Literature DB >> 33446976

Thromboelastography Profile of Patients with COVID-19 Admitted to Intensive Care Unit: A Single-center Retrospective Study from India.

Sanjith Saseedharan1, Vijay B Talla2, Annapurna Chiluka1.   

Abstract

Coronavirus disease (COVID-19) causes thromboinflammation resulting in a high incidence of venous thromboembolism (VTE) events, which occur in significant numbers despite giving standard thromboprophylaxis with low-molecular-weight heparins. Various markers and tests have been evaluated and found to have a strong association with the worse prognosis of the disease. Common coagulation markers like D-dimer and fibrinogen give more of a static picture of coagulation, whereas viscoelastic tests like thromboelastography (TEG) provide an understanding of the coagulation function and help in better interpretation. We conducted a retrospective analysis of TEG values of 32 patients with COVID-19 admitted to the intensive care unit (ICU). Hypercoagulation as defined by TEG-coagulation index (CI) higher than the upper limit of the normal reference range (NRR) is found in 62.5% of the patients. There is also a clear representation of hypercoagulability as reflected by TEG-R, TEG-K, and TEG-LY30 values lower than or toward the lower limit of NRR, and TEG-ANGLE, TEG-MA, and TEG-CI values higher than or toward the upper limit of NRR which is more pronounced in severe forms of the disease, both in comparison to NRRs and other non-COVID ICU patients. Findings are similar to that of earlier studies in patients with COVID-19 except for the LY30, which is retained in the majority of our patients. Thromboelastography can be a useful tool to understand and screen for COVID-19-related hypercoagulability and may help predict VTE events. The potential of TEG to determine the optimal anticoagulant therapy needs to be evaluated in larger prospective studies. How to cite this article: Saseedharan S, Talla VB, Chiluka A. Thromboelastography Profile of Patients with COVID-19 Admitted to Intensive Care Unit: A Single-center Retrospective Study from India. Indian J Crit Care Med 2020;24(12):1218-1222.
Copyright © 2020; Jaypee Brothers Medical Publishers (P) Ltd.

Entities:  

Keywords:  Coagulation disorder; Coronavirus disease; Intensive care unit; Thromboelastography

Year:  2020        PMID: 33446976      PMCID: PMC7775920          DOI: 10.5005/jp-journals-10071-23675

Source DB:  PubMed          Journal:  Indian J Crit Care Med        ISSN: 0972-5229


Introduction

A cluster of pneumonia cases was reported on December 31, 2019, in Wuhan, China's Hubei Province, which was eventually named as severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) as the causative agent and was declared a pandemic by World Health Organization (WHO). The number of confirmed cases as of June 29, 2020, the 6-month anniversary of the coronavirus disease (COVID-19) outbreak, was over 10 million cases with around 500,000 deaths.[1] Severe acute respiratory syndrome coronavirus 2 gains entry to human cells by binding to angiotensin-converting enzyme 2 (ACE-2) receptors expressed on the respiratory epithelium and other sites including endothelium.[2] Uncontrolled viral replication at these sites can cause inflammation and hypercoagulability as evidenced by venous and arterial thrombosis and multiorgan dysfunction.[3] In a large case series of hospitalized patients with COVID-19 from New York, 14.2% were treated in an intensive care unit (ICU), 12.2% required invasive mechanical ventilation (IMV), and 21% died.[4] A recent review on thrombosis risk in COVID-19 by Al-Ani et al. reported the occurrence of venous thromboembolism (VTE) in approximately 20% of patients and with cumulative incidences up to 49% during hospitalization.[5] Studies have also consistently reported a significant increase in D-dimer and high levels were associated with an increase in the risk of thrombosis, progression to critical illness, and mortality suggesting a crucial role of coagulopathy in the prognosis of the disease.[6] Thromboelastography (TEG), commonly used to guide transfusion of hemostatic products, is a test of hemostasis that measures clot formation and dissolution in real-time. Thromboelastography can be a useful adjunct to clinical judgment to stratify a patient's risk of developing thromboembolism.[7] We carried out a retrospective analysis of TEG data of critically ill patients with COVID-19 admitted to ICU, to study the coagulation states and to understand the utility of TEG in this setting.

Materials and Methods

This study was done as a retrospective chart review of data collected for clinical purposes. Data of consecutive patients with COVID admitted to the ICU between May 22, 2020, and June 22, 2020, were studied. As per our institutional protocols and practices, all patients were shifted to ICU only if they match moderate severity of acute respiratory distress syndrome (ARDS) Berlin definition,[8] COVID severity was defined based on Indian government guidelines,[9] all patients were already on prophylactic anticoagulation with low-molecular-weight heparin (LMWH), and were generally put on either non-rebreathing masks warranting high flow nasal cannula, non-IMV, or IMV. The clinical condition was assessed and blood for routine testing was collected on arrival to ICU. Thromboelastography, as per the hospital protocol to understand the coagulation profile better, was performed for all COVID patients admitted to ICU, within 1 hour of specimen collection using TEG® 5000 Thromboelastograph® Hemostasis Analyzer System (Haemonetics, Boston, MA, USA) with citrated kaolin in heparinase as the reagent. Quality-control checks were performed regularly according to the manufacturer's instructions. Statistical analyses were performed using SPSS (Version 16.0; Statistical Package for Social Sciences, Chicago, IL, USA). For descriptive analyses, variables were expressed as mean values and standard deviations (SD) or frequency and percentages. Independent-samples T-test was used to analyze the difference between the means. Pearson correlation was used to determine the correlation between TEG parameters and other clinical data. A p value of <0.05 was considered statistically significant.

Results

Thirty-two critically ill patients with TEG data were included in the analysis. There were no patients with known altered coagulable states like blood product transfusion within 24 hours of TEG, thrombocytopenia, liver failure, or current antiplatelet therapies. All patients were already receiving prophylactic anticoagulation with 40 mg enoxaparin subcutaneous once daily. Patient demographics are mentioned in Table 1.
Table 1

Demographics

Variable (n = 32)Mean (±SD) or frequency (%)
Age (years)58.19 (±14.89)
Sex

Male

23 (71.9%)

Female

9 (28.1%)

Days of illness5.28 (±3.45)
Days of admission to hospital (post illness)5.63 (±3.70)
Day of admission to ICU7.19 (±3.75)
COVID severity

Moderate

13 (40.6%)

Severe

19 (59.4%)

Comorbidity

No

9 (28.1%)

Yes

23 (71.9%)

HTN

19 (59.4%)

DM

7 (21.9%)

IHD

4 (12.5%)

RA

1 (3.1%)

Koch's

1 (3.1%)

Hypothyroid

1 (3.1%)

AF (not on OAC)

1 (3.1%)

SOFA score1.53 (±0.57)
APACHE score15.16 (±3.48)
IMV

No

18 (56.2%)

Yes

14 (43.8%)

OAC, oral anticoagulation; AF, atrial fibrillation; APACHE, Acute Physiology and Chronic Health Evaluation; COVID, coronavirus disease; DM, diabetes mellitus; HTN, hypertension; ICU, intensive care unit; IHD, ischemic heart disease; IMV, invasive mechanical ventilation; RA, rheumatoid arthritis; SOFA, Sequential Organ Failure Assessment

The mean values for hematological parameters and TEG values vis-à-vis the manufacturer's NRR are mentioned in Table 2. Mean fibrinogen levels are higher than the normal range with slightly higher values for INR and aPTT. All the mean TEG values are within the manufacturer's NRR, with mean TEG-MA and TEG-CI clearly toward the upper limit of NRR, reflecting a possible hypercoagulable state.
Table 2

Hematological and TEG parameters

Hematological parameters (NRR)Mean (±SD)
Fibrinogen (200–400 mg/dL)558.02 (±198.77)
PT (11–12.5 sec)  12.10 (±1.83)
INR (0.8–1.1)    1.19 (±0.12)
aPTT (30–40 sec)  41.60 (±11.18)
Platelets (1.5–4.0)    2.10 (±0.88)
TEG parameter (manufacturer's reference range)
TEG-R (3–8)    4.15 (±1.56)
TEG-K (1–3)    1.65 (±0.94)
TEG-ANGLE (55–78)  66.03 (±10.17)
TEG-MA (51–69)  67.39 (±13.75)
TEG-CI (−3 to 3)    2.99 (±2.44)
TEG-LY30 (0–8)    2.77 (±6.00)

ANGLE, alpha angle; aPTT, activated partial thromboplastin time; CI, coagulation index; INR, international normalized ratio; K, kinetics; LY30, lysis at 30 min; MA, maximum amplitude; NRR, normal reference range; PT, prothrombin time; R, reaction time; TEG, thromboelastography

Comparison of mean TEG values in relation to comorbidity, COVID severity, and IMV showed that the hypercoagulable nature of the disease is more pronounced in severe forms of the disease. Fourteen patients have abnormal TEG patterns with “Combined enzymatic and platelet hypercoagulability” being the most common abnormality pattern (Table 3). Hypercoagulation as defined by CI higher than the upper limit of NRR is found in 62.5% of the patients (Table 4).
Table 3

TEG patterns

TEG patternCriteriaFrequency/total (%)
Factor deficiencyR time higher than the upper limit of NRR0/32 (0)
Low fibrinogenNormal R time and MA, but ANGLE below the lower limit of NRR2/32 (6.25%)
Low platelet functionNormal R time but with an MA below the lower limit of NRR3/32 (9.38%)
Enzymatic hypercoagulabilityCI above the upper limit of NRR with R time below the lower limit of NRR and normal MA1/32 (3.13%)
Combined enzymatic and platelet hypercoagulabilityCI above the upper limit of NRR with R time below the lower limit of NRR and having an MA higher than the upper limit of NRR7/32 (21.88%)
Primary fibrinolysisLY30 higher than the upper limit of normal reference range with CI below the lower limit of NRR0/32 (0)
Secondary fibrinolysisLY30 and CI higher than the upper limit of NRR1/32 (3.13%)

ANGLE, alpha angle; CI, coagulation index; K, kinetics; LY30, lysis at 30 min; MA, maximum amplitude; NRR, normal reference range; R, reaction time; TEG, thromboelastography

Table 4

Coagulation status based on TEG-CI

Coagulation statusFrequency/total (%)
Hypocoagulable (CI < −3)0/32 (0)
Normocoagulable (CI −3 to 3)12/32 (37.5%)
Hypercoagulable (CI > 3)20/32 (62.5%)

CI, coagulation index; TEG, thromboelastography

Correlation analysis is done between severity scores—SOFA, APACHE, and the TEG parameters, and a significant positive correlation is seen between SOFA score and TEGMA (Supplementary Table 1).
Supplementary Table 1

Correlation analysis between severity scores—SOFA, APACHE, and TEG parameters

Correlations
SOFAAPACHETEGRTEGKTEGANGLETEGMATEGCITEGLY30
SOFAPearson correlation10.708[**]−0.091−0.1150.1350.413[*]0.214−0.040
Sig. (two-tailed)0.0000.6200.5300.4610.0190.2390.832
N3232323232323230
APACHEPearson correlation0.708[**]1−0.1040.0200.0080.1680.039−0.167
Sig. (two-tailed)0.0000.5710.9120.9650.3590.8330.379
N3232323232323230
TEGRPearson correlation−0.091−0.10410.510[**]−0.388[*]−0.552[**]−0.659[**]0.127
Sig. (two-tailed)0.6200.5710.0030.0280.0010.0000.505
N3232323232323230
TEGKPearson correlation−0.1150.0200.510[**]1−0.524[**]−0.672[**]−0.405[*]−0.073
Sig. (two-tailed)0.5300.9120.0030.0020.0000.0220.701
N3232323232323230
TEGANGLEPearson correlation0.1350.008−0.388[*]−0.524[**]10.2680.634[**]−0.110
Sig. (two-tailed)0.4610.9650.0280.0020.1380.0000.564
N3232323232323230
TEGMAPearson correlation0.413[*]0.168−0.552[**]−0.672[**]0.26810.454[**]0.032
Sig. (two-tailed)0.0190.3590.0010.0000.1380.0090.865
N3232323232323230
TEGCIPearson correlation0.2140.039−0.659[**]−0.405[*]0.634[**]0.454[**]1−0.195
Sig. (two-tailed)0.2390.8330.0000.0220.0000.0090.303
N3232323232323230
TEGLY30Pearson correlation−0.040−0.1670.127−0.073−0.1100.032−0.1951
Sig. (two-tailed)0.8320.3790.5050.7010.5640.8650.303
N3030303030303030

Correlation is significant at the 0.05 level (two-tailed)

Correlation is significant at the 0.01 level (two-tailed)

Discussion

As per our knowledge, our study is the first Indian study to observe the TEG profiles in patients with COVID-19. Compared to the manufacturer's NRR values, as well as two other Indian studies in the healthy population,[10,11] the TEG values in our study have shown a hypercoagulable state, reflected by TEG-R, TEG-K values lower than or toward the lower limit of NRR, and TEG-ANGLE, TEG-MA, TEG-CI values higher than or toward the upper limit of NRR. This is more pronounced in severe forms of the disease—“Comorbidity”, “Severe COVID”, and “IMV” groups. The findings are hypercoagulable even in comparison to an Indian study in non-COVID ICU patients, again more pronounced in severe forms of the disease. Demographics Male 23 (71.9%) Female 9 (28.1%) Moderate 13 (40.6%) Severe 19 (59.4%) No 9 (28.1%) Yes 23 (71.9%) HTN 19 (59.4%) DM 7 (21.9%) IHD 4 (12.5%) RA 1 (3.1%) Koch's 1 (3.1%) Hypothyroid 1 (3.1%) AF (not on OAC) 1 (3.1%) No 18 (56.2%) Yes 14 (43.8%) OAC, oral anticoagulation; AF, atrial fibrillation; APACHE, Acute Physiology and Chronic Health Evaluation; COVID, coronavirus disease; DM, diabetes mellitus; HTN, hypertension; ICU, intensive care unit; IHD, ischemic heart disease; IMV, invasive mechanical ventilation; RA, rheumatoid arthritis; SOFA, Sequential Organ Failure Assessment The hypercoagulable nature of COVID-19 as evident from abnormal TEG[12-19] and rotational thromboelastometry (ROTEM)[20-22] findings have been reported recently. Hightower et al. observed the TEG profile of a small cohort of patients with COVID-19 and found that dysregulation of the fibrinolytic system is responsible for the hypercoagulable state.[14] Maatman et al. analyzed TEG data of 12 patients admitted to ICU with severe COVID and found that 58% of them had a hypercoagulable state.[15] Panigada et al. studied 24 patients and found a state of hypercoagulability as shown by decreased R and K values, and increased values of ANGLE and MA.[16] Patel et al. observed 39 patients and found raised MA and absent fibrinolysis.[17] Yuriditsky et al. studied 64 patients and found that >50% of patients were hypercoagulable as reflected by different TEG parameters, and 31% had VTE events.[18] The mean LY-30 in our study is 2.77 and a complete lack is seen in only 12/32 (37.5%) patients hinting at a possibility of retained fibrinolytic function in the majority of patients, whereas Wright et al. (in 44 patients) found a very low LY30 of 0 (0–0.4) [median (IQR)], a complete lack of LY30 in 57% of patients and also shown that fibrinolysis shutdown (elevated D-dimer and LY30 of 0) predicts VTE events.[19] Hematological and TEG parameters ANGLE, alpha angle; aPTT, activated partial thromboplastin time; CI, coagulation index; INR, international normalized ratio; K, kinetics; LY30, lysis at 30 min; MA, maximum amplitude; NRR, normal reference range; PT, prothrombin time; R, reaction time; TEG, thromboelastography TEG patterns ANGLE, alpha angle; CI, coagulation index; K, kinetics; LY30, lysis at 30 min; MA, maximum amplitude; NRR, normal reference range; R, reaction time; TEG, thromboelastography Various studies and recent reviews have pointed out that there is a high incidence of VTE events in ICU patients with COVID-19 and that these events are occurring on the background of standard thromboprophylaxis.[5] Our study also has shown hypercoagulability despite giving standard doses of enoxaparin. Few studies have also studied the duration of altered coagulation state and linked the hypercoagulability to the occurrence of VTE events and the worse prognosis of the disease.[6,22] Thromboelastography can be an easy and helpful test to learn about this new disease and may have potential in deciding appropriate anticoagulant doses and duration.[7,23,24] Some experts advise TEG in patients with severe COVID-19 for monitoring coagulation and adjusting the heparin dosage.[25] More studies are needed to evaluate the applicability of TEG in understanding the disease, identifying appropriate doses and duration of thromboprophylaxis, and predicting outcomes. Coagulation status based on TEG-CI CI, coagulation index; TEG, thromboelastography

Limitations

The retrospective and a small number of patients in our study can limit the generalization and applicability of the results. Sequential TEG was not done, which could give more understanding of evolving patterns through the course of the disease. The correlation was not done with VTE or bleeding events.

Conclusion

To our knowledge, this is the first Indian study to characterize coagulation profiles based on TEG in patients with COVID-19 admitted to ICU. Hypercoagulability is observed in the majority of the patients which is more pronounced in severe forms of the disease. Fibrinolysis is also retained in the majority of patients which is a positive sign.

Contribution of Authors

All the authors are involved in design, analysis, interpretation, critical review and final approval, and agree to be accountable for all aspects of the work in ensuring that questions related to the accuracy or integrity of any part of the work are appropriately investigated and resolved. Hypercoagulation on thromboelastography (high TEG-CI) found in 62.5% of the patients with COVID-19 admitted to ICU. Hypercoagulability found in other TEG parameters also and is more pronounced in severe forms of the disease. TEG-LY30 is within normal range indicating a good fibrinolysis function. The potential of TEG in identifying appropriate doses and duration of thromboprophylaxis and predicting outcomes need to be evaluated.
  4 in total

Review 1.  Factors associated with differential COVID-19 mortality rates in the SEAR nations: a narrative review.

Authors:  Rubina Mulchandani; Giridhara R Babu; Avinash Kaur; Ranjana Singh; Tanica Lyngdoh
Journal:  IJID Reg       Date:  2022-02-27

2.  Thromboelastography determined dynamics of blood coagulation and its correlation with complications and outcomes in patients with coronavirus disease 2019.

Authors:  Tushar Sehgal; Mukul Aggarwal; Upendra Baitha; Gaurav Gupta; Bindu Prakash; Anu Gupta; Ganesh Kumar; Ashutosh Biswas; Maroof Khan
Journal:  Res Pract Thromb Haemost       Date:  2022-01-15

3.  Pattern of Conventional Coagulation and Thromboelastographic Parameters in Patients with COVID-19 Diseases and Association of COVID-Associated Coagulopathy with Mortality in Intensive Care Unit.

Authors:  Awale Rupali Balchandra; Tanmoy Ghatak; Sukhen Samanta; Ratender K Singh; Anupam Verma; Prabhakar Mishra; Rajendra Chaudhary; Alok Nath
Journal:  Anesth Essays Res       Date:  2022-06-27

Review 4.  Questions about COVID-19 associated coagulopathy: possible answers from the viscoelastic tests.

Authors:  Vittorio Pavoni; Lara Gianesello; Maddalena Pazzi; Pietro Dattolo; Domenico Prisco
Journal:  J Clin Monit Comput       Date:  2021-07-15       Impact factor: 1.977

  4 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.