Literature DB >> 34630590

Designing of RNA Molecule Translating for Activitable Melittin as Selective Targeting of Leishmania Infected Cells.

Soheila Akhzari1, Sedigheh Nabian1, Parviz Shayan1, Ramin Mazaheri Nezhad Fard2, Minoo Soltani3, Mohammad Taheri4.   

Abstract

BACKGROUND: Leishmaniasis is characterized by strong inflammatory responses with high levels of inflammatory cytokines that induce microRNA 21 and matrix metalloproteinases. Melittin has inhibitory effects on proliferation of various cells via induction of apoptosis. Melittin can be integrated in cell membranes and induce apoptosis. Thus, designation of biomolecules for the selective destroy of the infected cells is a treatment option. One approach is the precise engineering of constructs for the selective expression of melittin in the infected cells.
METHODS: For this aim we designed a construct composing melittin nucleotide sequence and nucleotide sequence coding for polyanionic peptide function inhibitory element to further guarantee the selective function of melittin in inflamed tissues and infected cells, were included in a construct as melittin inhibitor via matrix metalloproteinase degradable linker.
RESULTS: Reverse complementary sequences were designed so melittin sequences for the selective targeting of Leishmania could be expressed in infected cells using cell microRNA machinery.
CONCLUSION: Translation machinery in infected cells with increased miR-21 could translate melittin, MMP linker and polyanionic inhibitor through a non-canonical pathway. Then, the MMP linker is degraded and selective killing of Leishmania infected cells would happen.
Copyright © 2021 Akhzari et al. Published by Tehran University of Medical Sciences.

Entities:  

Keywords:  Leishmania spp.; Melittin; RNA design; miR-21; microRNA machinery

Year:  2021        PMID: 34630590      PMCID: PMC8476729          DOI: 10.18502/ijpa.v16i3.7098

Source DB:  PubMed          Journal:  Iran J Parasitol        ISSN: 1735-7020            Impact factor:   1.012


Introduction

Leishmaniasis is a major problem in developed and undeveloped countries. Leishmania parasites are obligatory intracellular protozoa living in macrophages of humans and other vertebrates. The prolonged course of Leishmania infection potentially reflects molecular defects in host immune responses (1). Despite remarkable progresses in understanding molecular biology of Leishmania and introducing experimental chemotherapeutic agents, a few drugs have been developed for the treatment of leishmaniasis (2). Most of the commonly used antileishmanial drugs such as pentavalent antimonial agents include high toxicities and severe side effects. Furthermore, clinical drug resistance is largely reported in the parasite that drug resistance is a fundamental determinant of treatment failure (2). Therefore, more effective therapeutic agents are needed to improve antileishmanial treatments. In fact, cell penetrating peptides such as melittin can be used as alternative drugs for the treatment of leishmaniasis. Melittin is a 26-amino acid (AA) peptide with no disulfide bridges. The N-terminal of the molecule is predominantly hydrophobic while the C-terminal is hydrophilic and strongly basic. Melittin forms tetramers in water and can be integrated in cell membranes (CMs). Melittin binds parallel to CMs at low concentrations and shifts to perpendicular orientation at high concentrations, resulting in pore formation (3). Melittin includes inhibitory effects on proliferation of various cancer cells via induction of apoptosis, necrosis or lysis. Moreover, increased concentration and incubation time of the peptide can increase cytotoxicity of the melittin. Based on the flow cytometric analyses, melittin at concentrations of 1 and 1.8 μg ml−1 induces apoptosis in HeLa cells after 24 h of incubation while melittin at concentrations of 4 μg ml−1 induces late apoptosis and necrosis of the cells (4). Melittin has no significant hemolytic activities at concentrations lower than 0.25 μg ml−1. However, 90% hemolysis of human RBCs has been reported at melittin concentrations greater than 1 μg ml−1 (5). Therefore, to avoid the undesirable function of melittin, in this study we designed a molecular construct with melittin sequences for the selective targeting of Leishmania infected cells and regulation of melittin production using cell microRNA machinery.

Materials and Methods

Cell culture

In order to investigate the effect of melittin on cell line, CHO cell line was purchased from the Pasteur Institute of Iran Cell Bank (Tehran, Iran). CHO cells were cultured in RPMI-1640 medium supplemented with 10% FBS, penicillin 100 unit/mL, and streptomycin 100 mg ml−1. Cultures were maintained at 37 °C in a humidified atmosphere of 5% CO2 and 95% air.

Construction for adjustable melittin production

Normally, RNA viruses such as encephalomyocarditis virus (ECMV) use internal ribosomal entry site (IRES) dependent translation of proteins to subvert ribosomes from canonical eukaryotic cap-dependent translation. The J-K region of ECMV IRES interacts with HEAT-1 domain of the eukaryotic translation initiation factor 4 G (eIF4G) and captures initiation factors to assemble initiation complexes (Fig. 1) (6).
Fig. 1:

The RNA folding prediction. a) MFE of J-K region of ECMV IRES sequences, -46 kcal mol−1 b) MFE of the J-K region of ECMV IRES with reverse complementary sequences, -127.60 kcal mol-1

The RNA folding prediction. a) MFE of J-K region of ECMV IRES sequences, -46 kcal mol−1 b) MFE of the J-K region of ECMV IRES with reverse complementary sequences, -127.60 kcal mol-1 In the current study, a reverse complementary (RC) was designed for the J-K region of ECMV IRES to modulate folding of ECMV IRES RNA and help fine tuning regulation of the melittin production. In RNA molecules, base pairing stabilizes RNA structure and its folding conformation; therefore, base pairing indirectly affects RNA functions and provides a powerful target for the control of gene expression (7). Translation machinery and its associated RNA helicases do not seem to denature fully structure of the stable base pairings (8). Messenger RNAs (mRNAs) should be unfolded to single strands by the RNA helicases during their translation to proteins (9). miRNA can also induce cleavage of the target RNA with a limited complementary to the mRNA target(10). In canonical miRNA target recognition, a perfect complementary occurs in Nucleotides 2–7 of the miRNA, which is called the seed region. However, targeting principles are complex and several alternative modes of the miRNA target recognition have been described (11). Members of the argonaute (AGO) protein family are critical players in RISC functions. AGO2 includes endonuclease activity (10). However, after AGO cuts the RNA into two pieces, known as 5′ and 3′ cleavage fragments, resulted fragments should be cleared (12). In the current study, mature miR-21 sequences, which are upregulated in Leishmania infected cells, were assumed to guide RISC complexes to miR-21 targets. Therefore, a miR-21 target in a location between the ECMV IRES sequences and the RC of ECMV IRES would be cleaved by the miRNA machinery (13). miR-21 in association with AGO-2 mediates cleavage of the mRNA targets (14). Degradation of the cleft fragments continues by Xrn1 (5′→3′), Rat1 (5′→3′) or Dis3/Rrp44 (3′→5′) in exosomes (Fig. 2). The RNA degradation by cellular ribonucleases ultimately removes RC sequences and therefore native refolding of EMCV IRES occurs (Fig. 3). Thus, translation machinery is able to translate selectively melittin in a noncanonical IRES dependent process in Leishmania infected cells. Shared complement of the miR-21 sequences and its targets in five animal species was described in the current study (Fig. 4).
Fig. 2:

Schematic of RNA degradation by endonucleolytic cleavage (scissor), followed by degradation of the cleft fragments by Xrn1 (5′→3′), Rat1 (5′→3′) or Dis3/Rrp44 (3′→5′) in exosomes

Fig. 3:

The RNA folding prediction. Optimal secondary structures of ECMV IRES with and without reverse complementary sequences. A) MFE of the complete sequences of ECMV IRES without RC of the J-K region (inside the triangle), -308 kcal mol−1, B) MFE of the complete sequences with RC of the J-K region of ECMV IRES, -411 kcal mol−1

Fig. 4:

Multiple sequence alignments of miR-21-5p from mouse, horse, dog, human and hog using CLUSTAL O Software v.1.2.4. Asterisks represent residue conservations within the sequences

Schematic of RNA degradation by endonucleolytic cleavage (scissor), followed by degradation of the cleft fragments by Xrn1 (5′→3′), Rat1 (5′→3′) or Dis3/Rrp44 (3′→5′) in exosomes The RNA folding prediction. Optimal secondary structures of ECMV IRES with and without reverse complementary sequences. A) MFE of the complete sequences of ECMV IRES without RC of the J-K region (inside the triangle), -308 kcal mol−1, B) MFE of the complete sequences with RC of the J-K region of ECMV IRES, -411 kcal mol−1 Multiple sequence alignments of miR-21-5p from mouse, horse, dog, human and hog using CLUSTAL O Software v.1.2.4. Asterisks represent residue conservations within the sequences Conservation of miRNAs and their targets in various eukaryotic cells and their roles in a variety of diseases suggest further investigations of miRNAs for gene therapies in different animal species. Generally, leishmaniasis is characterized by strong inflammatory responses with a high-level production of tumor necrosis factor (TNF). The TNF induces matrix metalloproteinase enzymes. Cells in cutaneous leishmaniasis (CL) lesions secrete high levels of matrix metalloprotease-9 (MMP-9), compared to cells in healthy people (15). Melittin includes a cationic motif called KRKR. Connection of melittin to a neutralizing polyanionic peptide (E7) via a matrix metalloproteinase cleavable linker may be a useful approach for therapeutic uses in leishmaniasis. In this study, melittin was fused to a MMP-2, 9 substrate peptide linker and a polyanionic peptide inhibitor. Thus, melittin was inhibited unless the linker was proteolyzed.

Vector construction

In this study, partial sequences of the construct (5′→3′) were respectively as follows: The RC sequences of the ECMV IRES J-K region were produced using online server (http://arep.med.harvard.edu/labgc/adnan/projects/Utilities/revcomp.html). The sequences included GGGGCCTAGACTTTAACCTCGACACATGTAAAGGTACCGAGGCCTCAGATCCCATGGGGTACCTTCATCCTTCAGCCCC. The RC sequences for the J-K region of EMCV IRES were assumed to form a stable double-stranded RNA (dsRNA) with adequate minimum free energy (MFE) to destroy the canonical folding of IRES and hence inhibit the IRES function; Three potential target sites for miR-21 (underlined) were designed; each included a 22-bp cognate sequence separated by three adenine nucleotides (aaa). In general, 115 nucleotides belonged to the flanking region of miR-21 target from Homo sapiens ERMIN (hErmin) transcript variant 1 mRNA (NM_001009959.3) were added to the 5′ terminal of miR-21 target mediating sequences as follows: TAATTCTATTGCCCCAGGGTGCATATTTCTATGCCTTATTTGAGTTATCACTTGGAGGGAGGTGGAAGTTGACTCTCTTTTTCACTGTAGAATAATGTGGAAATAACCCTAGATTCAACATCAGTCTGATAAGCTAaaaTCAACAcCAGTCTtATAAGCTAaaaTCAACATCAGTCcGATAAGCTA. Studies have identified perfect-paired sites as the miRNA targets are appropriate cleavage substrates in cultured cells and human brains. Therefore, a fully complementary version of miR-21 target was designed in the current study (10) to assess better cleavage capabilities of the miR-21 targets, three binding sites were used (16). Structure of the target RNA plays a critical role in miRNA target recognition. Regularly, target site accessibility plays an important role for the efficiency of miRNA target recognition (17, 24). Therefore, nucleotide replacement (T→C), (G→T) and (T→C) were designed to disrupt closed sequence complementarity and promote formation of the open structures, for improving target accessibility which are double underlined. When miR-21 target in the designed construct is cleft by miRNA machinery (led by miR-21), various enzymes catalyze degradation of the RC sequences (13). The ECMV IRES sequences were retrieved from NCBI (KF836387.1). The J-K region mediated sequences are underlined: GCCCCTCTCCCTCCCCCCCCCCTAACGTTACTGGCCGAAGCCGCTTGGAATAAGGCCGGTGTGCGTTTGTCTATATGTTATTTTCCACCATATTGCCGTCTTTTGGCAATGTGAGGGCCCGGAAACCTGGCCCTGTCTTCTTGACGAGCATTCCTAGGGGTCTTTCCCCTCTCGCCAAAGGAATGCAAGGTCTGTTGAATGTCGTGAAGGAAGCAGTTCCTCTGGAAGCTTCTTGAAGACAAACAACGTCTGTAGCGACCCTTTGCAGGCAGCGGAACCCCCCACCTGGCGACAGGTGCCTCTGCGGCCAAAAGCCACGTGTATAAGATACACCTGCAAAGGCGGCACAACCCCAGTGCCACGTTGTGAGTTGGATAGTTGTGGAAAGAGTCAAATGGCTCTCCTCAAGCGTATTCAACAAGGGGCTGAAGGATGCCCAGAAGGTACCCCATTGTATGGGATCTGATCTGGGGCCTCGGTACACATGCTTTACATGTGTTTAGTCGAGGTTAAAAAACGTCTAGGCCCC; 4) 26-AA sequences of Apis mellifera melittin were retrieved from NCBI (NP_001011607.1) and sequences of MMP cleavable peptide and polyanionic peptide inhibitor consisting of seven glutamic acid (E7) were added. Hydrophobic AAs of melittin are underlined, cationic AAs are dotted lined, MMP cleavable peptide is double underlined and polyanionic peptide (E7) is wave lined(18). MGIGAVLKVLTTGLPALISWIKRKRQQGGPVGLIGKEEEEEEE. atg ggc atc ggc gcc gtg ctg aag gtg ctg acc acc ggc ctg ccc gcc ctg atc agc tgg M G I G A V L K V L T T G L P A L I S W atc aag agg aag agg cag cag ggc ggc ccc gtg ggc ctg atc ggc aag gag gag gag gag I K R K R Q Q G G P V G L I G K E E E E gag gag gag taa E E E The peptide was translated to DNA and codons were optimized using JCAT Server (http://www.jcat.de) for translation in mice. Start and stop codon sequences were added to the start and end which are underlined: ATGGGCATCGGCGCCGTGCTGAAGGTGCTGACCACCGGCCTGCCCGCCCTGATCAGCTGGATCAAGAGGAAGAGGCAGCAGGGCGGCCCCGTGGGCCTGATCGGCAAGGAGGAGGAGGAGGAGGAGGAGTAA; and 5) sequences of the designed gene were completed. Partial sequences were merged as follows: 1..80 including RC of ECMV IRES J-K region mediated sequences, 81..195 including flanking region of the miR-21 target from H. sapiens Ermin, 196..267 including three potential targets of the miR-21 which are separated by aaa, 268..855 including ECMV IRES sequences and 856..987 including sequences of melittin, MMP cleavable peptide and polyanionic peptide (E7). Then, final sequences were designed for cloning in pcDNA vector to express transient selective melittin in Leishmania infected cells. The pcDNA vector included a strong cytomegalovirus promoter sequence for high-level expression in eukaryotic cells, SV40 and polyomavirus origins of replication (Ori) to facilitate episomal replication and an ampicillin resistance gene for propagation in E. coli. The construct can be delivered through intraperitoneal injections using liposomes and its potentially clinical usage for the treatment of experimentally Leishmania infected mice would be assessed (19,20).

The RNA folding prediction

Secondary structure of the sequences were predicted using the minimum free energy (MFE) by Vienna RNA Fold Server (http://rna.tbi.univie.ac.at/cgi-bin/RNAWebSuite/RNAfold.cgi).

Peptide folding prediction

Peptides are interested as great candidates for therapies. In fact, PEP-FOLD3 provides a general framework for the structural characterization of linear peptides with 5–50 AAs. The PEP-FOLD3 was available from http://bioserv.rpbs.univ-paris-diderot.fr/services/PEP-FOLD3).

Results

Treatments of CHO cells with melittin for 24 h indicated that melittin at different concentration (0.5, 1.8 ,4 μg ml−1) caused damages in different levels to cell membrane including cell shrinkage, irregularity in cellular shape, cellular detachment but there were not any changes in the control group (Fig. 5).
Fig. 5:

Treatments of CHO cells with melittin for 24 h. A) control; B) melittin at concentration of 0.5 μg ml−1; C) melittin at concentration of 1.8 μg ml−1; and D) melittin at concentration of 4 μg ml−1

Treatments of CHO cells with melittin for 24 h. A) control; B) melittin at concentration of 0.5 μg ml−1; C) melittin at concentration of 1.8 μg ml−1; and D) melittin at concentration of 4 μg ml−1 The optimal RNA secondary structures with minimum free energy (Figs. 1,3), microRNA target site accessibility (Fig. 6) and peptide folding prediction (Fig. 7) are shown. A potential complication in therapeutic use of long dsRNAs is activation of dsRNA dependent protein kinases and interferons. RC sequences were designed based on a protocol; in which, interval loops interrupted the long dsRNA at every nine base pairs. In general, dsRNAs longer than 26 nucleotides may activate 2, 5-oligoadenylate synthetase. The enzyme product activates RNase L, which subsequently degrades mRNAs.
Fig. 6:

As target site accessibility plays an important role in efficiency of the RISC activation23, replacements were introduced into miRNA target site (B) to be further accessible, compared to cognate sequence of the miRNA target site (A)

Fig. 7:

The peptide folding prediction. a) melittin plus MMP linker and polyanionic peptide (E7); b) melittin; c)MMP linker and polyanionic peptide (E7) and melittin

As target site accessibility plays an important role in efficiency of the RISC activation23, replacements were introduced into miRNA target site (B) to be further accessible, compared to cognate sequence of the miRNA target site (A) The peptide folding prediction. a) melittin plus MMP linker and polyanionic peptide (E7); b) melittin; c)MMP linker and polyanionic peptide (E7) and melittin

Discussion

The inhibitory effect of melittin on the cell lines has been investigated. Melittin in different concentrations causes some damages to CHO cell line, which was dose dependent. In purpose of selective targeting, we designed a construct for adjustable melittin production. Magnitude of these effects on translation depends on stability and position of the hairpins. Although the stable structure of 5′ leader (DG ≥ −50 kcal mol−1) completely blocks ribosome scanning and decreases protein yields by 85–95%, a moderate hairpin (−30 kcal mol−1) located near the 5′ end represses translation by affecting the binding of preinitiation complex to mRNAs(16). Weenink et al (24) demonstrated that RNA hairpins inserted in 5′ untranslated region (5′-UTR) of mRNAs can be used to tune expression levels by altering efficiency of the translation initiation. They described a direct link between the calculated free energies of folding in 5’UTR and protein abundance. Furthermore, folding strengths of the hairpins regulated expression levels of the associated proteins. Stronger hairpin structures resulted in lower expression levels, possibly via increased interferences with the translational machinery of hosts during the scanning step of the translation initiation. Expression was not affected by the hairpin structures weaker than -18 kcal mol−1. These revealed that the translation initiation machinery and its associated RNA helicases were likely able to fully denature structures with weak strengths. However, hairpins stronger than -44 kcal mol−1 were not translated at all, suggesting that the native machinery was unable to unfold these structures. In fact, accurate assessments of the native machinery limits are important since they provide possibilities to investigate effects of every component of the translation machinery (e.g. eIF4A, eIF4B and eIF4G) on helicase activities. Each of these components has been shown to play a role in RNA-helicase processing. Describing how overexpression and elimination of these components affect this process can provide valuable information on functions of these components. There are strong evidence that the RNA helicase activity in translation initiation partially counteracts effects of the hairpin structures in mRNAs (24). The 2-hydroxyl group that lines at each terminal of the RNA minor groove creates a polar extensively hydrated surface. Several dsRNA-protein interactions, including those seen with RNase III family members, rely on 2-hydroxyl groups to provide binding energy and differentiate dsRNA from DNA or DNA-RNA hybrids. Alterations in solvent conditions result in α-helices that exhibit a 12-bp pitch and a widened major groove (22). Assembly of the helical domains depends on the RNA sequence and determines magnitude of the free energy. Because base-pairing interactions are relatively stable in dsRNAs, energy barriers were high in the present study. Therefore, free energy predictions for the RNA folding were rough with local minima that competed with the global minima. Molecules in these local minima (representing the current construct) are kinetically trapped in their structures; hence, a small region of the RNA molecules controls the overall folding. Even the simplest elements of RNA structures demonstrate complex dynamic characteristics of a conformation in the structures. Further studies are necessary to better understand RNA folding mechanisms in cells (23). In normal conditions, activity of the miR-21 is limited to a threshold that is necessary for the gene silencing. In diseased and stressed cells, enhanced associations with polysome-linked mRNAs possibly explain advanced functions of the miR-21(25). Expression of miR-21 may increase in mononuclear cells of symptomatic dogs with natural infections of L. infantum (8). Several RNA helicases have been described in cells, which can unwind regions in genomic secondary structures. Interestingly, proteins associated with decapping and 5′→3′ exonucleolytic decay of mRNAs have been found in processing bodies (P-bodies), including enzymes involved in mRNA turnovers. Alternatively, a multiple protein complex (usually called the exosome) contains at least eleven proteins, which are involved in exonucleolytic RNA decays (26) in yeasts, poly A tails and their associated binding proteins protect RNAs from degradation. Once deadenylation is initiated, removal of 5′-methyl G cap results in rapid exonucleolytic degradation from either 5′or 3′ terminal. While 5′→3′ degradation is carried out by a single enzyme (Xrn1p), decay from 3′ terminal involves an exosome that contains numerous putative 3′→5′ exonucleases (27). The MMPs are a family of extracellular proteolytic enzymes that are characterized by their overexpression or over-activity in several pathological processes. Cytoplasmic MMP-2 can be activated by reactive oxygen species (ROS) (28). Various strategies have been described for the use of MMPs in targeting therapeutic entities. To achieve a further selectivity for melittin functioning in the current study, melittin was connected to a neutralizing polyanion with seven glutamic acids using a cleavable linker. Therefore, melittin was inhibited until the linker was proteolyzed.

Conclusion

MFE values of base pairings between the J-K regions of ECMV IRES were predicted as -127 kcal mol−1 with RC sequences and -46 kcal mol−1 with no RC sequences. In this study, translation machinery and its associated RNA helicases were unable to fully-denature structures of these stable base pairings consisting of RC sequences as well as to unfolding this strength. Furthermore, mature miR-21 sequences were assumed to lead the RISC complex to three designed miR-21 targets between the EMCV IRES sequences and the associated RC sequences and hence RNA cleavage would occur in these regions. In general, exoribonucleases need a free RNA 5′/3′-end with specific terminals (5′/3′-phosphate or 5′/3′-OH) to catalyze degradation of RNA substrates. Selective degradations of RNAs by cellular ribonucleases ultimately remove RC sequences in infected cells and hence the J-K region of EMCV IRES refolds to its native form and interacts with HEAT-1 domain of the eukaryotic translation initiation factor 4G. Translation machinery in cells with increased miR-21 can translate melittin, MMP linker and polyanionic inhibitor through a non-canonical pathway. Then, the MMP linker is degraded and selective killing happens.
  25 in total

1.  RNA folding energy landscapes.

Authors:  S J Chen; K A Dill
Journal:  Proc Natl Acad Sci U S A       Date:  2000-01-18       Impact factor: 11.205

2.  First report on the isolation of melittin from Iranian honey bee venom and evaluation of its toxicity on gastric cancer AGS cells.

Authors:  Amir Mahmoodzadeh; Hannaneh Zarrinnahad; Kamran Pooshang Bagheri; Ali Moradia; Delavar Shahbazzadeh
Journal:  J Chin Med Assoc       Date:  2015-08-24       Impact factor: 2.743

Review 3.  mRNA decay in prokaryotes and eukaryotes: different approaches to a similar problem.

Authors:  Sidney R Kushner
Journal:  IUBMB Life       Date:  2004-10       Impact factor: 3.885

4.  Disease-linked microRNA-21 exhibits drastically reduced mRNA binding and silencing activity in healthy mouse liver.

Authors:  John R Androsavich; B Nelson Chau; Balkrishen Bhat; Peter S Linsley; Nils G Walter
Journal:  RNA       Date:  2012-06-27       Impact factor: 4.942

Review 5.  Compact intermediates in RNA folding.

Authors:  Sarah A Woodson
Journal:  Annu Rev Biophys       Date:  2010       Impact factor: 12.981

6.  Human Argonaute2 mediates RNA cleavage targeted by miRNAs and siRNAs.

Authors:  Gunter Meister; Markus Landthaler; Agnieszka Patkaniowska; Yair Dorsett; Grace Teng; Thomas Tuschl
Journal:  Mol Cell       Date:  2004-07-23       Impact factor: 17.970

7.  Intraperitoneal injection of a hairpin RNA-expressing plasmid targeting urokinase-type plasminogen activator (uPA) receptor and uPA retards angiogenesis and inhibits intracranial tumor growth in nude mice.

Authors:  Christopher S Gondi; Sajani S Lakka; Dzung H Dinh; William C Olivero; Meena Gujrati; Jasti S Rao
Journal:  Clin Cancer Res       Date:  2007-07-15       Impact factor: 12.531

8.  Matrix metalloproteinase 9 production by monocytes is enhanced by TNF and participates in the pathology of human cutaneous Leishmaniasis.

Authors:  Taís M Campos; Sara T Passos; Fernanda O Novais; Daniel P Beiting; Rúbia S Costa; Adriano Queiroz; David Mosser; Phillip Scott; Edgar M Carvalho; Lucas P Carvalho
Journal:  PLoS Negl Trop Dis       Date:  2014-11-13

9.  Expression of Pro-inflammatory Genes in Lesions and Neutrophils during Leishmania major Infection in BALB/c Mice.

Authors:  Soheyla Akhzari; Hossein Rezvan; Masoud Zolhavarieh
Journal:  Iran J Parasitol       Date:  2016 Oct-Dec       Impact factor: 1.012

10.  Apoptotic Effect of Melittin Purified from Iranian Honey Bee Venom on Human Cervical Cancer HeLa Cell Line.

Authors:  Hannaneh Zarrinnahad; Amir Mahmoodzadeh; Monireh Parviz Hamidi; Mehdi Mahdavi; Ali Moradi; Kamran Pooshang Bagheri; Delavar Shahbazzadeh
Journal:  Int J Pept Res Ther       Date:  2017-11-11       Impact factor: 1.931

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.