Literature DB >> 32934753

Nucleotide sequencing of the HoxA gene cluster using Gorilla fosmid clones.

Takashi Kitano1, Choong-Gon Kim1, Naruya Saitou1.   

Abstract

We sequenced the western gorilla (Gorilla gorilla) HoxA cluster region using seven fosmid clones, and found that the total tiling path sequence was 214,185 bp from the 5' non-genic region of HoxA1 to the 3' non-genic region of Evx1. We compared the nucleotide sequence with the gorilla genome sequence in the NCBI database, and the overall proportion of nucleotide difference was estimated to be 0.0005-0.0007. These estimates are lower than overall genomic polymorphism in gorillas. © The author(s).

Entities:  

Keywords:  Fosmid library; Gorilla; HoxA

Year:  2020        PMID: 32934753      PMCID: PMC7484619          DOI: 10.7150/jgen.50468

Source DB:  PubMed          Journal:  J Genomics


Introduction

The euchromatic sequence of the human genome was sequenced using the hierarchical shotgun sequencing strategy, also known as clone-by-clone sequencing, by the International Human Genome Sequencing Consortium 1. With the advent of next-generation sequencer (NGS), the hierarchical shotgun sequencing strategy is now less commonly used. However, hierarchical shotgun sequencing involving bacterial artificial chromosomes (BACs) and fosmids is still used for some purposes, such as to determine the long complete haploid in a chromosome region. Kim et al. 2 constructed a western gorilla (Gorilla gorilla) fosmid library and established a simple polymerase chain reaction (PCR) screening system for it. They also selected seven fosmid clones, which constitutes the minimum tiling path for the entire HoxA gene cluster in the gorilla genome 2. In this study we sequenced these fosmid clones and used them in our analysis.

Materials and Methods

Seven fosmid clones originated from one female gorilla individual “Taiko” (GGFP-562J15, GGFP-367A20, GGFP-347D05, GGFP-175G07, GGFP-452O13, GGFP-012E07, and GGFP-210K06) were screened and selected in a previous study 2. These seven clones were used for this study. We determined nucleotide sequences primarily using the hierarchical shotgun sequencing method, as previously described 3, by sequencing each clone with more than tenfold-coverage. For base-calling, assembly, and to obtain a quality score for both raw and assembled data we used the Phred-Phrap software package 4. Editing was performed with Consed 5. Finishing was carried out by primer walking and PCR-coupled primer walking. The fosmid sequences were compared with the nucleotide sequences (assembly NC_044609.1 from the Kamilah_GGO_v0 genome) available in the National Center for Biotechnology Information (NCBI) database. Pairwise sequence alignment was done manually using MEGA7 software 6. Transitions, transversions, synonymous and nonsynonymous substitutions were counted using this software. Synonymous and nonsynonymous substitutions were estimated using Nei and Gojobori's method 7. When counting substitutions, the cluster sequence was divided into coding sequence (CDS), intron, and inter-genic regions. The 53 amino acid residues (e.g. RTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQK from HOXA1) were used as the homeodomain regions.

Results and Discussion

The nucleotide sequences of the seven fosmid clones are as follows: GGFP-562J15 (39,323 bp), GGFP-367A20 (41,479 bp), GGFP-347D05 (34,811 bp), GGFP-175G07 (37,837 bp), GGFP-452O13 (36,576 bp), GGFP-012E07 (41,057 bp), and GGFP-210K06 (40,950 bp) (Figure ). We found four identical overlapping regions: 4,635 bp of nucleotides between GGFP-562J15 (AB125652) and GGFP-367A20 (AB125653); 10,316 bp of nucleotides between GGFP-367A20 (AB125653) and GGFP-347D05 (AB125654); 2,819 bp of nucleotides between GGFP-452O13 (AB125656) and GGFP-012E07 (AB125657); and 3,986 bp of nucleotides between GGFP-012E07 (AB125657) and GGFP-210K06 (AB125658). The overlap region between GGFP-175G07 (AB125655) and GGFP-452O13 (AB125656) had one indel in 26,513 bp. We used PCR to sequence this region using the genomic DNA of the gorilla (Taiko), and we confirmed the probable loss of one base in GGFP-452O13 (AB125656). The nucleotides in the overlap region between GGFP-347D05 (AB125654) and GGFP-175G07 (AB125655) differed by 0.09% (9/9,560 bp). We therefore linked and concatenated GGFP-562J15, GGFP-367A20, and GGFP-347D05 as “concatenated haploid sequence 1” (100,662 bp) and GGFP-175G07, GGFP-452O13, GGFP-012E07, and GGFP-210K06 as “concatenated haploid sequence 2” (123,103 bp) (Figure ). The nucleotide difference of 0.09% between GGFP-347D05 (AB125654) and GGFP-175G07 (AB125655) can be considered the difference between maternal and paternal chromosomes. We compared the nucleotide difference (p-distance) between our two concatenated haploid gorilla fosmid sequences and the whole-genome shotgun sequence of the gorilla (assembly NC_044609.1 from the Kamilah_GGO_v0 genome) (Table ). The overall nucleotide difference in the HoxA cluster region between concatenated haploid sequence 1 and the shotgun sequence (100,577 bp) was 0.0005, and between concatenated haploid sequence 2 and the shotgun sequence (123,061 bp) was 0.0008. These estimates were lower than the genomic polymorphisms reported from two other western gorillas [Kamilah: 0.189% (0.00189), EB(JC): 0.178% (0.00178)] 8. These results are reasonable, because nucleotide differences in the HoxA gene cluster region are expected to be lower than in other genomic regions. In the intron regions, the average p-distance was 0.0007, ranging from 0 [in HoxA1, HoxA2, HoxA7 (in concatenated haploid sequence 2)], HoxA9, HoxA13, and Evx1) to 0.0021 (in HoxA5). In the CDS regions, the average p-distance was 0.0004, ranging from 0 [in HoxA1, HoxA3, HoxA6, HoxA7 (in concatenated haploid sequence 1), HoxA7 (in concatenated haploid sequence 2), HoxA11, HoxA13, and Evx1] to 0.0012 (in HoxA5 and HoxA9). One synonymous difference was observed in HoxA2. One nonsynonymous difference was observed for each of HoxA4, HoxA5, and HoxA9, although these changes were not located in homeobox regions. An 18 bp gap was observed in exon 1 of HoxA10. The fosmid sequences were 18 bp longer than the whole-genome shotgun sequence of the gorilla (assembly NC_044609.1 from the Kamilah_GGO_v0 genome). When we examined the same region in humans (Homo sapiens), chimpanzees (Pan troglodytes), and orangutans (Pongo abelii), we found that they did not contain the 18 bp insertion. We used PCR to sequence this region in the DNA of the gorilla (Taiko) genome and confirmed that Taiko did have the 18 bp insertion. Because this insertion was observed in the non-homeobox region, we hypothesize that this insertion does not affect the fundamental function of HoxA10. In the intergenic regions, the average p-distance was 0.0007, ranging from 0 [in the intergenic A1-A2 and A6-A7 (in concatenated haploid sequence 2)] to 0.0012 [in the intergenic A4-A5, A7-A9 (in concatenated haploid sequence 1), A10-A11, and A13-EVX1]. The differences observed in these intergenic regions were comparable with those observed in the intron regions. The estimates for the CDS, introns, and intergenic regions were lower than the genomic polymorphisms reported from two other western gorillas (Kamilah: 0.00189, EB(JC): 0.00178) 8. It has been previously reported that the four Hox gene clusters have the lowest density of interspersed repeats in the human genome 9, probably because of the large-scale cis-regulatory elements that cannot tolerate being interrupted by insertions 10-12. The lower estimates we observed in the HoxA gene cluster region are therefore reasonable. In conclusion, we successfully sequenced the HoxA cluster region of the gorilla. This region consists of two stretched haploid sequences that will be available for further analysis, including cis-regulatory element, linkage disequilibrium, and recombination.
Table 1

Nucleotide differences in the HoxA gene cluster sequences between two gorillas

RegionBp comparedtstvts+tvp-distancesn*
Concatenated haploid sequence 1 (AB125652-AB125654) vs. NC_044609.1
5p non-genic33,7046390.0003
A1 CDS1,0080000.000000
A1 intron4650000.0000
intergenic A1-A24,8220000.0000
A2 CDS1,1281010.000910
A2 intron6400000.0000
intergenic A2-A35,3930110.0002
A3 CDS1,3320000.000000
A3 intron1,3962020.0014
intergenic A3-A418,5214590.0005
A4 CDS9630110.001001 (D/H)
A4 intron5461010.0018
intergenic A4-A511,08185130.0012
A5 CDS8131010.001201 (G/S)
A5 intron9601120.0021
intergenic A5-A62,0301120.0010
A6 CDS7020000.000000
A6 intron1,3831010.0007
intergenic A6-A77,2013250.0007
A7 CDS6930000.000000
A7 intron9171010.0011
intergenic A7-A94,8795160.0012
sum100,5773520550.0005
Concatenated haploid sequence 2 (AB125655-AB125658) vs. NC_044609.1
intergenic A6-A73,0760000.0000
A7 CDS6930000.000000
A7 intron9320000.0000
intergenic A7-A97,0492460.0009
A9 CDS8190110.001201 (S/C)
A9 intron1,0360000.0000
intergenic A9-A106,4563470.0011
A10 CDS1,2331010.000800
A10 intron1,1751120.0017
intergenic A10-A118,48364100.0012
A11 CDS9450000.000000
A11 intron1,3991010.0007
intergenic A11-A1313,03574110.0008
A13 CDS1,1670000.000000
A13 intron7130000.0000
intergenic A13-EVX142,9313714510.0012
EVX1 CDS1,2270000.000000
EVX1 introns2,1770000.0000
3p non-genic28,51582100.0004
sum123,06166341000.0008

ts: transition, tv: transversion, s: synonymous substitution, n: nonsynonymous substitution;

*Amino acid differences are shown in parentheses.

  12 in total

1.  Initial sequencing and analysis of the human genome.

Authors:  E S Lander; L M Linton; B Birren; C Nusbaum; M C Zody; J Baldwin; K Devon; K Dewar; M Doyle; W FitzHugh; R Funke; D Gage; K Harris; A Heaford; J Howland; L Kann; J Lehoczky; R LeVine; P McEwan; K McKernan; J Meldrim; J P Mesirov; C Miranda; W Morris; J Naylor; C Raymond; M Rosetti; R Santos; A Sheridan; C Sougnez; Y Stange-Thomann; N Stojanovic; A Subramanian; D Wyman; J Rogers; J Sulston; R Ainscough; S Beck; D Bentley; J Burton; C Clee; N Carter; A Coulson; R Deadman; P Deloukas; A Dunham; I Dunham; R Durbin; L French; D Grafham; S Gregory; T Hubbard; S Humphray; A Hunt; M Jones; C Lloyd; A McMurray; L Matthews; S Mercer; S Milne; J C Mullikin; A Mungall; R Plumb; M Ross; R Shownkeen; S Sims; R H Waterston; R K Wilson; L W Hillier; J D McPherson; M A Marra; E R Mardis; L A Fulton; A T Chinwalla; K H Pepin; W R Gish; S L Chissoe; M C Wendl; K D Delehaunty; T L Miner; A Delehaunty; J B Kramer; L L Cook; R S Fulton; D L Johnson; P J Minx; S W Clifton; T Hawkins; E Branscomb; P Predki; P Richardson; S Wenning; T Slezak; N Doggett; J F Cheng; A Olsen; S Lucas; C Elkin; E Uberbacher; M Frazier; R A Gibbs; D M Muzny; S E Scherer; J B Bouck; E J Sodergren; K C Worley; C M Rives; J H Gorrell; M L Metzker; S L Naylor; R S Kucherlapati; D L Nelson; G M Weinstock; Y Sakaki; A Fujiyama; M Hattori; T Yada; A Toyoda; T Itoh; C Kawagoe; H Watanabe; Y Totoki; T Taylor; J Weissenbach; R Heilig; W Saurin; F Artiguenave; P Brottier; T Bruls; E Pelletier; C Robert; P Wincker; D R Smith; L Doucette-Stamm; M Rubenfield; K Weinstock; H M Lee; J Dubois; A Rosenthal; M Platzer; G Nyakatura; S Taudien; A Rump; H Yang; J Yu; J Wang; G Huang; J Gu; L Hood; L Rowen; A Madan; S Qin; R W Davis; N A Federspiel; A P Abola; M J Proctor; R M Myers; J Schmutz; M Dickson; J Grimwood; D R Cox; M V Olson; R Kaul; C Raymond; N Shimizu; K Kawasaki; S Minoshima; G A Evans; M Athanasiou; R Schultz; B A Roe; F Chen; H Pan; J Ramser; H Lehrach; R Reinhardt; W R McCombie; M de la Bastide; N Dedhia; H Blöcker; K Hornischer; G Nordsiek; R Agarwala; L Aravind; J A Bailey; A Bateman; S Batzoglou; E Birney; P Bork; D G Brown; C B Burge; L Cerutti; H C Chen; D Church; M Clamp; R R Copley; T Doerks; S R Eddy; E E Eichler; T S Furey; J Galagan; J G Gilbert; C Harmon; Y Hayashizaki; D Haussler; H Hermjakob; K Hokamp; W Jang; L S Johnson; T A Jones; S Kasif; A Kaspryzk; S Kennedy; W J Kent; P Kitts; E V Koonin; I Korf; D Kulp; D Lancet; T M Lowe; A McLysaght; T Mikkelsen; J V Moran; N Mulder; V J Pollara; C P Ponting; G Schuler; J Schultz; G Slater; A F Smit; E Stupka; J Szustakowki; D Thierry-Mieg; J Thierry-Mieg; L Wagner; J Wallis; R Wheeler; A Williams; Y I Wolf; K H Wolfe; S P Yang; R F Yeh; F Collins; M S Guyer; J Peterson; A Felsenfeld; K A Wetterstrand; A Patrinos; M J Morgan; P de Jong; J J Catanese; K Osoegawa; H Shizuya; S Choi; Y J Chen; J Szustakowki
Journal:  Nature       Date:  2001-02-15       Impact factor: 49.962

2.  Construction of a gorilla fosmid library and its PCR screening system.

Authors:  Choong Gon Kim; Asao Fujiyama; Naruya Saitou
Journal:  Genomics       Date:  2003-11       Impact factor: 5.736

3.  Evolution of conserved non-coding sequences within the vertebrate Hox clusters through the two-round whole genome duplications revealed by phylogenetic footprinting analysis.

Authors:  Masatoshi Matsunami; Kenta Sumiyama; Naruya Saitou
Journal:  J Mol Evol       Date:  2010-10-28       Impact factor: 2.395

4.  Base-calling of automated sequencer traces using phred. I. Accuracy assessment.

Authors:  B Ewing; L Hillier; M C Wendl; P Green
Journal:  Genome Res       Date:  1998-03       Impact factor: 9.043

5.  MEGA7: Molecular Evolutionary Genetics Analysis Version 7.0 for Bigger Datasets.

Authors:  Sudhir Kumar; Glen Stecher; Koichiro Tamura
Journal:  Mol Biol Evol       Date:  2016-03-22       Impact factor: 16.240

6.  Simple methods for estimating the numbers of synonymous and nonsynonymous nucleotide substitutions.

Authors:  M Nei; T Gojobori
Journal:  Mol Biol Evol       Date:  1986-09       Impact factor: 16.240

7.  Finishing the euchromatic sequence of the human genome.

Authors: 
Journal:  Nature       Date:  2004-10-21       Impact factor: 49.962

8.  DNA sequence and comparative analysis of chimpanzee chromosome 22.

Authors:  H Watanabe; A Fujiyama; M Hattori; T D Taylor; A Toyoda; Y Kuroki; H Noguchi; A BenKahla; H Lehrach; R Sudbrak; M Kube; S Taenzer; P Galgoczy; M Platzer; M Scharfe; G Nordsiek; H Blöcker; I Hellmann; P Khaitovich; S Pääbo; R Reinhardt; H-J Zheng; X-L Zhang; G-F Zhu; B-F Wang; G Fu; S-X Ren; G-P Zhao; Z Chen; Y-S Lee; J-E Cheong; S-H Choi; K-M Wu; T-T Liu; K-J Hsiao; S-F Tsai; C-G Kim; S OOta; T Kitano; Y Kohara; N Saitou; H-S Park; S-Y Wang; M-L Yaspo; Y Sakaki
Journal:  Nature       Date:  2004-05-27       Impact factor: 49.962

9.  Insights into hominid evolution from the gorilla genome sequence.

Authors:  Aylwyn Scally; Julien Y Dutheil; LaDeana W Hillier; Gregory E Jordan; Ian Goodhead; Javier Herrero; Asger Hobolth; Tuuli Lappalainen; Thomas Mailund; Tomas Marques-Bonet; Shane McCarthy; Stephen H Montgomery; Petra C Schwalie; Y Amy Tang; Michelle C Ward; Yali Xue; Bryndis Yngvadottir; Can Alkan; Lars N Andersen; Qasim Ayub; Edward V Ball; Kathryn Beal; Brenda J Bradley; Yuan Chen; Chris M Clee; Stephen Fitzgerald; Tina A Graves; Yong Gu; Paul Heath; Andreas Heger; Emre Karakoc; Anja Kolb-Kokocinski; Gavin K Laird; Gerton Lunter; Stephen Meader; Matthew Mort; James C Mullikin; Kasper Munch; Timothy D O'Connor; Andrew D Phillips; Javier Prado-Martinez; Anthony S Rogers; Saba Sajjadian; Dominic Schmidt; Katy Shaw; Jared T Simpson; Peter D Stenson; Daniel J Turner; Linda Vigilant; Albert J Vilella; Weldon Whitener; Baoli Zhu; David N Cooper; Pieter de Jong; Emmanouil T Dermitzakis; Evan E Eichler; Paul Flicek; Nick Goldman; Nicholas I Mundy; Zemin Ning; Duncan T Odom; Chris P Ponting; Michael A Quail; Oliver A Ryder; Stephen M Searle; Wesley C Warren; Richard K Wilson; Mikkel H Schierup; Jane Rogers; Chris Tyler-Smith; Richard Durbin
Journal:  Nature       Date:  2012-03-07       Impact factor: 49.962

10.  Vertebrate paralogous conserved noncoding sequences may be related to gene expressions in brain.

Authors:  Masatoshi Matsunami; Naruya Saitou
Journal:  Genome Biol Evol       Date:  2013       Impact factor: 3.416

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.