Literature DB >> 33063679

Relationship Between Rotavirus P[6] Infection in Korean Neonates and Histo-Blood Group Antigen: a Single-Center Study.

Su-Kyung Lee1, Su Jin Oh1, Seoheui Choi2, Soo Han Choi2, Seon-Hee Shin2, Eun Jin Lee1, Eun-Jung Cho1, Jungwon Hyun1, Hyun Soo Kim1.   

Abstract

BACKGROUND: Rotaviruses are a major cause of pediatric gastroenteritis. The rotavirus P[6] genotype is the most prevalent genotype isolated from Korean neonates but has rarely been reported in other countries. Histo-blood group antigen (HBGA) is known to play an important role in rotavirus infection. We investigated the relationship between rotavirus genotype and HBGA-Lewis blood type in Korean children and explored the reasons for the predominance of rotavirus P[6] strain in Korean neonates.
METHODS: Blood and stool samples were collected from 16 rotavirus-infected patients. Rotavirus G (VP7) and P (VP4) genotyping was performed using reverse transcription-PCR and sequencing. Lewis antigen phenotypes (Lea/Leb) were tested, and HBGA-Lewis genotype was determined by sequencing the secretor (FUT2) and Lewis (FUT3) genes. Deduced amino acid sequences and three-dimensional structures of the VP8* portion of the rotavirus VP4 protein were analyzed.
RESULTS: All P[6] rotaviruses were isolated from neonates under one month of age, who were negative or weakly positive for the Leb antigen. However, 10 of the 11 non-P[6] rotaviruses were isolated from older children who were Leb antigen-positive. The VP8* amino acid sequences differed among P[6], P[4], and P[8] genotypes. Korean P[6] strains showed a unique VP8* sequence with amino acid substitutions, including Y169>L169, which differed from the sequences of P[6] strains from other countries.
CONCLUSIONS: The predominance of the rotavirus P[6] genotype in Korean neonates may be related to the interaction between HBGA-Lewis antigen and the VP8* portion of the VP4 protein, and this information will be helpful in future neonatal vaccine development.

Entities:  

Keywords:  Genotype; Histo-blood group antigen; Korean; Lewis; Neonate; Rotavirus; VP4 protein

Mesh:

Substances:

Year:  2021        PMID: 33063679      PMCID: PMC7591292          DOI: 10.3343/alm.2021.41.2.181

Source DB:  PubMed          Journal:  Ann Lab Med        ISSN: 2234-3806            Impact factor:   3.464


INTRODUCTION

Rotaviruses are one of the major causes of pediatric gastroenteritis worldwide. Rotaviruses cause 5–10% of all cases of acute gastroenteritis in young children of < 5 years of age, and 30% of rotavirus infections are severe enough to require treatment [1]. Rotavirus is a non-enveloped, double-stranded RNA (dsRNA) virus with a triple-layered capsid surrounding a genome of 11 dsRNA segments [1]. The outer capsid layer comprises two structural proteins, VP7 and VP4; based on these, rotaviruses are classified into at least 36 G and 51 P genotypes [2]. G1–G4 and G9 and P[4], P[6], and P[8] are the most prevelent G and P genotypes, respectively [1, 3], and the genotypic distribution of rotavirus strains shows temporal and geographical fluctuations [1, 4]. In Korea, G1P[6] rotavirus strains in Korean neonates. Gut Pathog. 2018 ">8] is the most prevalent genotype in children, whereas G4P[6] is the most prevalent genotype in neonates [3, 5-8]. The predominance of the G4P[6] and the G8P[6] genotype in Korean neonates has been reported from 1999 to 2019 [5-8]. Notably, the predominance of G4P[6] in neonates has not been reported in other countries. The rotavirus P[6] genotype is mainly isolated from Korean neonates, but is rarely isolated in older children [5-8]. Recently, rotavirus infection mediated by the attachment of the VP8* domain of the VP4 spike protein to specific histoblood group antigens (HBGAs) in the gut epithelium has been reported [9-11]. HBGAs are blood-type determinants determined by an individual’s secretor gene (FUT2, fucosyltransferase 2) and Lewis gene (FUT3, fucosyltransferase 3) [12]. We investigated the relationship between rotavirus genotype and HBGA-Lewis type in Korean children and explored the reasons for the predominance of rotavirus P[6] infection in Korean neonates.

MATERIALS AND METHODS

Patient samples

We used rotavirus-positive stool samples and corresponding blood samples, which were remnants to be discarded after rotavirus test and complete blood count test, collected from acute gastroenteritis patients at Hallym University Dongtan Sacred Heart Hospital, Hwaseong-si, Korea, between February 2019 and January 2020. The rotavirus antigen test was conducted using SD BIOLINE Rotavirus (SD BIOLINE Rotavirus; Abbott Diagnostic Korea, Yongin, Korea) or RIDASCREEN Rotavirus test kits (RIDASCREEN Rotavirus; R-Biopharm, Darmstadt, Germany), according to the manufacturer’s protocol. The Lewis phenotyping test and DNA extraction were performed on day of sample collection; extracted DNA and remnant diluted stool samples were stored at −70°C until use. During this period, 66 of the 726 stool samples (9.1%) were rotavirus-positive; adequate stool and corresponding blood samples for sequencing the four genes (the rotavirus VP4/VP7 genes and FUT2/FUT3 genes) and Lewis antigen phenotyping were available for 16 patients. Median patient age was 3.4 years (range, 8 days−10 years), and six patients (37.5%) were under 30 days of age. The Institutional Review Board (IRB) of Hallym University Dongtan Sacred Heart Hospital (IRB No. 2017-08-007) approved the study protocol and waived the need for informed consent.

Rotavirus G and P genotyping

Rotavirus G (VP7) and P (VP4) genotyping was performed using reverse transcription-PCR and sequencing. Viral RNA was extracted from diluted stool samples using the QIAamp Viral RNA Mini kit (Qiagen, Hilden, Germany) and the QIAcube platform (Qiagen). The RNA was denatured and reverse-transcribed using the SuperScript III First-Strand Synthesis System (Invitrogen, Carlsbad, CA, USA). The VP7 and VP4 genes were amplified from the dsRNA genome using specific primer sets, VP7-F/VP7-R and VP4-F/VP4-R, respectively [7,8,13]. PCR products were visualized by electrophoresis on agarose gels and analyzed by DNA sequencing using ABI BigDye Terminator v3.1 Cycle Sequencing kits (Applied Biosystems, Foster City, CA, USA) and an ABI 3500 XL DNA Analyzer (Applied Biosystems). Genotypes were confirmed using the Basic Local Alignment Search Tool on the National Center for Biotechnology Information (https://blast.ncbi.nlm.nih.gov/)

Lewis antigen phenotyping

Lewis antigen phenotyping was performed using ID-Antigen Profile I (Bio-Rad, Cressier Switzerland) and gel suspensions containing antibodies for the P, Lea, Leb, Lua, Lub, and ctl antigens, according to the manufacturer’s protocol. A 5% erythrocyte suspension was prepared from each EDTA-anticoagulated blood sample by mixing 50 µL of erythrocytes in 0.5 mL of Diluent 1 solution. The cell suspension was incubated for 10 minutes at room temperature (18–25°C), and 12.5 µL of the cell suspension was added to each phenotype ID-card micro-tube. The ID-cards were then centrifuged for 10 minutes in the ID-centrifuge 12 S II (Bio-Rad) and read in the range between negative to 4+, according to the agglutination strength.

PCR and sequencing of the secretor and Lewis genes (FUT2 and FUT3)

DNA was extracted from EDTA-anticoagulated blood samples using the QIAamp Blood Mini kit (Qiagen). A 1,153-bp region of the FUT2 gene was amplified using the tk1/tk2 primer set [14], and two segments (917 and 419 bp) of the FUT3 gene were amplified using two primer sets (N-F1/6R and 4F/8R) [15]. The forward primer sequence of N-F1 (TGATGACCGGCTATGCCTTC) was specifically designed for this study. PCR products were analyzed by DNA sequencing using ABI BigDye Terminator v3.1 Cycle Sequencing kits and an ABI 3500 XL DNA Analyzer. Variants of the FUT2 and FUT3 genes were detected by comparison with reference sequences FUT2*01 and FUT3 (http://erythrogene.com). Minor allele variants at the FUT2 c.418, c.461, and c.772 and FUT3 c.59, c.202, c.314, c.508, and c.1067 sites, which are known to be related to Lewis antigen phenotypes, were examined [16, 17].

Analyses of amino acid sequences and three-dimensional (3D) structure of VP8*

The deduced amino acid sequences of the rotavirus VP8* portion of the VP4 capsid protein were analyzed and compared with the reference VP4 sequence data from GenBank: Wa_G1P[6] rotavirus strains in Korean neonates. Gut Pathog. 2018 ">8]_ JX406750, DS-1_G2P[4]_HQ650119, RV3_P[6]_U16299, and P[6] strains detected in other countries (JN129097, LC095922, KF835915, and KF726067) and in Korea (MK953605 and G8P[6] from a previous study [6] rotavirus strains in Korean neonates. Gut Pathog. 2018 ">8]). Multiple sequence alignment and translation to amino acids were conducted using the MEGA version 7 program [18]. The 3D structures of the deduced amino acid sequences of the VP8* portion were obtained using the Swiss-Model program [19], PDB (Protein Data Bank. http://www.rcsb.org/) [20], and UCSF Chimera Program [21]. Briefly, the deduced amino acid sequences of the VP8* portion were converted to PDB format files in the Swiss-Model program, and structure comparison analyses were performed using the UCSF Chimera Program using the converted PDB files.

Statistical analysis

The relationship between P[6] and Leb antigen negativity is expressed as a 2 × 2 contingency table, and P was calculated by Fisher’s exact test using MedCalc software version 19 (MedCalc Sofware Ltd, Ostend, Belgium). P < 0.05 was considered statistically significant.

RESULTS

Rotavirus genotype, erythrocyte Lewis antigen phenotypes, and FUT2/FUT3 gene variants in rotavirus infected patients

Table 1 shows the rotavirus genotyping, Lewis antigen phenotyping, and FUT2/FUT3 gene results. Of the 16 rotavirus-positive patients, five patients under one month of age were positive for P[6] (all G8P[6]) rotaviruses; these patients were negative (patients 1, 3, 4, and 5) or weakly positive (patient 2) for the Leb antigen. In contrast, non-P[6] rotaviruses (G2P[4]s, G8P[6] rotavirus strains in Korean neonates. Gut Pathog. 2018 ">8]s, G9P[6] rotavirus strains in Korean neonates. Gut Pathog. 2018 ">8]s, and G1P[6] rotavirus strains in Korean neonates. Gut Pathog. 2018 ">8]) were isolated from older children (except patient 12, aged 20 days); these patients were Leb antigen-positive. Table 2 shows the relationship between P[6] rotavirus and Leb antigen negativity. The patients with Leb antigen-negative phenotypes (patients 1, 3, 4, and 5) showed FUT2 c.418A > T homozygosity, FUT3 c.59T > G homozygosity, or FUT3 c.508G > A homozygosity. The patients with Leb antigen-positive phenotypes did not show FUT2 c.418A > T homozygosity, FUT3 c.59T > G homozygosity, or FUT3 c.508G > A homozygosity. Several other variants were also detected in the FUT2 and FUT3 genes; however, we focused on the FUT2 c.418, c.461, and c.772 and FUT3 c.59, c.202, c.314, c.508, and c.1067 sites.
Table 1

Rotavirus genotype, erythrocyte Lewis antigen phenotype, and FUT2/FUT3 gene variants in patients with rotavirus infection

Rotavirus genotypeCase numberSex/AgeErythrocyte Lewis phenotypeMinor allele homozygosity(FUT2 c.418, c.461, c.772)Minor allele homozygosity(FUT3 c.59, c.202, c.314, c.508, or c.1067)
G8P[6]119RP-09M/15 daysLea(3+) Leb(-)*c.418A > T-
219RP-11M/8 daysLea(1+) Leb(2+)--
319RP-26M/20 daysLea(−) Leb(−)-c.508G > A
419RP-35M/15 daysLea(−) Leb(−)c.418A > Tc.59T > G
519RP-38M/9 daysLea(−) Leb(−)-c.59T > G, c.508G > A
G1P[8]619RP-23F/3 yrLea(−) Leb(4+)--
G8P[8]719RP-04M/6 yrLea(−) Leb(4+)--
819RP-07M/4 yrLea(−) Leb(4+)--
919RP-31F/4 yrLea(−) Leb(4+)--
G9P[8]1019RP-02F/3 yrLea(−) Leb(4+)--
1119RP-15F/6 yrLea(−) Leb(3+)--
1219RP-24F/ 20 daysLea(3+) Leb(3+)--
G2P[4]1319RP-13M/5 yrLea(−) Leb(4+)--
1419RP-17F/10 yrLea(−) Leb(3+)--
1519RP-21F/1 yrLea(−) Leb(4+)--
1619RP-32M/9 yrLea(−) Leb(3+)--

Abbreviations: M, male; F, female.

*Agglutination strength was expressed in the range of - to 4+, according to the manufacturer’s guidelines.

Table 2

Relationship between rotavirus P[6] genotype and Leb antigen negativity in patients with rotavirus infection

Rotavirus genotypeLeb(−)Leb(+)P
P[6]* (N=5)4 (80%)1 (20%)0.0027
Non-P[6]* (N=11)0 (0%)11 (100%)

*All P[6] rotaviruses were isolated from neonates under one month of age, and 10 of the 11 non-P[6] rotaviruses were isolated from older children.

Amino acid sequence of the VP8* portion of the VP4 capsid protein

The amino acid sequences of the VP8* portion of the P[6] rotavirus strains in Korean neonates. Gut Pathog. 2018 ">8], P[4], and P[6] genotypes greatly varied according to the genotype (Table 3). The amino acid sequences of the VP8* portion of Korean P[6] strains (19RP-09_G8P[6], 19RP-26_G8P[6], 19RP-35 G8P[6], 19RP-38 G8P[6], RN-001_KOR_G4P[6], and 27_2017_KOR_G8P[6]) were notably different from those of P[6] strains detected in other countries (P[6] RV3, P[6] Nicaragua, P[6] Vietnam, P[6] Hungary, and P[6] China). The amino acid differences between P[6] strains from other countries and Korean P[6] strains were as follows: N88D, V103I, T125M, K126R, K136T, S145R, S146T, V147A, S148G, R155H, H169L, H178Y, and S188L S189L T198A (yellow shading in Table 3). We omitted the 19RP-11 data in Table 3, because this portion (amino acids 81–230 in Table 3) of the VP4 sequence of 19RP-11 yielded an unclear sequence chromatogram.
Table 3

Deduced amino acid sequences of the antigenic epitopes of the VP8* portion of the VP4 capsid protein

Amino acid8191101111121130
Wa_G1P[8]_JX406750*WILINSNTNGVVYESTNNSDFWTAVVAIEPHVNPVDRQYTIFGESKQFNV
19RP-23_G1P[8]WILINSNTNGVVYESTNNSDFWTAVIAVEPHVDPVDRQYNVFGENKQFNV
19RP-04_G8P[8]WILINSNTNGVVYESTNNSDFWTAVIAVEPHVDPVDRQYNVFGENKQFNV
19RP-07_G8P[8]WILINSNTNGVVYESTNNSDFWTAVIAVEPHVDPVDRQYNVFGENKQFNV
19RP-31_G8P[8]WILINSNTNGVVYESTNNSDFWTAVIAVEPHVDPVDRQYNVFGENKQFNV
19RP-02_G9P[8]WILINSNTNGVVYESTNNSDFWTAVIAVEPHVDPVDRQYNVFGENKQFNV
19RP-15_G9P[8]WILINSNTNGVVYESTNNSDFWTAVIAVEPHVDPVDRQYNVFGENKQFNV
19RP-24_G9P[8]WILINSNTNGVVYESTNNSDFWTAVIAVEPHVDPVDRQYNVFGENKQFNV
DS-1_G2P[4]_HQ650119*WLLISSNTNGVVYESTNNNDFWTAVIAVEPHVSQTNRQYILFGENKQFNV
19RP-13_G2P[4]WLLISSNTDGVVYESTNNSDFWTAVIAVEPHVSPTNRQYVLFGENKQFNV
19RP-17_G2P[4]WLLISSNTDGVVYESTNNSDFWTAVIAVEPHVSPTNRQYVLFGENKQFNV
19RP-21_G2P[4]WLLISSNTDGVVYESTNNSDFWTAVIAVEPHVSQTNRQYVLFGENKQFNI
19RP-32_G2P[4]WLLISSNTDGVVYESTNNSDFWTAVIAVEPHVSPTNRQYVLFGENKQFNV
RV3_P[6]_U16299*WILLNPTNQQVVLEGTNKTDIWVALLLVEPNVTNQSRQYTLFGETKQITV
19RP-09_G8P[6]WILLNPTDQQVVLESTNKTDIWIALLLVEPNVTNQSRQYTLFGEMRQITI
19RP-26_G8P[6]WILLNPTDQQVVLESTNKTDIWIALLLVEPNVTNQSRQYTLFGEMRQITI
19RP-35_G8P[6]WILLNPTDQQVVLESTNKTDIWIALLLVEPNVTNQSRQYTLFGEMRQITI
19RP-38_G8P[6]WILLNPTDQQVVLESTNKTDIWIALLLVEPNVTNQSRQYTLFGEMRQITI
RN-001_KOR_G4P[6]_MK953605WILLNPTDQQVVLESTNKTDIWIALLLVEPNVTNQSRQYTLFGEMRQITI
27_ 2017_KOR_G8P[6] [8]WILLNPTDQQVVLESTNKTDIWIALLLVEPNVTNQSRQYTLFGEMRQITI
P[6] RV3_U16299*WILLNPTNQQVVLEGTNRTDIWVALLLVEPNVTNQSRQYTLFGETKQITV
P[6] Nicaragua_JN129097*WILLNPTNQAVVLEGTNRTDVWVALLLIEPNTPSQSRQYTLFGEIKQISV
P[6] Vietnam 2007_LC095922*WILLSPTNQQVVLEGTNRTDVWVALLLIEPNVTNQSRQYTLFGETKQITV
P[6] Hungary 2002_KF835915*WILLNPTNQKVVLEGTNRADVWVAILLIEPNTINQSRQYTLFGETKQITI
P[6] China 2013_KF726067*WILLSPTNQQVVLEGTNRTDVWVALLLVEPNVTNQSRQYTLFGETKNIITV

Amino acid131141151161171180

Wa_G1P[8]_JX406750*SND--IWKFLEMFRSSSQNEFYNRRTLTSDTRLVGILKYGGRVWTFHGET
19RP-23_G1P[8]RND--IWKFLEMFRGSSQSDFYNRRTLTSDTKLVGILKYGGRIWTFHGET
19RP-04_G8P[8]RND--IWKFLEMFRGGSQSDFYNRRTLTSDTKLVGILKYGGRIWTFHGET
19RP-07_G8P[8]RND--IWKFLEMFRGGSQSDFYNRRTLTSDTKLVGILKYGGRIWTFHGET
19RP-31_G8P[8]RND--IWKFLEMFRGSSQSDFYNRRTLTSDTKLVGILKYGGRIWTFHGET
19RP-02_G9P[8]RND--IWKFLEMFRGSSQSDFYNRRTLTSDTKLVGILKYGGRIWTFHGET
19RP-15_G9P[8]RND--IWKFLEMFRGSSQSDFYNRRTLTSDTKLVGILKYGGRIWTFHGET
19RP-24_G9P[8]RND--IWKFLEMFRGSSQSDFYNRRTLTSDTKLVGILKYGGRIWTFHGET
DS-1_G2P[4]_HQ650119*ENN--IWKFFEMFKGSSQGDFSNRRTLTSSNRLVGMLKYGGRVWTFHGET
19RP-13_G2P[4]ENS--IWKFFEMFKGSSQSDFSNRRTLTSDNRLVGMLKYGGRVWTFHGET
19RP-17_G2P[4]ENS--IWKFFEMFKGSSQSDFSNRRTLTSDNRLVGMLKYGGRVWTFHGET
19RP-21_G2P[4]ENS--TWKFFEMFKGSSQSDFSNRRTLTSNNRLVGMLKYGGRVWTFHGET
19RP-32_G2P[4]ENS--IWKFFEMFKGSSQSDFSNRRTLTSDNRLVGMLKYGGRVWTFHGET
RV3_P[6]_U16299*ENNTNKWKFFEMFRSSVSAEFQHKRTLTSDTKLAGFLKHYNSVWTFHGET
19RP-09_G8P[6]ENN--TWKFFEVFRRTAGAEFQHKHTLTSDTKLAGFLKLYNSVWTFYGET
19RP-26_G8P[6]ENN--TWKFFEVFRRTAGAEFQHKHTLTSDTKLAGFLKLYNSVWTFYGET
19RP-35_G8P[6]ENN--TWKFFEVFRRTAGAEFQHKHTLTSDTKLAGFLKLYNSVWTFYGET
19RP-38_G8P[6]ENN--TWKFFEVFRRTAGAEFQHKHTLTSDTKLAGFLKLYNSVWTFYGET
RN-001_KOR_G4P[6]_MK953605ENN--TWKFFEVFRRTAGAEFQHKHTLTSDTKLAGFLKLYNSVWTFYGET
27_ 2017_KOR_G8P[6] [8]ENN--TWKFFEVFRRTAGAEFQHKHTLTSDTKLAGFLKLYNSVWTFYGET
P[6] RV3_U16299*ENNTNKWKFFEMFRSSVSAEFQHKRTLTSDTKLAGFLKHYNSVWTFHGET
P[6] Nicaragua_JN129097*ENNTNKWKFFEMFRNNINSEFQHKRTLTSDTKLAGFLKHGGRVWTFHGET
P[6] Vietnam 2007_LC095922*ENNTNEWKFYEMFRNSANVEFQHKRTLTSDTKLAGFLKHGGRVWTFHGET
P[6] Hungary 2002_KF835915*ENNSSKWKFFEMFRNNASAEFQHKRTLTSDTKLAGFLKHGGRVWTFHGET
P[6] China 2013_KF726067*ENNTNKWKFYEMFRNNASAEFQPKRTLTSDTKLAGFLKHGGRVWTFHGET

Amino acid181191201211221229

Wa_G1P[8]_JX406750*PRATTDSSSTANLNNISITIHSEFYIIPRSQESKCNEYINNGLPPIQNT
19RP-23_G1P[8]PRATTDSSNTANLNGISITIHSEFYIIPRSQESKCNEYINNGLPPIQNT
19RP-04_G8P[8]PRATTDSSNTANLNGISITIHSEFYIIPRSQESKCNEYINNGLPPIQNT
19RP-07_G8P[8]PRATTDSSNTANLNGISITIHSEFYIIPRSQESKCNEYINNGLPPIQNT
19RP-31_G8P[8]PRATTDSSNTANLNDISITIHSEFYIIPRSQESKCNEYINNGLPPIQNT
19RP-02_G9P[8]PRATTDSSNTANLNGISITIHSEFYIIPRSQESKCNEYINNGLPPIQNT
19RP-15_G9P[8]PRATTDSSNTANLNGISITIHSEFYIIPRSQESKCNEYINNGLPPIQNT
19RP-24_G9P[8]PRATTDSSNTANLNGISITIHSEFYIIPRSQESKCNEYINNGLPPIQNT
DS-1_G2P[4]_HQ650119*PRATTDSSNTADLNNISIIIHSEFYIIPRSQESKCNEYINNGLPPIQNT
19RP-13_G2P[4]PRATTDSSSTADLNNISIIIHSEFYIIPRSQESKCNEYINNGLPPIQNT
19RP-17_G2P[4]PRATTDSSSTADLNNISIIIHSEFYIIPRSQESKCNEYINNGLPPIQNT
19RP-21_G2P[4]PRATTDSSNTADLNNISIIIHSEFYIIPRSQESKCNEYINNGLPPIQNT
19RP-32_G2P[4]PRATTDSSSTADLNNISIIIHSEFYIIPRSQESKCNEYINNGLPPIQNT
RV3_P[6]_U16299*PHATTDYSSTSNLSEVETTIHVEFYIIPRSQESKCVEYINTGL
19RP-09_G8P[6]PHATTDYLLTSNLSEVEAVIHVEFYIIPRSQESKCVEYINNGLPPIQNT
19RP-26_G8P[6]PHATTDYLLTSNLSEVEAVIHVEFYIIPRSQESKCVDYINNGLPPMQNT
19RP-35_G8P[6]PHATTDYLLTSNLSEVEAVILVEFYIIPRSQESKCVEYINNGLPPMQNT
19RP-38_G8P[6]PHATTDYLLTSNLSEVEAVILVEFYIIPRSQESKCVEYINNGLPPMQNT
RN-001_KOR_G4P[6]_MK953605PHATTDYLLTSNLSEVEAVIHVEFYIIPRSQESKCVEYINTGLPPMQNT
27_2017_KOR_G8P[6] [8]PHATTDYLLTSNLSEVEAVIHVEFYIIPRSQESKCVEYINNGLPPMQNT
P[6] RV3_U16299*PHATTDYSSTSNLSEVETTIHVEFYIIPRSQESKCVEYINTGL
P[6] Nicaragua_JN129097*PHATTDYSTSNLSEVIETVIHAEFYIIPRSQESKCNEYINTGL
P[6] Vietnam 2007_LC095922*PHATTDYSSSNLSEVIETVIHTEFYIIPRSQESKCNEYINTGL
P[6] Hungary 2002_KF835915*PNATTDYSTSNLSPDIETVIHTDFYIIPRSQESKCKEYINTGL
P[6] China 2013_KF726067*PHATTDYSSSNLSEVVETVIHTEFYIIPRSQESKCNEYINTGL

*These sequences were obtained from GenBank.

Brown shading indicates amino acids that differ from USA-Wa_G1P[8], and yellow shading indicates amino acids that differ from 19RP-09 G8P[6] strains detected in Korean neonates.

3D structure of the VP8* glycoprotein

Fig. 1 shows the superposition of the P[6] VP8*, P[4] VP8*, and P[6] rotavirus strains in Korean neonates. Gut Pathog. 2018 ">8] VP8* structures deduced from the VP4 amino acid sequences of P[6], P[4], and P[6] rotavirus strains in Korean neonates. Gut Pathog. 2018 ">8] strains. Rotaviruses with similar genotypes showed nearly the same 3D structures of the VP8* portion, although one or two amino-acid sequence differences were observed. Despite the differences in amino acid sequences at various sites between P[4], P[6], and P[6] rotavirus strains in Korean neonates. Gut Pathog. 2018 ">8], only a slight structural difference was observed.
Fig. 1

Superposition of P[6] VP8*, P[4] VP8*, and P[8] VP8* structures deduced from the VP4 nucleotide sequences. Sky blue, P[6]; gold, P[8]; and pink, P[4].

DISCUSSION

We investigated the relationship between rotavirus genotypes and HBGA-Lewis blood type in Korean children with rotavirus infections, and explored the reason for the P[6] genotype predominance in Korean neonates. Although the number of cases was small, all P[6] rotaviruses were isolated from neonates who were Leb antigen-negative or weakly positive. In contrast, nonP[6] rotaviruses were isolated from older children (except for patient 12, aged 20 days) who were Leb antigen-positive. These results suggest that neonate-specific P[6] rotaviruses easily infect neonates who are negative or weakly positive for Leb antigen, but rarely infect patients who are Leb antigen-positive or older children. Our results are supported by recent studies showing that rotavirus P[6] strains can infect Lewis-negative individuals, regardless of their secretor status [22, 23]. In the neonate gut, modification to the precursor moieties or branching of Lewis HBGA is developmentally regulated, and thus the most abundant type of Lewis HBGA in the neonate gut is the unbranched type I precursor glycan, Le(a-b-) [24]. Only a few studies in Africa have also reported the relationship between P[6] and neonates; however, the proportion of P[6] infection in neonates were at most 25% in those studies [22, 25, 26]. This phenomenon may be related to the higher proportion of Le(a-b-) in Koreans and Africans than in Caucasian or Chinese populations [14, 22, 27, 28]. Contrarily, this may be related to the noted differences in the VP8* amino acid sequences between the Korean rotavirus P[6] strains and those of the P[6] strains detected in other countries (Table 3). In terms of differences in the 3D structure between the rotavirus VP8* portion and Lewis HBGA, the cleft between the betasheets of rotavirus P[6] has been reported to be wider than that in P[14], and rotavirus P[6] has been suggested to bind to the unbranched type I precursor glycan, Le(a-b-), rather than to the branched HBGA, Le(a-b+) [12]. However, in our study, the cleft between the beta-sheets of the P[6] rotavirus was not markedly wider than that of P[4] or P[8] strains (Fig. 1). A previous study suggested that a single residue of the neonatal P[6] VP8*, specifically H169, which is well conserved in most neonate-specific P[6] genotypes, alters the glycan conformation [12]. However, all neonatal G8P[6] in this study showed a different amino acid residue, L169 instead of H169, which can cause P[6] infection in Korean neonates. Other amino acid substitutions at different sites (N88D, V103I, T125M, K126R, K136T, S145R, S146T, V147A, S148G, R155H, H169L, H178Y, S188L S189L, and T198A) may cause a small change in the 3D structure or hydrogen bond/hydrophobic interaction between the VP8* of the rotavirus VP4 protein and HBGA molecules in patients, which may involve ageor population-related tropism of some P[6] strains [12]. The Lewis histo-blood group system consists of two major antigens, Lea and Leb, and four phenotypes, Le(a-b-), Le(a+b-), Le (a-b+), and Le(a+b+) [29]. Lewis antigen synthesis depends on the interaction of FUT3 and FUT2. Although the number of cases in our study was too small to reveal the relationship between phenotype and genotype, our results are compatible with previous interpretations of Lewis genotypes [16, 17]. In terms of FUT2, patients harboring homozygous G428A (c.461) and G739A (c.772) variants were non-secretors, and those with a homozygous A385T (c.418) variants were weak secretors. Patients who were wild-type or harbored heterozygous variants at these sites were designated as secretors. In terms of FUT3, patients who harbored homozygous variants for at least T202C (c.202), G508A (c.508), or T1067A (c.1067) were designated as Le(a-b-) [16]. In another study, patients with wild-type FUT2 and FUT3 were classified as Leb-positive secretors [Se+, Le(a-b+)]; patients who were homozygous for the minor allele in FUT2 at rs601338 (G428A, c.461) and/or rs602662 (G739A, c.772), with a wild-type FUT3 genotype were classified as Leb-negative non-secretors [Se-, Le(a+b-)]; patients homozygous for the minor allele in FUT3 at rs778986 (C314T, c.314), rs28362459 (T59G, c.59), rs3894326 (T1067A, c.1067), and/or rs3745635 (G508A, c.508), with a wild-type FUT2 genotype were considered to have a secretor Lewis-null phenotype [Se+, Le(a-b-)]; and those homozygous for the minor allele at one or more sites in FUT2 and FUT3 were considered to have a non-secretor Lewis-null phenotype [Se-, Le(a-b-)] [17]. To the best of our knowledge, the relationship between all Lewis gene variants and the Lewis antigen phenotypes has not been clearly established and thus, there were slight differences in interpretation across the studies. Therefore, we focused on the FUT2 c.418, c.461, and c.772 and the FUT3 c.59, c.202, c.314, c.508, and c.1067 sites. Further studies will be needed to elucidate the relationship between all variants of Lewis-related genes and Lewis antigen phenotypes. In conclusion, we found that the rotavirus P[6] genotype predominance in Korean neonates may be related to the interaction between the patient’s HBGA-Lewis antigen phenotype and the VP8* portion of the rotavirus VP4 capsid protein. Four possible explanations are suggested: (1) P[6] infection may be related to Leb antigen-negative or weakly positive status; (2) Lewis antigens are not fully developed in the neonate gut; (3) the proportion of Le(a-b-) is higher in Korea than in other countries; and (4) the antigenicity of rotavirus P[6] strains isolated in Korea is different from that of P[6] strains isolated in other countries. Although, this study is limited with the small number of patients, the results provide valuable information on future development of neonatal rotavirus vaccine.
  25 in total

1.  Both Lewis and secretor status mediate susceptibility to rotavirus infections in a rotavirus genotype-dependent manner.

Authors:  Johan Nordgren; Sumit Sharma; Filemon Bucardo; Waqas Nasir; Gökçe Günaydın; Djeneba Ouermi; Leon W Nitiema; Sylvia Becker-Dreps; Jacques Simpore; Lennart Hammarström; Göran Larson; Lennart Svensson
Journal:  Clin Infect Dis       Date:  2014-08-05       Impact factor: 9.079

2.  Human P[6] Rotaviruses From Sub-Saharan Africa and Southeast Asia Are Closely Related to Those of Human P[4] and P[8] Rotaviruses Circulating Worldwide.

Authors:  Elisabeth Heylen; Mark Zeller; Max Ciarlet; Jody Lawrence; Duncan Steele; Marc Van Ranst; Jelle Matthijnssens
Journal:  J Infect Dis       Date:  2016-07-28       Impact factor: 5.226

3.  Lewis and Secretor gene effects on Lewis antigen and postnatal development of Lewis blood type.

Authors:  S Ameno; H Kimura; K Ameno; X Zhang; H Kinoshita; T Kubota; I Ijiri
Journal:  Biol Neonate       Date:  2001-02

4.  Fucosyltransferase Gene Polymorphisms and Lewisb-Negative Status Are Frequent in Swedish Newborns, With Implications for Infectious Disease Susceptibility and Personalized Medicine.

Authors:  Jovanka R King; Jezabel Varadé; Lennart Hammarström
Journal:  J Pediatric Infect Dis Soc       Date:  2019-12-27       Impact factor: 3.164

5.  Association between norovirus and rotavirus infection and histo-blood group antigen types in Vietnamese children.

Authors:  Nguyen Van Trang; Hau ThiBich Vu; Nhung ThiHong Le; Pengwei Huang; Xi Jiang; Dang Duc Anh
Journal:  J Clin Microbiol       Date:  2014-02-12       Impact factor: 5.948

6.  Lewis enzyme (alpha1-3/4 fucosyltransferase) polymorphisms do not explain the Lewis phenotype in the gastric mucosa of a Portuguese population.

Authors:  Jacinta Serpa; Raquel Almeida; Carla Oliveira; Filipe Santos Silva; Elisabete Silva; Celso Reis; Jacques Le Pendu; Graça Oliveira; Luís Manuel Cunha Ribeiro; Leonor David
Journal:  J Hum Genet       Date:  2003-03-20       Impact factor: 3.172

7.  Cell attachment protein VP8* of a human rotavirus specifically interacts with A-type histo-blood group antigen.

Authors:  Liya Hu; Sue E Crawford; Rita Czako; Nicolas W Cortes-Penfield; David F Smith; Jacques Le Pendu; Mary K Estes; B V Venkataram Prasad
Journal:  Nature       Date:  2012-04-15       Impact factor: 49.962

8.  SWISS-MODEL: homology modelling of protein structures and complexes.

Authors:  Andrew Waterhouse; Martino Bertoni; Stefan Bienert; Gabriel Studer; Gerardo Tauriello; Rafal Gumienny; Florian T Heer; Tjaart A P de Beer; Christine Rempfer; Lorenza Bordoli; Rosalba Lepore; Torsten Schwede
Journal:  Nucleic Acids Res       Date:  2018-07-02       Impact factor: 16.971

9.  Unraveling the role of the secretor antigen in human rotavirus attachment to histo-blood group antigens.

Authors:  Roberto Gozalbo-Rovira; J Rafael Ciges-Tomas; Susana Vila-Vicent; Javier Buesa; Cristina Santiso-Bellón; Vicente Monedero; María J Yebra; Alberto Marina; Jesús Rodríguez-Díaz
Journal:  PLoS Pathog       Date:  2019-06-21       Impact factor: 6.823

10.  Human Neonatal Rotavirus Vaccine (RV3-BB) Produces Vaccine Take Irrespective of Histo-Blood Group Antigen Status.

Authors:  Karen Boniface; Sean G Byars; Daniel Cowley; Carl D Kirkwood; Julie E Bines
Journal:  J Infect Dis       Date:  2020-03-16       Impact factor: 5.226

View more
  2 in total

Review 1.  The Role of Host Glycobiology and Gut Microbiota in Rotavirus and Norovirus Infection, an Update.

Authors:  Nazaret Peña-Gil; Cristina Santiso-Bellón; Roberto Gozalbo-Rovira; Javier Buesa; Vicente Monedero; Jesús Rodríguez-Díaz
Journal:  Int J Mol Sci       Date:  2021-12-15       Impact factor: 5.923

Review 2.  Serological Humoral Immunity Following Natural Infection of Children with High Burden Gastrointestinal Viruses.

Authors:  Mark R Zweigart; Sylvia Becker-Dreps; Filemón Bucardo; Fredman González; Ralph S Baric; Lisa C Lindesmith
Journal:  Viruses       Date:  2021-10-09       Impact factor: 5.048

  2 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.