, in the case of ERK1/2, unmodified peptides quantifying protein expression show relatively little change, indicating that activity is driven through changes in phosphorylation. Immuno-MRM data are presented, but direct-MRM measurements of protein ERK protein expression and IMAC-MRM measurements of ERK1/2 phosphotyrosine measurements strongly correlate with the immuno-MRM results. Specificity of each phosphosite is conferred through chromatographic separation, detection of internal standard peptides, and consistent fragment ion relative intensities. We find phosphorylation predominantly occurs at the p-Y204/Y187 sites on ERK1/2 (Figure 4A). The p-T sites were only detected at 48 h after exposure to PLX4720. Likewise, for the A375 cells, the doubly phosphorylated peptides also show an increase at 48 h, indicating hyperphosphorylation of the ERK1/2 active sites. This phosphorylation pattern is consistent with previous results (Lee et al., 2019), showing that tyrosine phosphorylation is critical for ERK activation. WB results correlate with the immuno-MRM measurements (Figure 4B), showing consistent trends in the increase of p-ERKT202/Y204 phosphorylation compared with DMSO controls. Although the antibody for WB might recognize all phosphorylated forms of ERK1/2, the MRM data quantify each phosphopeptide separately. The additional molecular detail afforded by the MRM assays confirms that tyrosine phosphorylation is the dynamic driving factor in ERK activation and that threonine phosphorylation plays a supporting role. This is further illustrated by examining the relative quantitative relationship of total protein expression and phosphorylation between the cell lines, shown in Figure 4C, which provides insights into the changes in ERK signaling in BRAFi-sensitive and -resistant cells. A375 cells show little change with DMSO, but a significant decrease in signaling at 1.5 h with paradoxical signaling at 24 h that is sustained at 48 h after treatment. All other cell lines show increased p-ERK after BRAF inhibition. Although expression levels differed approximately 2-fold between the cell lines, the activated levels of phosphorylated p-ERK were similar. Furthermore, phosphorylation levels increased more compared with the total expression level of ERK1.
Figure 4

Quantitation of paradoxical ERK1/2 activation after PLX4720 treatment in colorectal cancer and melanoma cell lines illustrates the molecular detail accessible through immuno-MRM measurements

(A) Relative quantitation of ERK1/2 peptides are plotted as mean peak area ratio (PAR) comparing the light endogenous with the heavy internal standard in cell lines ± PLX4720. Error bars show the range of duplicate biological replicates. Dotted line shows the approximate lower limit of quantification (LLOQ).

(B) Densitometry values from western blots (WB) of ERK1/2 expression and phosphorylation in the same cell lysates were used for correlation with immuno-MRM analysis.

(C) The relative levels of total protein expression, plotted as the PAR for the peptide ALDLLDR, are related to levels of the phosphorylated p-ERK1Tyr204. The amino acid residue numbers of the peptides within the protein are shown in brackets. Samples are color-coded according to cell line and ±PLX4720 in the key at the top of the panel; data were labeled with time point.

Quantitation of paradoxical ERK1/2 activation after PLX4720 treatment in colorectal cancer and melanoma cell lines illustrates the molecular detail accessible through immuno-MRM measurements (A) Relative quantitation of ERK1/2 peptides are plotted as mean peak area ratio (PAR) comparing the light endogenous with the heavy internal standard in cell lines ± PLX4720. Error bars show the range of duplicate biological replicates. Dotted line shows the approximate lower limit of quantification (LLOQ). (B) Densitometry values from western blots (WB) of ERK1/2 expression and phosphorylation in the same cell lysates were used for correlation with immuno-MRM analysis. (C) The relative levels of total protein expression, plotted as the PAR for the peptide ALDLLDR, are related to levels of the phosphorylated p-ERK1Tyr204. The amino acid residue numbers of the peptides within the protein are shown in brackets. Samples are color-coded according to cell line and ±PLX4720 in the key at the top of the panel; data were labeled with time point.

Discussion

In this study, we present methods for MRM-based assays that can be used as a resource for the precise relative quantification of protein expression and signaling in growth and proliferation. The procedures, application notes, and performance data for each of the multiplex MRM assays described here are publicly available through CPTAC's Assay Portal (assays.cancer.gov), and the monoclonal antibodies (Schoenherr et al., 2019) are available via the Antibody Portal (antibodies.cancer.gov) (see Table S1 for assay and antibody identifiers). These fit-for-purpose validated quantitative assays offer advantages over conventional antibody-based forms of protein quantitation (e.g., WB, IHC). For example, MS confirms the specific sequence of the peptide derived from the protein (i.e., the analyte is measured directly and there is no secondary detection/amplification step). Additionally, spiked-in SIS peptides control for some preanalytical variations and facilitate transferability of the assays across laboratories and over time (e.g., quantitation of proteins in different sample types analyzed in different batches). Finally, the assays are multiplexed, performing the equivalent of 63 WBs (for 29 proteins and 34 phosphorylation sites) from the same sample in a single experiment. Another advantage of the MRM approach is in measuring phosphorylated and non-phosphorylated forms with a multiplexed assay. We demonstrate this utility by showing relative measurements of ERK1/2 protein and phosphoprotein expression. Absolute quantitative conclusions about phosphorylation stoichiometry must be made with caution, however, given that phosphosites can be clustered, not all possible phospho-isoforms might be detected, and phosphorylation near cleavage sites can affect trypsin digestion. If multiple isoforms of the analyte peptide exist, each corresponding mass must be targeted separately in the MRM assay to quantify site occupancy. Thus, the MRM-based assays provide precise relative quantification of the reproducibly recovered tryptic peptide analyte(s) targeted by the MRM method, and further quantitative validation is necessary to provide absolute quantitation of phosphosite stoichiometry. The assays were developed in three formats: direct-MRM, IMAC-MRM, and immuno-MRM. As expected, each format has its strengths and weaknesses regarding the analytes detected and resources required for implementation. This dataset provides indication of which proteins might require enrichment in future studies. Direct-MRM offers the most straightforward approach to measuring protein expression with the smallest sample requirements and least sample-handling steps. However, it is limited to measurement of higher-abundance proteins, whereas enrichment is required for low-abundance targets and phosphorylated peptides. IMAC-MRM offers the ability to reproducibly measure phosphorylation without target-specific reagents but is limited to a subset of the phosphoproteome and might require additional fractionation to increase recovery of specific phosphopeptides or reduce interference. Immuno-MRM can measure both unmodified and phosphorylated peptides in a single assay and is capable of the highest sensitivity of the three, as it is not limited by sample input amounts and the antibodies provide 102- to 104-fold enrichment of the target. Unless an applicable antibody already exists (Schoenherr et al., 2016), costs and lead time for developing immuno-MRM assays are greater than for direct- or IMAC-MRM assays, which do not require reagents for target-specific enrichment. As we have demonstrated in this approach using multiple forms of enrichment coupled with MRM, the main limitation to developing an MRM assay is the availability of a peptide that is amenable to analysis by MS and the abundance of the peptide in the specimen of interest. We demonstrated the application of the multiplexed MRM assay resource for pharmacodynamic and mechanism-of-action studies. As predicted, both RAS-mutated cells, HCT-116 and SK-MEL-2, hyperactivated the MAPK pathway by increasing p-ERK1/2T202/Y204. HCT-116 presented a robust multi-mechanism feedback induction by activating both p-EGFRY1092 and p-AKT1/2/3S473, suggesting that RAS-dependent PI3K activation also contributes to PLX4720 resistance. MAPK hyperactivation and subsequent drug resistance was also observed after longer-term drug exposures in BRAFV600E-mutated A375 and HT-29 cell lines. Although low expression prevented detection of EGFR hyperactivation (Corcoran et al., 2012), we did observe upregulation of other RTKs, including ERBB2 and ERBB3 in A375 (Abel et al., 2013) and HT-29 (Herr et al., 2018), supporting a model of ERBB-mediated BRAF inhibitor resistance by reactivating the MAPK and PI3K pathways in these BRAF-mutated cell lines. Combination therapy has taken center stage in targeting acquired resistance in the clinic. Melanoma and CRC are both complex and heterogeneous diseases, and acquired resistance to targeted therapeutics might be inevitable. Therefore, multiplexed assays such as these provide a way to encompass multiple upstream and downstream signaling network members in a quantitative evaluation of protein expression and phosphorylation during drug treatment to find novel synergistic combinations. Multiple clinical trials are ongoing with the goal of chronically inhibiting BRAF activity while vertically targeting compensatory mechanisms. Although the dual inhibition treatment strategies were not evaluated as part of this study, our assays can provide support for the clinical strategies combining BRAFi + MEKi, BRAFi + HSP90i (Eroglu et al., 2018), BRAFi + PI3Ki, and BRAFi + ERBBi therapies for treatment of BRAF-driven melanomas and CRC (Lee et al., 2010; Lito et al., 2012) and other emerging targeted therapies for RAS-driven tumors. Moving forward, this assay resource could be expanded to further increase its utility in assessing cancer signaling in the Ras-Raf-MEK-ERK pathway. For example, assays to quantify the DUSP4 and Gab2 proteins could be added to further study signaling in drug-resistant cell lines. Expansion of the assay platform to include reporters for downstream effectors (e.g., changes in cancer metabolism) could provide more links between this panel and cancer phenotypes linked to drug sensitivity or therapeutic resistance. Additional peptides corresponding to other relevant proteins not pursued for assay development in this study are available in Table S1. Other additions to the assay resource could address additional phosphorylation sites on these target proteins, those biologically significant phosphosites that were less amenable to the standard MS workflow (because the sites of interest were in tryptic peptides that were either too small or too large for LC-MS/MS analysis), and those phosphosites where we developed an assay but were unable to measure endogenous expression levels. Modifications to the standard sample processing, such as use of alternative enzymes for digestion, would be necessary to optimize recovery of these phosphosites, allowing expansion of the panel to more phosphosites of interest. In summary, we have described the development of MRM-based targeted assays for a panel of biologically important proteins and their key phosphosites relevant to targeted cancer therapy. These experiments probing resistance mechanisms in cell lines illustrate the utility of this assay resource by replacing over 60 WBs in examining cancer signaling and tumor biology with high molecular specificity and quantitative rigor, and demonstrate the value of this assay resource for pharmacodynamic measurements and mechanism-of-action studies.

Limitations of the study

Detection of the targeted analytes depends on expression levels and relative response in the mass spectrometer. The method is most likely to succeed where there is sufficient material available for analysis and phosphorylated proteins are appropriately preserved. For analysis of low-abundance targets, or using limited material, the described enrichment methods are most appropriate. To improve likelihood of detection, increasing the amount of input material might be necessary. Special attention to preanalytical variables (e.g., sample collection, preservation, and lysis conditions) is helpful for minimizing changes in phosphorylation status due to phosphatase activity and/or degradation. When addressed, these considerations make the methods applicable to a variety of applications. In addition to the pharmacodynamic and mechanism-of-action studies demonstrated herein, a broad utility in measuring protein expression and phosphorylation is possible using the assays, including biomarker studies, confirmation of expression, and differential proteomics studies.

STAR★Methods

Key resources table

Resource availability

Lead contact

Further information and requests for resources and reagents should be directed to and will be fulfilled by the Lead Contact, Amanda Paulovich (apaulovi@fredhutch.org).

Materials availability

Antibodies for immuno-MRM assays have been deposited to the CPTAC Antibody Portal (antibodies.cancer.gov). Assay characterization data and protocols have been deposited to the CPTAC Assay Portal (assays.cancer.gov).

Data and code availability

The accession number for the data reported in this paper is Panorama: NmDXGW. Panorama Public (Sharma et al., 2014) is a database of targeted proteomics measurements; the link for this dataset is (https://panoramaweb.org/NmDXGW.url). Characterization data for assays are available in the CPTAC Assay Portal (assays.cancer.gov).

Experimental model and subject details

Cell lines

HCT-116 (ATCC catalog# CCL-247), HT-29 (ATCC catalog# HTB-38), A375 (ATCC catalog# CRL-1619), and SK-MEL2 (ATCC catalog# HTB-68) cells were grown in 150 mm TC plates in 30mL of DMEM/F12 supplemented with 10% FBS and treated with PLX-4720 at 48h, 24h and 1.5 h time points. PLX-4720 and DMSO controls were added in fresh media for every time point. After treatment, adherent cells were released in 0.25% trypsin and washed 3x with DPBS. Lysis buffer (6 M Urea, 25 mM Tris pH 8.0, 1 mM EGTA, 1 mM EDTA, Sigma phosphatase cocktail 1 and 2 and Sigma Protease inhibitor) was added to the pellet at 5 x 107 cells/ mL. Cells suspended in lysis buffer were sonicated 3 times with a Qsonica Sonicator, Pulse 1 sec on and 1 sec off at 70% amplitude. Lysates were then spun at 20,000 x g for 15 min at 4oC. After confirming the common signaling pathways dysregulated after PLX-4720 treatment, the cell lines were scaled up, treated with PLX-4720 and the lysates shipped to FHCRC on dry ice for distribution to the three proteomics laboratories.

Method details

Proliferation assays

Cells were seeded at 1,000 cells/well in a 384-well black wall tissue culture plate (Greiner microClear®) in DMEM/F12 supplemented with 10% FBS. (For experiments in which media was changed, the cells were washed with DPBS 1X and supplemented with indicated media before drug treatment). Cells were treated with PLX-4720 and a final DMSO concentration of 0.25% 12–18 h after seeding. Plates and cells were harvested 72 h post treatment using CellTiter-Glo® Luminescent Cell Viability Assay (Promega: G7570) and read on Envision multimode Plate Reader (PerkinElmer). Relative viability was calculated as a percent change relative to 0.25% DMSO control treated wells.

Western blot analysis

HCT-116, HT-29, A375 and SK-MEL2 cells were seeded (300,000 in 3 mL DMEM/F-12 supplemented with 10% FBS) in a 6-well tissue culture plate and treated with PLX-4720 at 48h, 24h and 1.5 h time points. PLX-4720 and DMSO controls were added in fresh media for all time points. After treatment cells were collected and lysed using lysis buffer (1% Triton X100, 20 mM Tris pH 7.5, 50 mM NaCl, 2 mM MgCl2, 1mM EDTA, and EGTA and Halt protease and phosphatase inhibitors). The membranes were immunoblotted using primary antibodies overnight, incubated with LI-COR secondary antibodies for 45 min, and scanned on Odyssey® CLx Imaging System.

Peptide selection criteria

Using the existing cancer biology literature and proteomics resources, each of these targets was comprehensively reviewed. First, existing LC/MS proteomic datasets (including data from breast, ovarian, and colorectal cancer tissues, cancer cell lines, and public databases) were mined for empirical evidence of detection of corresponding peptides. For modified targets, datasets incorporating phosphopeptide enrichment were used for searching. Each dataset was searched for matching peptides to the gene product identified on the master list, or in the case of post-translationally modified targets, the datasets were searched for the tryptic sequence containing the modification (searches allowed for identifications encompassing missed trypsin cleavage sites). Selected peptides were required to be proteotypic (i.e., unique to the protein target of interest and featuring a good response by mass spectrometry) and were prioritized by frequency of observation, MS intensity, length (between ∼7-25aa), hydrophobicity (10-40 by SSRCalc) or retention time, charge state (z=2,3), amino acid composition (deprioritize M, N-terminal Q, N-terminal C, multiple P, previous and next amino acids containing trypsin sites (ie. ragged ends)), and frequency of missed cleavage products. After ranking of the peptides based on those criteria, further review focused on a peptide-level knowledge of biology, which included known sites of mutation using CBioPortal (Cerami et al., 2012), post-translational modifications using PhosphoSitePlus (Hornbeck et al., 2012, 2019), and assessment of potential interference using the in silico Peptide Interference Predictor (Remily-Wood et al., 2014).

Enzymatic digestion

Cell lysates were analyzed in a blinded fashion. Lysates were diluted to 2 mg/mL with lysis buffer. Aliquots were transferred to 2 mL deep-well plates and sealed with pierceable film. Reduction was performed by addition of 0.5 M triscarboxyethylphosphine (TCEP) and incubated for 30 min at 37°C with mixing. Cysteines were alkylated with iodoacetamide for 30 min in the dark. To decrease urea concentration, 0.2 M Tris (pH 8.0) was added to decrease urea concentration to ∼0.6 M prior to addition of Lys-C at a 1:50 enzyme: substrate ratio. The mixture was incubated for 2 h at 37°C with mixing, followed by addition of trypsin at a 1:50 enzyme: substrate ratio. The mixture was incubated overnight (16 h) at 37°C. Formic acid (aqueous 20% v/v) was added to quench the digestion at a final acid concentration of 1%. The heavy SIS peptide master mix was added to the digested peptides prior to desalting. The digested peptides were desalted on SPE plates by equilibrating with 1% formic acid, loading the peptide mixture on the plates, washing 3x with aqueous 0.1% formic acid, and elution with aqueous 50% acetonitrile/0.1% formic acid. Eluted peptides were lyophilized to powder.

Peptide immunoaffinity enrichment

Custom rabbit and mouse monoclonal antibodies were crosslinked to Protein G agarose magnetic particles (GE Healthcare). The dried peptides were resuspended in PBS/0.01% CHAPS in 96 well plates and adjusted to pH 8.0 with 1 M Tris. 24 μL of antibody beads (corresponding to panel mix #1; monoclonal antibodies to phosphorylated peptides crosslinked to Protein G beads) was added to the solution, the plate was sealed, and samples were incubated overnight at 4°C with tumbling on a Labquake tube rotator or Lab Shaker. Following incubation, the plates were centrifuged at 800 × g for 30 seconds and processed using a KingFisher automated magnetic particle processor. The beads were washing twice with PBS/0.01% CHAPS and once with 0.1X PBS/0.01%CHAPS. The peptides were eluted from the beads with aqueous 3% acetonitrile/5% acetic acid / 50mM citrate. The flow-through was used in a sequential enrichment experiment by adding antibody beads (corresponding to panel mix #2; monoclonal antibodies to unmodified peptides crosslinked to Protein G beads) and repeating the enrichment procedure as described above.

Liquid chromatography multiple reaction monitoring mass spectrometry

Direct-MRM and IMAC-MRM LC-MS was performed with a Dionex Ultimate 3000 RS system coupled to a Thermo Quantiva triple quadrupole mass spectrometer. Peptides were loaded on a trap column (Acclaim Pepmap 100 C18, 20 mm x 100 μm) using mobile phase A (0.1% formic acid in 2% acetonitrile). The LC gradient was delivered at 300 nL/minute and consisted of a linear gradient of mobile phase B (90% acetonitrile and 0.1% formic acid in water) developed on a 25 cm x 75 μm column (Acclaim Pepmap C18, 2 μm particles) from 2%–8% B in 1 minute, 8%–26.5% B in 41.5 minutes, 26.5%–50% B in 6 minutes, 50%–90% B in 30 seconds, 90%–96% B in 5.5 minutes, and re-equilibration at 2% B for 15 minutes. The nano electrospray interface was operated in the positive ion MRM mode. Parameters for collision energy (CE) were taken from optimized values in Skyline (MacLean et al., 2010). Q1 resolution was 0.4, Q3 resolution was 0.7. Immuno-MRM measurements were performed at two additional sites. The first site used a Proxeon Easy nLC-1000 system coupled to a Thermo Quantiva triple quadrupole mass spectrometer. Peptides were loaded using mobile phase A (0.1% formic acid in 2% acetonitrile) and 2% mobile phase B. The LC gradient was delivered at 200 nL/minute and consisted of a linear gradient of mobile phase B (90% acetonitrile and 0.1% formic acid in water) developed on a 15 cm x 75 μm column (Reprosil C18, 1.9 μm particles) from 2%–6% B in 2 minutes, 6%–30% B in 45 minutes, 30%–60% B in 6 minutes, 60%–90% B in 1 minute, and 5 minutes at 90%B. The final site used an Eksigent 425 nanoLC system with a nano autosampler and chipFLEX system (Eksigent Technologies, Dublin, CA) coupled to a 5500 QTRAP mass spectrometer (SCIEX, Foster City, CA). Peptides were loaded on a trap column (Reprosil C18, 5 mm x 200 μm) at 5 μL/min for 3 minutes using mobile phase A (0.1% formic acid in water). The LC gradient was delivered at 300 nL/minute and consisted of a linear gradient of mobile phase B (90% acetonitrile and 0.1% formic acid in water) developed from 3%–14% B in 1 minute, 14%–34% B in 20 minutes, 34%–90% B in 2 minutes, and re-equilibration at 3% B on a 15 cm x 75 μm chip column (ChromXP C18 particles, 3 μm). Scheduled MRM transitions used a retention time window of 150 seconds and a desired cycle time of 1.5 seconds, enabling sufficient points across a peak for quantitation. A minimum of two transitions (four total per peptide pair, including endogenous and spiked heavy peptides) were recorded for each light and heavy peptide. MRM data were analyzed by Skyline. Peak integrations were reviewed manually, and transitions from analyte peptides were confirmed by the same retention times of the light synthetic peptides and heavy stable isotope-labeled peptides, and with equivalent relative areas of recorded transitions. Transitions with detected interferences were not used in the data analysis.

Fit-for-purpose assay validation

The analytical performance of the assays was characterized in response curves, repeatability, and inter-laboratory experiments. Response curves were generated in a background of cell lysates from the following cell lines (relative contribution in parentheses): MCF10A-EV (5), T47D (1.25), CCRF-CEM (1), COLO205 (2), COR-L23 (2.5), H2444 (3), H2122 (3), H1792 (1.25), HEPG2 (2), K-562 (1.25), and H226 (3.75) cells. The pooled lysate was digested (Lys-C + trypsin) and heavy SIS peptides added by serial dilution (heavy spike amounts (fmol): 2000, 200, 20. 8, 3.2, 1.28, 0.512, 0.2048). Light peptide was added at a constant concentration (light spike (fmol): 50 (phosphopeptides), 20 (nonmodified peptides)). Blanks were prepared by using background lysate spiked with light peptide and no heavy peptides. All points were analyzed by immunoaffinity enrichment and MS in triplicate. Curves were analyzed using Skyline (MacLean et al., 2010) with a linear regression in log space with no weighting on all points above the lower limit of quantification. The Lower Limit of Quantification (LLOQs) was obtained by empirically finding the lowest point on the curve that had CV < 20% in the curve replicates. The upper limit of quantification (ULOQ) was determined by the highest concentration point of the response curve that maintained the linear range (R2 > 0.9) of the response. For curves that maintained linearity at the highest concentration measured, the ULOQ is a minimum estimate. Repeatability was determined by spiking heavy peptides at three concentrations (Low, Medium, High; spike levels (fmol) 2, 20, 200 (nonmodified); 5, 50, 500 (phosphorylated)) into the same pooled background lysate used in the response curves. Complete process triplicates (including digestion, enrichment – if applicable, and MS) were prepared and analyzed over five days. Intra-assay variation was calculated as the mean CV obtained within each day. Inter-assay variation was the CV calculated from the mean values of the five days. All replicates included in the repeatability calculation were required to be above the LLOQ determined from response curves. Inter-laboratory validation was conducted using the immuno-MRM assays in three independent laboratories using a “mini-kit” approach: a common set of antibodies linked to beads and master mixes of synthetic peptides were prepared centrally and distributed to participating sites. Response curves and repeatability experiments were run independently at each site to determine respective performance figures of merit. Inter-laboratory validation was conducted on lysates from the cell line samples used in proof-of-principle demonstration studies. As described above, lysates were prepared centrally and shipped to participating sites for analysis (i.e., digestion, enrichment, and MS was performed independently at each site). Due to differences in detection efficiency of some peptides at sites (different instruments and operating conditions), validated assays were required to be characterized at least two of the three sites.

Data analysis

Peak integration was performed in Skyline (MacLean et al., 2010). Specificity was determined by consistent retention times of light and heavy peptides in addition to relative intensity of transitions in light and heavy peptides within 30% of mean values. Integrated raw peak areas were exported from Skyline and total intensity was calculated using Peak Area + Background. Peak area ratios were obtained by dividing peak areas of light peptides by that of the corresponding heavy peptides and ratios were log (base 2) transformed for heat maps and statistical analysis. Immuno-MRM results from site 1 were used for data analysis except for peptides below LLOQ in a majority of samples, in which data from site 2 or 3 data were used (where possible).

Quantification and statistical analysis

Statistical analysis was performed using R and Microsoft Excel. Details for statistical analysis can be found in the figure legends.
REAGENT or RESOURCESOURCEIDENTIFIER
Antibodies

Monoclonal anti-AKT1antibodies.cancer.govRRID: AB_2722014
Monoclonal anti-AKT1antibodies.cancer.govRRID: AB_2868548
Monoclonal anti-AKT1antibodies.cancer.govRRID: AB_2722012
Monoclonal anti-AKT1antibodies.cancer.govRRID: AB_2722013
Monoclonal anti-AKT1antibodies.cancer.govRRID: AB_2868548
Monoclonal anti-AKT1antibodies.cancer.govRRID: AB_2827858
Monoclonal anti-AKT2antibodies.cancer.govRRID: AB_2868549
Monoclonal anti-AKT2antibodies.cancer.govRRID: AB_2868549
Monoclonal anti-AKT2antibodies.cancer.govRRID: AB_2722017
Monoclonal anti-AKT2antibodies.cancer.govRRID: AB_2722015
Monoclonal anti-AKT2antibodies.cancer.govRRID: AB_2722015
Monoclonal anti-AKT3antibodies.cancer.govRRID: AB_2814780
Monoclonal anti-AKT3antibodies.cancer.govRRID: AB_2814778
Monoclonal anti-AKT3antibodies.cancer.govRRID: AB_2722019
Monoclonal anti-AKT3antibodies.cancer.govRRID: AB_2722019
Monoclonal anti-AKT3antibodies.cancer.govRRID: AB_2820256
Monoclonal anti-AKT3antibodies.cancer.govRRID: AB_2820256
Monoclonal anti-CDH1antibodies.cancer.govRRID: AB_2722038
Monoclonal anti-CDH1antibodies.cancer.govRRID: AB_2722039
Monoclonal anti-CDH2antibodies.cancer.govRRID: AB_2722042
Monoclonal anti-CDH2antibodies.cancer.govRRID: AB_2722044
Monoclonal anti-PTENantibodies.cancer.govRRID: AB_2617320
Monoclonal anti-PTENantibodies.cancer.govRRID: AB_2722096
Monoclonal anti-PTENantibodies.cancer.govRRID: AB_2722095
Monoclonal anti-ARAFantibodies.cancer.govRRID: AB_2722023
Monoclonal anti-ARAFantibodies.cancer.govRRID: AB_2827857
Monoclonal anti-ARAFantibodies.cancer.govRRID: AB_2722020
Monoclonal anti-ARAFantibodies.cancer.govRRID: AB_2722021
Monoclonal anti-ARAFantibodies.cancer.govRRID: AB_2722022
Monoclonal anti-ARAFantibodies.cancer.govRRID: AB_2722023
Monoclonal anti-ARAFantibodies.cancer.govRRID: AB_2827857
Monoclonal anti-BRAFantibodies.cancer.govRRID: AB_2722029
Monoclonal anti-BRAFantibodies.cancer.govRRID: AB_2722024
Monoclonal anti-BRAFantibodies.cancer.govRRID: AB_2722027
Monoclonal anti-BRAFantibodies.cancer.govRRID: AB_2722027
Monoclonal anti-BRAFantibodies.cancer.govRRID: AB_2827860
Monoclonal anti-BRAFantibodies.cancer.govRRID: AB_2722027
Monoclonal anti-BRAFantibodies.cancer.govRRID: AB_2722027
Monoclonal anti-RAF1antibodies.cancer.govRRID: AB_2868553
Monoclonal anti-RAF1antibodies.cancer.govRRID: AB_2868552
Monoclonal anti-RAF1antibodies.cancer.govRRID: AB_2868554
Monoclonal anti-RAF1antibodies.cancer.govRRID: AB_2868551
Monoclonal anti-RAF1antibodies.cancer.govRRID: AB_2827856
Monoclonal anti-MAP2K1antibodies.cancer.govRRID: AB_2722079
Monoclonal anti-MTORantibodies.cancer.govRRID: AB_2722092
Monoclonal anti-MTORantibodies.cancer.govRRID: AB_2722091
Monoclonal anti-MTORantibodies.cancer.govRRID: AB_2722087
Monoclonal anti-MTORantibodies.cancer.govRRID: AB_2722090
Monoclonal anti-MTORantibodies.cancer.govRRID: AB_2722085
Monoclonal anti-MTORantibodies.cancer.govRRID: AB_2722085
Monoclonal anti-MTORantibodies.cancer.govRRID: AB_2722086
Monoclonal anti-MTORantibodies.cancer.govRRID: AB_2722086
Monoclonal anti-MTORantibodies.cancer.govRRID: AB_2722088
Monoclonal anti-MTORantibodies.cancer.govRRID: AB_2722085
Monoclonal anti-MTORantibodies.cancer.govRRID: AB_2722085
Monoclonal anti-MTORantibodies.cancer.govRRID: AB_2820270
Monoclonal anti-MTORantibodies.cancer.govRRID: AB_2820270
Monoclonal anti-GSK3Bantibodies.cancer.govRRID: AB_2722062
Monoclonal anti-GSK3Bantibodies.cancer.govRRID: AB_2722063
Monoclonal anti-GSK3Bantibodies.cancer.govRRID: AB_2722064
Monoclonal anti-GSK3Bantibodies.cancer.govRRID: AB_2722068
Monoclonal anti-GSK3Bantibodies.cancer.govRRID: AB_2827872
Monoclonal anti-MAPK1antibodies.cancer.govRRID: AB_2827852
Monoclonal anti-MAPK1antibodies.cancer.govRRID: AB_2827852
Monoclonal anti-MAPK1antibodies.cancer.govRRID: AB_2827852
Monoclonal anti-MAPK1antibodies.cancer.govRRID: AB_2827852
Monoclonal anti-MAPK3antibodies.cancer.govRRID: AB_2722081
Monoclonal anti-MAPK1antibodies.cancer.govRRID: AB_2827852
Monoclonal anti-MAPK1antibodies.cancer.govRRID: AB_2827852
Monoclonal anti-MAPK1antibodies.cancer.govRRID: AB_2827852
Monoclonal anti-MAPK1antibodies.cancer.govRRID: AB_2827852
Monoclonal anti-FOSantibodies.cancer.govRRID: AB_2722060
Monoclonal anti-FOSantibodies.cancer.govRRID: AB_2722061
Monoclonal anti-FOSantibodies.cancer.govRRID: AB_2722059
Monoclonal anti-EGFRantibodies.cancer.govRRID: AB_2722047
Monoclonal anti-EGFRantibodies.cancer.govRRID: AB_2722050
Monoclonal anti-EGFRantibodies.cancer.govRRID: AB_2722051
Monoclonal anti-EGFRantibodies.cancer.govRRID: AB_2722048
Monoclonal anti-EGFRantibodies.cancer.govRRID: AB_2827844
Monoclonal anti-EGFRantibodies.cancer.govRRID: AB_2827844
Monoclonal anti-EGFRantibodies.cancer.govRRID: AB_2827846
Monoclonal anti-EGFRantibodies.cancer.govRRID: AB_2827847
Monoclonal anti-EGFRantibodies.cancer.govRRID: AB_2827849
Monoclonal anti-ERBB2antibodies.cancer.govRRID: AB_2722052
Monoclonal anti-ERBB2antibodies.cancer.govRRID: AB_2722053
Monoclonal anti-ERBB2antibodies.cancer.govRRID: AB_2827851
Monoclonal anti-ERBB2antibodies.cancer.govRRID: AB_2722053
Monoclonal anti-ERBB3antibodies.cancer.govRRID: AB_2722054
Monoclonal anti-ERBB3antibodies.cancer.govRRID: AB_2722055
Monoclonal anti-ERBB3antibodies.cancer.govRRID: AB_2722057
Monoclonal anti-ERBB3antibodies.cancer.govRRID: AB_2722056
Monoclonal anti-CCND1antibodies.cancer.govRRID: AB_2722036
Monoclonal anti-CCND1antibodies.cancer.govRRID: AB_2868550
Monoclonal anti-CCND1antibodies.cancer.govRRID: AB_2722033
Monoclonal anti-CCND1antibodies.cancer.govRRID: AB_2722031
Monoclonal anti-CCND1antibodies.cancer.govRRID: AB_2722032
Monoclonal anti-RPTORantibodies.cancer.govRRID: AB_2722104
Monoclonal anti-RPTORantibodies.cancer.govRRID: AB_2722103
anti-Pan AKTCell Signalingcat#2920; RRID: AB_1147620
anti-P-AKT S473Cell Signalingcat#4060; RRID: AB_2315049
anti-Pan MEKCell Signalingcat#4694; RRID: AB_10695868
anti-P-MEK S217/221Cell Signalingcat#9154; RRID: AB_2138017
anti-Erk 1/2Cell Signalingcat#4696; RRID: AB_390780
anti-P-ERK 1/2Cell Signalingcat#9101; RRID: AB_331646
anti-EGFRCell Signalingcat#2646; RRID: AB_2230881
anti-P-EGFR Y1068Cell Signalingcat#3777; RRID: AB_2096270
anti-PTENCell Signalingcat#9559; RRID: AB_390810
anti-AKT3Cell Signalingcat#4059; RRID: AB_2225351
anti-CCND1Cell Signalingcat#2978; RRID: AB_10699151
anti-ERBB2Cell Signalingcat#4290; RRID: AB_10557104
anti-P-CTNNB1 S552Cell Signalingcat#5651; RRID: AB_10831053
anti-N-CadherinCell Signalingcat#13116; RRID: AB_2687616
anti-P-GSK3B S9Cell Signalingcat#5585; RRID: AB_10706782
anti-E-CadherinCell Signalingcat#3195; RRID: AB_2291471
anti-CRAFCell Signalingcat#53745; RRID: AB_2799444
anti-P-PRAS40 T246Cell Signalingcat#13175; RRID: AB_2798140
anti-RSK1Cell Signalingcat#9333; RRID: AB_2181177
anti-VinculinCell Signalingcat#13901; RRID: AB_2728768
anti-Erbb3Cell Signalingcat#12708; RRID: AB_2721919
anti-stat3Cell Signalingcat#9139; RRID: AB_331757
anti-eIF2alphaCell Signalingcat#2103; RRID: AB_836874
anti-B-RafCell Signalingcat#14814; RRID: AB_2750887
anti-C-RafCell Signalingcat#53745; RRID: AB_2799444
anti-A-RafCell Signalingcat#4432; RRID: AB_330813
anti-P-p90RSK T359/s363Cell Signalingcat#9344; RRID: AB_331650
anti-P-c-Raf S338Cell Signalingcat#9427; RRID: AB_2067317

Chemicals, peptides, and recombinant proteins

Stable Isotope Labeled Synthetic PeptidesNew England PeptideCustom by sequence

Critical commercial assays

CellTiter-Glo® Luminescent Cell ViabilityPromegaG7570

Deposited data

Raw DataPanoramaWebhttps://panoramaweb.org/NmDXGW.url

Experimental models: cell lines

HCT116ATCCCCL-247
HT29ATCCHTB-38
A375ATCCCRL-1619
SKMEL2ATCCHTB-68
MRM assays
AKT1_FFAGIVWQHVYEK_directassays.cancer.govnon-CPTAC-5528
AKT1_FYGAEIVSALDYLHSEK_directassays.cancer.govnon-CPTAC-5328
AKT1_RPHFPQFSYSASGTA_directassays.cancer.govnon-CPTAC-5332
AKT1_SLLSGLLK_directassays.cancer.govnon-CPTAC-5527
AKT2_EGISDGATMK_directassays.cancer.govnon-CPTAC-5335
AKT2_FYGAEIVSALEYLHSR_directassays.cancer.govnon-CPTAC-5334
AKT2_LLPPFKPQVTSEVDTR_directassays.cancer.govnon-CPTAC-5529
AKT2_SLLAGLLK_directassays.cancer.govnon-CPTAC-5336
AKT2_THFPQFSYSASIRE_directassays.cancer.govnon-CPTAC-5338
AKT2_THFPQFSYSASIR_directassays.cancer.govnon-CPTAC-5339
AKT3_DEVAHTLTESR_directassays.cancer.govnon-CPTAC-5530
AKT3_EGITDAATMK_directassays.cancer.govnon-CPTAC-5531
AKT3_FYGAEIVSALDYLHSGK_directassays.cancer.govnon-CPTAC-5342
AKT3_RPHFPQFSYSASGR_directassays.cancer.govnon-CPTAC-5344
AKT3_RPHFPQFSYSASGRE_directassays.cancer.govnon-CPTAC-5345
AKT3_TDGSFIGYK_directassays.cancer.govnon-CPTAC-5340
CDH1_GLDARPEVTR_directassays.cancer.govnon-CPTAC-5542
CDH1_GQVPENEANVVITTLK_directassays.cancer.govnon-CPTAC-5541
CDH1_NDVAPTLMSVPR_directassays.cancer.govnon-CPTAC-5370
CDH1_NTGVISVVTTGLDR_directassays.cancer.govnon-CPTAC-5367
CDH1_TAYFSLDTR_directassays.cancer.govnon-CPTAC-5366
CDH2_GPFPQELVR_directassays.cancer.govnon-CPTAC-5371
CDH2_IDPVNGQITTIAVLDR_directassays.cancer.govnon-CPTAC-5373
CDH2_LNGDFAQLNLK_directassays.cancer.govnon-CPTAC-5374
CDH2_LSDPANWLK_directassays.cancer.govnon-CPTAC-5543
CDH2_SAAPHPGDIGDFINEGLK_directassays.cancer.govnon-CPTAC-5544
CTNNB1_RTSMGGTQQQFVEGVR_directassays.cancer.govnon-CPTAC-3265
PTEN_AQEALDFYGEVR_directassays.cancer.govnon-CPTAC-5566
PTEN_GVTIPSQR_directassays.cancer.govnon-CPTAC-5567
PTEN_IYSSNSGPTR_directassays.cancer.govnon-CPTAC-5430
PTEN_NHLDYRPVALLFHK_directassays.cancer.govnon-CPTAC-5429
ARAF_DSGYYWEVPPSEVQLLK_directassays.cancer.govnon-CPTAC-5348
ARAF_NLGYRDSGYYWEVPPSEVQLLK_directassays.cancer.govnon-CPTAC-5347
ARAF_IGTGSFGTVFR_directassays.cancer.govnon-CPTAC-5533
ARAF_VSQPTAEQAQAFK_directassays.cancer.govnon-CPTAC-5350
BRAF_GDGGSTTGLSATPPASLPGSLTNVK_directassays.cancer.govnon-CPTAC-5353
BRAF_RDSSDDWEIPDGQITVGQR_directassays.cancer.govnon-CPTAC-5354
BRAF_DSSDDWEIPDGQITVGQR_directassays.cancer.govnon-CPTAC-5355
BRAF_SNNIFLHEDLTVK_directassays.cancer.govnon-CPTAC-5356
RAF1_DSSYYWEIEASEVMLSTR_directassays.cancer.govnon-CPTAC-5433
RAF1_GYASPDLSK_directassays.cancer.govnon-CPTAC-5570
RAF1_STSTPNVHMVSTTLPVDSR_directassays.cancer.govnon-CPTAC-5432
RAF1_VVDPTPEQFQAFR_directassays.cancer.govnon-CPTAC-5569
MAP2K1_IPEQILGK_directassays.cancer.govnon-CPTAC-5411
MAP2K1_ISELGAGNGGVVFK_directassays.cancer.govnon-CPTAC-5557
MAP2K1_VSHKPSGLVMAR_directassays.cancer.govnon-CPTAC-5410
MTOR_DLELAVPGTYDPNQPIIR_directassays.cancer.govnon-CPTAC-5563
MTOR_IQSIAPSLQVITSK_directassays.cancer.govnon-CPTAC-5421
MTOR_LFDAPEAPLPSR_directassays.cancer.govnon-CPTAC-5561
MTOR_LTESLDFTDYASR_directassays.cancer.govnon-CPTAC-5562
MTOR_TDSYSAGQSVEILDGVELGEPAHK_directassays.cancer.govnon-CPTAC-5423
MTOR_TRTDSYSAGQSVEILDGVELGEPAHK_directassays.cancer.govnon-CPTAC-5422
MTOR_TGTTVPESIHSFIGDGLVKPEALNK_directassays.cancer.govnon-CPTAC-5424
MTOR_TGTTVPESIHSFIGDGLVKPEALNKK_directassays.cancer.govnon-CPTAC-5425
MTOR_VLGLLGALDPYK_directassays.cancer.govnon-CPTAC-5560
GSK3B_LLEYTPTAR_directassays.cancer.govnon-CPTAC-5556
GSK3B_QTLPVIYVK_directassays.cancer.govnon-CPTAC-5403
GSK3B_VIGNGSFGVVYQAK_directassays.cancer.govnon-CPTAC-5554
MAPK3_ALDLLDR_directassays.cancer.govnon-CPTAC-5559
MAPK3_GQPFDVGPR_directassays.cancer.govnon-CPTAC-5412
MAPK3_IADPEHDHTGFLTEYVATR_directassays.cancer.govnon-CPTAC-5414
MAPK3_NYLQSLPSK_directassays.cancer.govnon-CPTAC-5415
FOS_APHPFGVPAPSAGAYSR_directassays.cancer.govnon-CPTAC-5551
FOS_GSSSNEPSSDSLSSPTLLAL_directassays.cancer.govnon-CPTAC-5553
FOS_LEFILAAHR_directassays.cancer.govnon-CPTAC-5398
FOS_SALQTEIANLLK_directassays.cancer.govnon-CPTAC-5397
FOS_TEPFDDFLFPASSR_directassays.cancer.govnon-CPTAC-5552
EGFR_GSHQISLDNPDYQQDFFPK_directassays.cancer.govnon-CPTAC-5381
EGFR_GSTAENAEYLR_directassays.cancer.govnon-CPTAC-5382
EGFR_IPLENLQIIR_directassays.cancer.govnon-CPTAC-5545
EGFR_NLQEILHGAVR_directassays.cancer.govnon-CPTAC-5546
EGFR_YSSDPTGALTEDSIDDTFLPVPEYINQSVPK_directassays.cancer.govnon-CPTAC-5380
ERBB2_ELVSEFSR_directassays.cancer.govnon-CPTAC-5385
ERBB2_GIWIPDGENVK_directassays.cancer.govnon-CPTAC-5547
ERBB2_GTPTAENPEYLGLDVPV_directassays.cancer.govnon-CPTAC-5386
ERBB2_LLDIDETEYHADGGK_directassays.cancer.govnon-CPTAC-5384
ERBB3_ANDALQVLGLLFSLAR_directassays.cancer.govnon-CPTAC-5387
ERBB3_GDSAYHSQR_directassays.cancer.govnon-CPTAC-5390
ERBB3_LTFQLEPNPHTK_directassays.cancer.govnon-CPTAC-5548
ERBB3_SLEATDSAFDNPDYWHSR_directassays.cancer.govnon-CPTAC-5550
ERBB3_YLERGESIEPLDPSEK_directassays.cancer.govnon-CPTAC-5549
CCND1_AYPDANLLNDR_directassays.cancer.govnon-CPTAC-5536
CCND1_FLSLEPVKK_directassays.cancer.govnon-CPTAC-5538
CCND1_FLSLEPVK_directassays.cancer.govnon-CPTAC-5360
RPTOR_ALETIGANLQK_directassays.cancer.govnon-CPTAC-5441
RPTOR_SLIVAGLGDGSIR_directassays.cancer.govnon-CPTAC-5445
RPTOR_VLDTSSLTQSAPASPTNK_directassays.cancer.govnon-CPTAC-5444
RPTOR_VLNSIAYK_directassays.cancer.govnon-CPTAC-5443
RASGRF1_LLYGEPPKSPR_directassays.cancer.govnon-CPTAC-5438
RASGRF1_NSLDYAK_directassays.cancer.govnon-CPTAC-5436
RASGRF1_SLELLFASGQNNK_directassays.cancer.govnon-CPTAC-5437
EIF2A_SPDLAPTPAPQSTPR_directassays.cancer.govnon-CPTAC-5377
FOXO3_AVSMDNSNK_directassays.cancer.govnon-CPTAC-5392
FOXO3_AVSMDNSNKYTK_directassays.cancer.govnon-CPTAC-5394
MAPK8_TAGTSFMMTPYVVTR_directassays.cancer.govnon-CPTAC-5407
RPS6KA1_GFSFVATGLMEDDGKPR_directassays.cancer.govnon-CPTAC-5446
AKT1S1_LNTSDFQK_directassays.cancer.govnon-CPTAC-5333
AKT1_RPHFPQFS[+80]YSASGTA_S473_IMACassays.cancer.govnon-CPTAC-5720
AKT1_T[+80]FC[+57]GTPEYLAPEVLEDNDYGR_T308_IMACassays.cancer.govnon-CPTAC-5719
AKT2_THFPQFS[+80]YSASIRE_S473_IMACassays.cancer.govnon-CPTAC-5718
AKT2_THFPQFS[+80]YSASIR_S473_IMACassays.cancer.govnon-CPTAC-5717
AKT3_RPHFPQFS[+80]YSASGR_S472_IMACassays.cancer.govnon-CPTAC-5693
AKT3_RPHFPQFS[+80]YSASGRE_S472_IMACassays.cancer.govnon-CPTAC-5692
CTNNB1_TS[+80]MGGTQQQFVEGVR_S552_IMACassays.cancer.govnon-CPTAC-5715
CTNNB1_RTS[+80]MGGTQQQFVEGVR_S552_IMACassays.cancer.govnon-CPTAC-5716
ARAF_DS[+80]GYYWEVPPSEVQLLK_S299_IMACassays.cancer.govnon-CPTAC-5730
ARAF_NLGYRDS[+80]GYYWEVPPSEVQLLK_S299_IMACassays.cancer.govnon-CPTAC-5731
BRAF_GDGGSTTGLSAT[+80]PPASLPGSLTNVK_T401_IMACassays.cancer.govnon-CPTAC-5729
BRAF_DS[+80]SDDWEIPDGQITVGQR_S446_IMACassays.cancer.govnon-CPTAC-5727
BRAF_RDS[+80]SDDWEIPDGQITVGQR_S446_IMACassays.cancer.govnon-CPTAC-5728
RAF1_STS[+80]TPNVHMVSTTLPVDSR_S259_IMACassays.cancer.govnon-CPTAC-5734
MAP2K2_LC[+57]DFGVSGQLIDS[+80]MANSFVGTR_S221_IMACassays.cancer.govnon-CPTAC-5704
MTOR_TDS[+80]YSAGQSVEILDGVELGEPAHK_S2448_IMACassays.cancer.govnon-CPTAC-5711
MTOR_TRTDS[+80]YSAGQSVEILDGVELGEPAHK_S2448_IMACassays.cancer.govnon-CPTAC-5712
MTOR_TGTTVPESIHS[+80]FIGDGLVKPEALNK_S2481_IMACassays.cancer.govnon-CPTAC-5709
MTOR_TGTTVPESIHS[+80]FIGDGLVKPEALNKK_S2481_IMACassays.cancer.govnon-CPTAC-5710
GSK3B_TTS[+80]FAESC[+57]KPVQQPSAFGSMK_S9_IMACassays.cancer.govnon-CPTAC-5705
MAPK1_VADPDHDHTGFLT[+80]EY[+80]VATR_T185/Y187_IMACassays.cancer.govnon-CPTAC-5723
MAPK1_VADPDHDHTGFLT[+80]EYVATR_T185_IMACassays.cancer.govnon-CPTAC-5721
MAPK1_VADPDHDHTGFLTEY[+80]VATR_Y187_IMACassays.cancer.govnon-CPTAC-5722
MAPK3_IADPEHDHTGFLT[+80]EY[+80]VATR_T202/Y204_IMACassays.cancer.govnon-CPTAC-5726
MAPK3_IADPEHDHTGFLT[+80]EYVATR_T202_IMACassays.cancer.govnon-CPTAC-5724
MAPK3_IADPEHDHTGFLTEY[+80]VATR_Y204_IMACassays.cancer.govnon-CPTAC-5725
EGFR_Y[+80]SSDPTGALTEDSIDDTFLPVPEYINQSVPK_Y1045_IMACassays.cancer.govnon-CPTAC-5738
EGFR_YSSDPTGALTEDSIDDTFLPVPEY[+80]INQSVPK_Y1068_IMACassays.cancer.govnon-CPTAC-5735
EGFR_GSHQISLDNPDY[+80]QQDFFPK_Y1148_IMACassays.cancer.govnon-CPTAC-5737
EGFR_GSTAENAEY[+80]LR_Y1173_IMACassays.cancer.govnon-CPTAC-5736
ERBB2_GTPTAENPEY[+80]LGLDVPV_Y1248_IMACassays.cancer.govnon-CPTAC-5732
ERBB2_LLDIDETEY[+80]HADGGK_Y877_IMACassays.cancer.govnon-CPTAC-5733
EIF2A_SPDLAPTPAPQST[+80]PR_T518_IMACassays.cancer.govnon-CPTAC-5694
EIF2A_SDKSPDLAPTPAPQST[+80]PR_T518_IMACassays.cancer.govnon-CPTAC-5695
EIF2A_S[+80]PDLAPTPAPQSTPR_T506_IMACassays.cancer.govnon-CPTAC-5696
EIF2A_SDKS[+80]PDLAPTPAPQSTPR_T506_IMACassays.cancer.govnon-CPTAC-5697
FOXO1_AAS[+80]MDNNSK_S256_IMACassays.cancer.govnon-CPTAC-5703
FOXO3_AVS[+80]MDNSNK_S253_IMACassays.cancer.govnon-CPTAC-5740
FOXO3_AVS[+80]MDNSNKYTK_S253_IMACassays.cancer.govnon-CPTAC-5739
MAPK8_TAGTSFMMT[+80]PY[+80]VVTR_T183/Y185_IMACassays.cancer.govnon-CPTAC-5708
MAPK8_TAGTSFMMT[+80]PYVVTR_T183_IMACassays.cancer.govnon-CPTAC-5706
MAPK8_TAGTSFMMTPY[+80]VVTR_Y185_IMACassays.cancer.govnon-CPTAC-5707
MAPK14_HTDDEMT[+80]GY[+80]VATR_T180/Y182_IMACassays.cancer.govnon-CPTAC-5699
MAPK14_HTDDEMT[+80]GYVATR_T180_IMACassays.cancer.govnon-CPTAC-5701
MAPK14_HTDDEMTGY[+80]VATR_Y182_IMACassays.cancer.govnon-CPTAC-5700
RPS6KA1_GFS[+80]FVATGLMEDDGKPR_S380_IMACassays.cancer.govnon-CPTAC-5702
AKT1S1_LNT[+80]SDFQK_T246_IMACassays.cancer.govnon-CPTAC-5698
STAT3_FIC[+57]VTPTTC[+57]SNTIDLPMS[+80]PR_S727_IMACassays.cancer.govnon-CPTAC-5713
STAT3_YC[+57]RPESQEHPEADPGSAAPY[+80]LK_Y705_IMACassays.cancer.govnon-CPTAC-5714
AKT1_FFAGIVWQHVYEK_immunoassays.cancer.govCPTAC-5758
AKT1_RPHFPQFSYSASGTA_immunoassays.cancer.govCPTAC-5806
AKT1_SLLSGLLK_immunoassays.cancer.govCPTAC-5759
AKT1_TFC[+57]GTPEYLAPEVLEDNDYGR_immunoassays.cancer.govCPTAC-5808
AKT1_RPHFPQFS[+80]YSASGTA_S473_immunoassays.cancer.govCPTAC-5805
AKT1_T[+80]FC[+57]GTPEYLAPEVLEDNDYGR_T308_immunoassays.cancer.govCPTAC-5807
AKT2_THFPQFS[+80]YSASIRE_S473_immunoassays.cancer.govCPTAC-5804
AKT2_THFPQFS[+80]YSASIR_S473_immunoassays.cancer.govCPTAC-5802
AKT2_LLPPFKPQVTSEVDTR_immunoassays.cancer.govCPTAC-5757
AKT2_THFPQFSYSASIRE_immunoassays.cancer.govCPTAC-5803
AKT2_THFPQFSYSASIR_immunoassays.cancer.govCPTAC-5801
AKT3_EGITDAATMK_immunoassays.cancer.govCPTAC-5742
AKT3_RPHFPQFSYSASGR_immunoassays.cancer.govCPTAC-5788
AKT3_RPHFPQFSYSASGRE_immunoassays.cancer.govCPTAC-5786
AKT3_RPHFPQFS[+80]YSASGR_S472_immunoassays.cancer.govCPTAC-5789
AKT3_RPHFPQFS[+80]YSASGRE_S472_immunoassays.cancer.govCPTAC-5787
CDH1_GLDARPEVTR_immunoassays.cancer.govCPTAC-5772
CDH1_GQVPENEANVVITTLK_immunoassays.cancer.govCPTAC-5773
CDH2_LSDPANWLK_immunoassays.cancer.govCPTAC-5770
CDH2_SAAPHPGDIGDFINEGLK_immunoassays.cancer.govCPTAC-5769
PTEN_AQEALDFYGEVR_immunoassays.cancer.govCPTAC-5747
PTEN_GVTIPSQR_immunoassays.cancer.govCPTAC-5746
PTEN_IYNLC[+57]AER_immunoassays.cancer.govCPTAC-5748
ARAF_DSGYYWEVPPSEVQLLK_immunoassays.cancer.govCPTAC-5823
ARAF_NLGYRDSGYYWEVPPSEVQLLK_immunoassays.cancer.govCPTAC-5825
ARAF_GLNQDC[+57]C[+57]VVYR_immunoassays.cancer.govCPTAC-5776
ARAF_IGTGSFGTVFR_immunoassays.cancer.govCPTAC-5775
ARAF_TQADELPAC[+57]LLSAAR_immunoassays.cancer.govCPTAC-5774
ARAF_DS[+80]GYYWEVPPSEVQLLK_S299_immunoassays.cancer.govCPTAC-5824
ARAF_NLGYRDS[+80]GYYWEVPPSEVQLLK_S299_immunoassays.cancer.govCPTAC-5826
BRAF_GDGGSTTGLSATPPASLPGSLTNVK_immunoassays.cancer.govCPTAC-5821
BRAF_GLIPEC[+57]C[+57]AVYR_immunoassays.cancer.govCPTAC-5771
BRAF_RDSSDDWEIPDGQITVGQR_immunoassays.cancer.govCPTAC-5820
BRAF_DSSDDWEIPDGQITVGQR_immunoassays.cancer.govCPTAC-5818
BRAF_GDGGSTTGLSAT[+80]PPASLPGSLTNVK_T401_immunoassays.cancer.govCPTAC-5822
BRAF_DS[+80]SDDWEIPDGQITVGQR_S446_immunoassays.cancer.govCPTAC-5817
BRAF_RDS[+80]SDDWEIPDGQITVGQR_S446_immunoassays.cancer.govCPTAC-5819
RAF1_GLQPEC[+57]C[+57]AVFR_immunoassays.cancer.govCPTAC-5780
RAF1_GYASPDLSK_immunoassays.cancer.govCPTAC-5778
RAF1_STSTPNVHMVSTTLPVDSR_immunoassays.cancer.govCPTAC-5828
RAF1_VVDPTPEQFQAFR_immunoassays.cancer.govCPTAC-5779
RAF1_STS[+80]TPNVHMVSTTLPVDSR_S259_immunoassays.cancer.govCPTAC-5829
MAP2K1_ISELGAGNGGVVFK_immunoassays.cancer.govCPTAC-5745
MTOR_DLELAVPGTYDPNQPIIR_immunoassays.cancer.govCPTAC-5753
MTOR_IQSIAPSLQVITSK_immunoassays.cancer.govCPTAC-5752
MTOR_LFDAPEAPLPSR_immunoassays.cancer.govCPTAC-5755
MTOR_LTESLDFTDYASR_immunoassays.cancer.govCPTAC-5754
MTOR_TDSYSAGQSVEILDGVELGEPAHK_immunoassays.cancer.govCPTAC-5797
MTOR_TRTDSYSAGQSVEILDGVELGEPAHK_immunoassays.cancer.govCPTAC-5799
MTOR_TGTTVPESIHSFIGDGLVKPEALNK_immunoassays.cancer.govCPTAC-5794
MTOR_TGTTVPESIHSFIGDGLVKPEALNKK_immunoassays.cancer.govCPTAC-5796
MTOR_VLGLLGALDPYK_immunoassays.cancer.govCPTAC-5756
MTOR_TDS[+80]YSAGQSVEILDGVELGEPAHK_S2448_immunoassays.cancer.govCPTAC-5798
MTOR_TRTDS[+80]YSAGQSVEILDGVELGEPAHK_S2448_immunoassays.cancer.govCPTAC-5800
MTOR_TGTTVPESIHS[+80]FIGDGLVKPEALNK_S2481_immunoassays.cancer.govCPTAC-5793
MTOR_TGTTVPESIHS[+80]FIGDGLVKPEALNKK_S2481_immunoassays.cancer.govCPTAC-5795
GSK3B_LLEYTPTAR_immunoassays.cancer.govCPTAC-5749
GSK3B_TPPEAIALC[+57]SR_immunoassays.cancer.govCPTAC-5750
GSK3B_TTSFAESC[+57]KPVQQPSAFGSMK_immunoassays.cancer.govCPTAC-5790
GSK3B_VIGNGSFGVVYQAK_immunoassays.cancer.govCPTAC-5751
GSK3B_TTS[+80]FAESC[+57]KPVQQPSAFGSMK_S9_immunoassays.cancer.govCPTAC-5791
MAPK1_VADPDHDHTGFLT[+80]EY[+80]VATR_T185/Y187_immunoassays.cancer.govCPTAC-5812
MAPK1_VADPDHDHTGFLT[+80]EYVATR_T185_immunoassays.cancer.govCPTAC-5809
MAPK1_VADPDHDHTGFLTEY[+80]VATR_Y187_immunoassays.cancer.govCPTAC-5810
MAPK1_VADPDHDHTGFLTEYVATR_immunoassays.cancer.govCPTAC-5811
MAPK3_ALDLLDR_immunoassays.cancer.govCPTAC-5760
MAPK3_IADPEHDHTGFLTEYVATR_immunoassays.cancer.govCPTAC-5813
MAPK3_IADPEHDHTGFLT[+80]EY[+80]VATR_T202/Y204_immunoassays.cancer.govCPTAC-5814
MAPK3_IADPEHDHTGFLT[+80]EYVATR_T202_immunoassays.cancer.govCPTAC-5816
MAPK3_IADPEHDHTGFLTEY[+80]VATR_Y204_immunoassays.cancer.govCPTAC-5815
FOS_APHPFGVPAPSAGAYSR_immunoassays.cancer.govCPTAC-5783
FOS_GSSSNEPSSDSLSSPTLLAL_immunoassays.cancer.govCPTAC-5781
FOS_TEPFDDFLFPASSR_immunoassays.cancer.govCPTAC-5782
EGFR_GSHQISLDNPDYQQDFFPK_immunoassays.cancer.govCPTAC-5831
EGFR_IPLENLQIIR_immunoassays.cancer.govCPTAC-5785
EGFR_NLQEILHGAVR_immunoassays.cancer.govCPTAC-5784
EGFR_YSSDPTGALTEDSIDDTFLPVPEYINQSVPK_immunoassays.cancer.govCPTAC-5834
EGFR_Y[+80]SSDPTGALTEDSIDDTFLPVPEYINQSVPK_Y1045_immunoassays.cancer.govCPTAC-5835
EGFR_YSSDPTGALTEDSIDDTFLPVPEY[+80]INQSVPK_Y1068_immunoassays.cancer.govCPTAC-5833
EGFR_GSHQISLDNPDY[+80]QQDFFPK_Y1148_immunoassays.cancer.govCPTAC-5832
EGFR_GSTAENAEY[+80]LR_Y1173_immunoassays.cancer.govCPTAC-5830
ERBB2_GIWIPDGENVK_immunoassays.cancer.govCPTAC-5777
ERBB2_GTPTAENPEY[+80]LGLDVPV_Y1248_immunoassays.cancer.govCPTAC-5827
ERBB3_LTFQLEPNPHTK_immunoassays.cancer.govCPTAC-5768
ERBB3_SLEATDSAFDNPDYWHSR_immunoassays.cancer.govCPTAC-5766
ERBB3_YLERGESIEPLDPSEK_immunoassays.cancer.govCPTAC-5767
CCND1_AC[+57]QEQIEALLESSLR_immunoassays.cancer.govCPTAC-5761
CCND1_AEETC[+57]APSVSYFK_immunoassays.cancer.govCPTAC-5764
CCND1_AYPDANLLNDR_immunoassays.cancer.govCPTAC-5765
CCND1_FLSLEPVKK_immunoassays.cancer.govCPTAC-5763
CCND1_VIKC[+57]DPDC[+57]LR_immunoassays.cancer.govCPTAC-5762
RPTOR_ALETIGANLQK_immunoassays.cancer.govCPTAC-5744
RPTOR_SYNC[+57]TPVSSPR_immunoassays.cancer.govCPTAC-5743
FOXO3_AVS[+80]MDNSNKYTK_S253_immunoassays.cancer.govCPTAC-5836
MAPK8_TAGTSFMMTPY[+80]VVTR_Y185_immunoassays.cancer.govCPTAC-5792
  73 in total

1.  Evaluation of large scale quantitative proteomic assay development using peptide affinity-based mass spectrometry.

Authors:  Jeffrey R Whiteaker; Lei Zhao; Susan E Abbatiello; Michael Burgess; Eric Kuhn; ChenWei Lin; Matthew E Pope; Morteza Razavi; N Leigh Anderson; Terry W Pearson; Steven A Carr; Amanda G Paulovich
Journal:  Mol Cell Proteomics       Date:  2011-01-18       Impact factor: 5.911

2.  CPTAC Assay Portal: a repository of targeted proteomic assays.

Authors:  Jeffrey R Whiteaker; Goran N Halusa; Andrew N Hoofnagle; Vagisha Sharma; Brendan MacLean; Ping Yan; John A Wrobel; Jacob Kennedy; D R Mani; Lisa J Zimmerman; Matthew R Meyer; Mehdi Mesri; Henry Rodriguez; Amanda G Paulovich
Journal:  Nat Methods       Date:  2014-07       Impact factor: 28.547

3.  Basal and treatment-induced activation of AKT mediates resistance to cell death by AZD6244 (ARRY-142886) in Braf-mutant human cutaneous melanoma cells.

Authors:  Y N Vashisht Gopal; Wanleng Deng; Scott E Woodman; Kakajan Komurov; Prahlad Ram; Paul D Smith; Michael A Davies
Journal:  Cancer Res       Date:  2010-10-19       Impact factor: 12.701

Review 4.  Ras signaling and therapies.

Authors:  Amy Young; Jesse Lyons; Abigail L Miller; Vernon T Phan; Irma Rangel Alarcón; Frank McCormick
Journal:  Adv Cancer Res       Date:  2009       Impact factor: 6.242

5.  Commercially available antibodies can be applied in quantitative multiplexed peptide immunoaffinity enrichment targeted mass spectrometry assays.

Authors:  Regine M Schoenherr; Lei Zhao; Richard G Ivey; Uliana J Voytovich; Jacob Kennedy; Ping Yan; Chenwei Lin; Jeffrey R Whiteaker; Amanda G Paulovich
Journal:  Proteomics       Date:  2016-05-23       Impact factor: 3.984

Review 6.  The evolving role of mass spectrometry in cancer biomarker discovery.

Authors:  Pei Wang; Jeffrey R Whiteaker; Amanda G Paulovich
Journal:  Cancer Biol Ther       Date:  2009-06-06       Impact factor: 4.742

Review 7.  Targeting RAS signalling pathways in cancer therapy.

Authors:  Julian Downward
Journal:  Nat Rev Cancer       Date:  2003-01       Impact factor: 60.716

8.  Patterns of substrate affinity, competition, and degradation kinetics underlie biological activity of thalidomide analogs.

Authors:  Adam S Sperling; Michael Burgess; Hasmik Keshishian; Jessica A Gasser; Shruti Bhatt; Max Jan; Mikołaj Słabicki; Rob S Sellar; Emma C Fink; Peter G Miller; Brian J Liddicoat; Quinlan L Sievers; Rohan Sharma; Dylan N Adams; Elyse A Olesinski; Mariateresa Fulciniti; Namrata D Udeshi; Eric Kuhn; Anthony Letai; Nikhil C Munshi; Steven A Carr; Benjamin L Ebert
Journal:  Blood       Date:  2019-05-01       Impact factor: 25.476

9.  Impact of feedback phosphorylation and Raf heterodimerization on normal and mutant B-Raf signaling.

Authors:  Daniel A Ritt; Daniel M Monson; Suzanne I Specht; Deborah K Morrison
Journal:  Mol Cell Biol       Date:  2009-11-23       Impact factor: 4.272

Review 10.  Mechanism and consequences of RAF kinase activation by small-molecule inhibitors.

Authors:  M Holderfield; T E Nagel; D D Stuart
Journal:  Br J Cancer       Date:  2014-03-18       Impact factor: 7.640

View more
  1 in total

1.  Targeted Mass Spectrometry Enables Multiplexed Quantification of Immunomodulatory Proteins in Clinical Biospecimens.

Authors:  Jeffrey R Whiteaker; Rachel A Lundeen; Lei Zhao; Regine M Schoenherr; Aura Burian; Dongqing Huang; Ulianna Voytovich; Tao Wang; Jacob J Kennedy; Richard G Ivey; Chenwei Lin; Oscar D Murillo; Travis D Lorentzen; Mathangi Thiagarajan; Simona Colantonio; Tessa W Caceres; Rhonda R Roberts; Joseph G Knotts; Joshua J Reading; Jan A Kaczmarczyk; Christopher W Richardson; Sandra S Garcia-Buntley; William Bocik; Stephen M Hewitt; Karen E Murray; Nhan Do; Mary Brophy; Stephen W Wilz; Hongbo Yu; Samuel Ajjarapu; Emily Boja; Tara Hiltke; Henry Rodriguez; Amanda G Paulovich
Journal:  Front Immunol       Date:  2021-11-11       Impact factor: 8.786

  1 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.