Literature DB >> 32650719

Genome-wide identification and transcript profiles of walnut heat stress transcription factor involved in abiotic stress.

Xuejiao Liu1, Panpan Meng1, Guiyan Yang1, Mengyan Zhang1, Shaobing Peng2, Mei Zhi Zhai1.   

Abstract

BACKGROUND: Walnut (Juglans regia) is an important tree cultivated worldwide and is exposed to a series of both abiotic and biotic stress during their life-cycles. The heat stress transcription factors (HSFs) play a crucial role in plant response to various stresses by regulating the expression of stress-responsive genes. HSF genes are classified into 3 classes: HSFA, HSFB, and HSFC. HSFA gene has transcriptional activation function and is the main regulator of high temperature-induced gene expression. HSFB gene negatively regulates plant resistance to drought and NaCl. And HSFC gene may be involved in plant response to various stresses. There are some reports about the HSF family in herbaceous plants, however, there are no reports about the HSFs in walnut. RESULT: In this study, based on the complete genome sequencing of walnut, the bioinformatics method was used and 29 HSF genes were identified. These HSFs covered 18 HSFA, 9 HSFB, and 2 HSFC genes. Phylogenetic analysis of these HSF proteins along with those from Arabidopsis thaliana showed that the HSFs in the two species are closely related to each other and have different evolutionary processes. The distribution of conserved motifs and the sequence analysis of HSF genes family indicated that the members of the walnut HSFs are highly conserved. Quantitative Real-Time PCR (qRT-PCR) analysis revealed that the most of walnut HSFs were expressed in the walnut varieties of 'Qingxiang' and 'Xiangling' under high temperature (HT), high salt and drought stress, and some JrHSFs expression pattern are different between the two varieties.
CONCLUSION: The complex HSF genes family from walnut was confirmed by genome-wide identification, evolutionary exploration, sequence characterization and expression analysis. This research provides useful information for future studies on the function of the HSF genes and molecular mechanism in plant stress response.

Entities:  

Keywords:  Expression profiles; Heat stress transcription factors (HSFs); Motif distribution; Multiple alignments; Phylogenetic analysis

Mesh:

Substances:

Year:  2020        PMID: 32650719      PMCID: PMC7350716          DOI: 10.1186/s12864-020-06879-2

Source DB:  PubMed          Journal:  BMC Genomics        ISSN: 1471-2164            Impact factor:   3.969


Background

Walnut (Juglans regia) is an important nut tree cultivated worldwide [1]. In 2017, its planting area was about 489,866 ha, and the output was about 1,925,403 tons in China (FAO, http://www.fao.org/faostat/en/#data/QC/visualize). However, the walnut is suffering from both abiotic (e.g., high temperature, drought, high salt, chilling.) and biotic (e.g., pathogenic microorganisms and pests) stresses during its life-cycle. In recent years, as “greenhouse effect” has intensified all around the world, high temperature (HT) have reduced the yield of most agricultural and forestry crops to some degree, including the walnut plants. It is generally believed that with a temperature 10 °C to 15 °C higher than the ambient temperature, plants would have a heat shock response (HSR) and obtain a heat resistance quickly within a few hours to withstand the HT which may be lethal [2]. Meanwhile, in China, walnuts are mainly planted in arid and semi-arid regions, where are drought and less rainfall in spring and summer, and precipitation is unevenly distributed. Therefore, moisture is one of the key factors that affect the growth and development of walnuts, as well as the yield and quality of nuts [3]. Moreover, soil salinization and secondary salinization deserve attention. Excessive salt can cause imbalance in osmotic regulation of plants, and excessive accumulation of Na+ can also cause ion toxicity. Therefore, the effect of the HT, drought and salt stress on the growth and development of the walnut cannot be ignored. Gene expression changes triggered by various abiotic stresses are important mechanisms that enable plants to respond and adapt to adverse conditions and thus ensure survival [4]. Therefore, the possible impact of heat, salt and drought stress on walnuts and its molecular mechanisms have been widely surveyed in recent years [5]. Heat stress transcription factors (HSFs) is a protein with transcriptional regulatory activity that responds to a variety of stresses [6]. HSF proteins have five typical structural features: a highly conserved DNA-binding domain (DBD) at the N-terminus, an oligomerization domain (OD or HR-A/B), a nuclear localization signal (NLS), a nuclear export signal (NES) and a C-terminal domain (CTD) at the C-terminus [7]. The DBD domain of HSFs can accurately recognize the heat shock element (HSE: 5′-AGAAnnTTCT-3′; n: any base) that located in the upstream promoter region of heat shock proteins (HSPs) genes and induce the transcription of HSP genes [8, 9]. Depending on the number of amino acids that inserted between the A and B segments of the HR-A/B region, HSF genes are classified into 3 classes: HSFA, HSFB, and HSFC. The structure of the class HSFB is relatively simple and has no amino acid inserted between the A and B segments, whereas the classes HSFA and HSFC have 21 and 7 amino acids inserted between the A and B segments, respectively [10]. The CTD of most class HSFA is acidic and contains short peptide motifs (acidic amino acid residues, AHA: Activator motifs) with central Trp or Phe residues [11, 12]. The AHA motifs are essential for activation function, and a similar motif has also been identified as part of the activation region of transcription factors (TFs) in mammalian and yeast (Saccharomyces cerevisiae) [12, 13]. HSFB and HSFC lack the AHA motifs; and therefore, they are considered to have no transcriptional activation function. Under normal conditions, HSFs exists in the cytoplasm and nucleoplasm without the activity binding to DNA. HSP70 (or HSP90 and multi-companion complex) interacts with HSFs to make HSFs in a passivated monomer state. However, abnormal proteins will be produced during heat shock and then HSPs can be deprived from HSFs and release HSFs, further, HSFs in the nucleus will be assembled into a trimer that binds to the thermal response element at the 5′ end of the heat shock to induce transcription [14]. Although the adversity response function of HSF genes is not well understood in most plants, the information about the HSFs has accumulated in A. thaliana and Lycopersicon esculentum. For example, in L. esculentum, HSFA1a has been found to be a major regulator for the induction of heat-resistant genes and synthesis of HSFA2 and HSFB1 [15, 16]; The expression of HSFA1, HSFA2 and HSFB1 were affected by salicylic acid (SA) under heat shock conditions [17]. In A. thaliana, HSF1, HSF3, HSFA2 and HSFA3 are related to heat tolerance, and HSFA2 is the most strongly induced one by heat; overexpression of HSFA2 not only enhances plants with basic and heat resistance, but also improves the tolerance of root callus; When osmotic stress occurs, HSFA2 mutations lead to a significant reduction in basic heat tolerance and antioxidant capacity [18]. Due to the extensive multifaceted roles in anti-stress response, the HSFs has recently attracted broad attentions. However, there were few reports on walnut HSFs. Considering that abiotic stress causes a significant reduction in walnut yield, and HSFs plays a non-negligible role in plant stress resistance, a better understanding of the function of walnut HSF genes is important. In this study, the walnut HSFs was identified and analyzed according to the released genome [1]. Phylogenetic tree analysis revealed that the evolutionary relationships of HSFs between walnut and A. thaliana are different. Quantitative Real-Time PCR (qRT-PCR) analysis provided a solid basis for further functional characterization of the HSF genes. In addition, the results may provide vital information for understanding the walnut adversity adaptation mechanism, which will benefit for walnut industry.

Results

Genome-wide identification and chromosomal locations of walnut HSF genes

Total 33 candidate HSF genes were identified by BLAST and HMMER methods. Among the 33 candidates, 4 sequences were repeated and abandoned. Finally, 29 walnut HSF genes were confirmed and named from JrHSF01 to JrHSF29. The molecular weight of these HSF proteins is between 14.43 kDa and 65.42 kDa, consisting with 128 ~ 505 amino acid residues. The theoretical PIs of these JrHSFs are 2.12 ~ 9.28 (Table 1).
Table 1

The HSF genes in J. regia

GeneAccession No.Gene IDChromos-omeNumber of amino acids/aaMolecular weight/kDaTheoretical PI
JrHSF01XP_018829016.1LOC108997276Chr3S50055.645.12
JrHSF02XP_018811267.1LOC108983931Chr1D27730.625.26
JrHSF03XP_018845450.1LOC109009449Chr2D48053.694.89
JrHSF04XP_018845303.1LOC109009313Chr2D47152.784.84
JrHSF05XP_018829017LOC108997276Chr3S50055.642.12
JrHSF06XP_018856444LOC109018727Chr4D36341.395.69
JrHSF07XP_018830717LOC108998591Chr2D30033.456.26
JrHSF08XP_018839407LOC109005079Chr1S36842.224.96
JrHSF09XP_018849985LOC109012680Chr5D39044.475.26
JrHSF10XP_018844061.1LOC109008434Chr1D50565.425.75
JrHSF11XP_018818650LOC108989484Chr1D32137.375.58
JrHSF12XP_018847363LOC109010870Chr3D12814.438.8
JrHSF13XP_018848541.1LOC109011701Chr1S49054.585.58
JrHSF14XP_018805575.1LOC108979361Chr2D336385.49
JrHSF15XP_018813737.1LOC108985770Chr1S27730.716.23
JrHSF16XP_018838842.1LOC109004663Chr2S33237.525.59
JrHSF17XP_018811948.1LOC108984436Chr6D34437.284.82
JrHSF18XP_018847277.1LOC109010817Chr3D50555.395.02
JrHSF19XP_018820155LOC108990606Chr5D20623.639.28
JrHSF20XP_018822295LOC108992254Chr8D36340.658.16
JrHSF21XP_018839503LOC109005155Chr5S50356.925.14
JrHSF22XP_018848321.1LOC109011524Chr5S20824.258.5
JrHSF23XP_018805848.1LOC108979602Chr5S39044.345.05
JrHSF24XP_018818420.1LOC108989320Chr5D25028.546.97
JrHSF25XP_018855724.1LOC109017997Chr7S28733.176.46
JrHSF26XP_018836499.1LOC109003006Chr3D35140.314.78
JrHSF27XP_018809115.1LOC108982254Chr6S49755.654.84
JrHSF28XP_018858526.1LOC109020508Chr8D38342.964.69
JrHSF29XP_018811530.1LOC108984137Chr6S48954.724.84
The HSF genes in J. regia These 29 JrHSF genes were located on 13 chromosomes of J. regia, while the chromosomes 4S, 7D and 8S do not contain any JrHSF gene. There are 4 JrHSF genes mapped on the chromosome 2D, which contains the most number of JrHSF genes. The chromosomes 2S, 4D, 6D and 7S each contain only 1 JrHSF gene (Fig. 1).
Fig. 1

Distribution of the JrHSF genes on pseudo chromosomes of J. regia. The scale on the right is in million bases (Mb). D: Dominant; S: Subdominant

Distribution of the JrHSF genes on pseudo chromosomes of J. regia. The scale on the right is in million bases (Mb). D: Dominant; S: Subdominant

The conservative domains of JrHSFs

The JrHSFs protein sequences were aligned and the result showed that the DBD domain exists in all JrHSF sequences and is highly conserved. The number of amino acid residues is from 94 (JrHSF12) to 103 (JrHSF19) (Fig. 2a). However, there are different degrees of insertion or deletion in these proteins. For example, 9 amino acids are inserted between α1 and β1 in JrHSF19, 6 amino acid sequences are inserted between α1 and β1 in JrHSF22, however, 36 amino acid residues are lacked in JrHSF12, who delete 3 amino acid residues between α2 and α3, and 33 amino acid residues between β3 and β4 (Fig. 2b).
Fig. 2

Multiple sequences alignment of JrHSFs. a Comparison of amino acid sequences of 29 HSFs in J. regia. b Multiple sequence alignment of the DBDs of JrHSF proteins. c The logo map of JrHSF DBDs

Multiple sequences alignment of JrHSFs. a Comparison of amino acid sequences of 29 HSFs in J. regia. b Multiple sequence alignment of the DBDs of JrHSF proteins. c The logo map of JrHSF DBDs Sequence logos were constructed using WebLogo program and showed that the HSF domain is highly-conserved with 100% of amino acids sequence identity at sites of 1, 9, 14, 15, 18, 22, 25, 26, 28, 29, 30, 31, 33, 34, 35, 45, 50, and so on (Fig. 2c).

Evolutionary relationship of the JrHSF genes

An un-rooted phylogenetic tree relating to the evolutionary relationship between the HSFs from the walnut and Arabidopsis was constructed (Fig. 3). According to the classification of A. thaliana, the HSFs of these two plants was divided into three groups: group A contains 18 JrHSFs, group B contains 9 JrHSFs, and group C contains 2 JrHSFs. The group A was further divided into 9 subgroups (A1 to A9), of which A5 contains only AT4G13980 (HSFA5), A7 includes only AT3G51910 (HSFA7), and A9 covers only AT5G54070 (HSFA9). Meanwhile, no Orthologous and paralogous HSF genes from walnut were found in the above three subgroups, suggesting that gene deletions may have occurred during evolution. The group B was divided into four subgroups (B1 to B4), of which B1 contains only AT4G36990 (HSFB1) with no homologous from. The group C was not further divided (Fig. 3).
Fig. 3

Phylogenetic tree analysis of the HSFs from J. regia (Jr) and Arabidopsis (AT). Orthologous and paralogous genes were indicated by circle and roundness, respectively

Phylogenetic tree analysis of the HSFs from J. regia (Jr) and Arabidopsis (AT). Orthologous and paralogous genes were indicated by circle and roundness, respectively

Conservative motif distribution and sequence feature of the JrHSFs

The MEME was used to analyze the motifs in the JrHSFs and their basic information (Table 2 and Fig. 4). The results showed that there are 20 different conserved motifs (including 11 ~ 50 amino acids) in these 29 JrHSFs, and each JrHSF include 2 ~ 16 conserved motifs (Table 2, Fig. 4). Among 29 JrHSFs, JrHSF01, JrHSF05 and JrHSF22 have the most number of conserved motifs, while JrHSF16 contains only 2 conserved motifs; JrHSF23, JrHSF24 and JrHSF26 contain 3 conserved motifs; JrHSF07, JrHSF21, JrHSF28 and JrHSF29 contain 4 conserved motifs, respectively. Furthermore, there are 4 motifs (Motif1, Motif2, Motif3 and Motif4) are completely conserved in these 29 JrHSFs. Most of the 29 JrHSFs have Motif1, Motif2 and Motif3. The Motif1 (FVVWBPPEFARDLLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGF) is located in β2-β4. The Motif2 (PFLTKTYDMVDDPATDSIVSW) is located in α1-β1. The Motif3 is dispersed in the DBD and is highly conserved (Fig. 4). The Motifs 1–3 represent the DBD domain. Therefore, it is concluded that the members of the JrHSFs are highly conserved.
Table 2

Motif sequences identified by MEME tool

MotifNumber of amino acidsBest possible match
Motif150FVVWBPPEFARDLLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGF
Motif221PFLTKTYDMVDDPATDSIVSW
Motif320LRGQKHLLKNIHRRKPVHSH
Motif429MEQRQQQMMSFLAKAMQNPGFJAQLVQQQ
Motif529FGLEEEIERLKRDKNVLMQELVKLRQQQZ
Motif630APVPPGINDTFWEQFLTETPGTSDADEISS
Motif741EETILPEFSEJQGIMPESTAEIPDMNYAGSETGNASYVDPM
Motif832PSMNEAAKALLRQILKMBGSPRVEPLMBNPGA
Motif929HGLZQGKKNGWDKIQHMDKLTEQMGLLAS
Motif1050PISAELFMPAEPEFPISSPSTANSDIQSSSYAMPDHAIEAQFPNLDVYNS
Motif1121NRRITAGNKKRRLPIEEESES
Motif1211SSLGACVEVGK
Motif1315PPPQPMEGLHETGPP
Motif1429JFDDAPSTNAFDSGSSTNRVSGVTLSEVP
Motif1515ATDHQLQAMEQRLQG
Motif1611NAPDGQIVKYQ
Motif1715MADVNDAGSSTTATT
Motif1850VNGSLPIEIDYISPDADIDLFLSDPNFWDDLVQSPVPEDIESNSVQGMSK
Motif1929KFGSDQEDLIVKQGDCGGSRGGLVEQAGG
Motif2048KQQKRELDGEEFVKRRRLLASHGREKAIDKIHRINCRNQVPGGLVTTL
Fig. 4

Distribution of the conserved motifs in JrHSFs

Motif sequences identified by MEME tool Distribution of the conserved motifs in JrHSFs

Expression of the JrHSFs in the walnut

The expression of JrHSFs was analyzed in the leaves of the ‘Qingxiang’ and ‘Xiangling’ using qRT-PCR under drought, HT and high salt stresses. The results showed that all JrHSFs were expressed under these stresses with different expression patterns (Fig. 5).
Fig. 5

Expression patterns of JrHSFs in ‘Qingxiang’ and ‘Xiangling’. H-0-Q / H-0-X ~ H-24-Q / H-24-X: 0, 2, 8, 12, 24 h after high temperature stress treatments in‘Qingxiang’ / ‘Xiangling’. S-6-Q / S-6-X ~ S-72-Q / S-72-X: 6, 12, 24, 48, 72 h after high salt stress treatments. D-7-Q / D-7-X ~ D-22-Q / D-22-X: 7, 13, 18, 20, 22 d after drought stress treatments. D-R-Q / D-R-X: Rehydration. Details of the experimental conditions were provided in Table S2. Log2 based fold changes were used to create the heatmap. Differences in gene expression changes were shown in color as per the lower scale

Expression patterns of JrHSFs in ‘Qingxiang’ and ‘Xiangling’. H-0-Q / H-0-X ~ H-24-Q / H-24-X: 0, 2, 8, 12, 24 h after high temperature stress treatments in‘Qingxiang’ / ‘Xiangling’. S-6-Q / S-6-X ~ S-72-Q / S-72-X: 6, 12, 24, 48, 72 h after high salt stress treatments. D-7-Q / D-7-X ~ D-22-Q / D-22-X: 7, 13, 18, 20, 22 d after drought stress treatments. D-R-Q / D-R-X: Rehydration. Details of the experimental conditions were provided in Table S2. Log2 based fold changes were used to create the heatmap. Differences in gene expression changes were shown in color as per the lower scale In ‘Qingxiang’. (1) Under drought stress, the expression of eight JrHSFs (JrHSF24, JrHSF13, JrHSF19, JrHSF15, JrHSF11, JrHSF22 and JrHSF09) were increased at 7 d and then decreased at 22 d; the expression levels of JrHSF08, JrHSF20 and JrHSF03 were enhanced at 13 d; five JrHSFs (JrHSF16, JrHSF24, JrHSF15, JrHSF11 and JrHSF05) maintained high expression after 7 d, but low transcription after rehydration. (2) After heat stress, the transcription of JrHSF21, JrHSF13 and JrHSF06 reached to peak level at 8 h; five other JrHSFs (JrHSF28, JrHSF17, JrHSF19, JrHSF08 and JrHSF11) increased to maximum level at 24 h; and eight JrHSFs (JrHSF21, JrHSF13, JrHSF06, JrHSF17, JrHSF02, JrHSF19, JrHSF08 and JrHSF15) maintained high expression status after 2 h. (3) Under salt stress, thirteen JrHSFs (JrHSF13, JrHSF17, JrHSF19, JrHSF8, JrHSF15, JrHSF26, JrHSF18, JrHSF23, JrHSF10, JrHSF05, JrHSF01, JrHSF22 and JrHSF09) showed the highest abundance at 24 h and then decreased. In summary, the expression of JrHSF28, JrHSF21, JrHSF06, JrHSF02 and JrHSF07 under heat stress was significantly higher than that under drought and salt stresses, but the expression patterns of JrHSF05 and JrHSF01 was opposite. In addition, JrHSF13 and JrHSF17 maintained high expression levels while JrHSF25, JrHSF04 and JrHSF12 were hardly expressed under above three stresses (Fig. 5). In ‘Xiangling’. (1) Under drought stress, the expression level of JrHSF20 reached to peak level at 22 d, most of the JrHSFs were hardly expressed after rehydration. (2) After heat stress, JrHSF22 maintained a high expression level from 0 h to 24 h; the expression of nine JrHSFs (JrHSF28, JrHSF21, JrHSF08, JrHSF17, JrHSF06, JrHSF02, JrHSF07, JrHSF19 and JrHSF15) were increased significantly at 8 h. (3) Under salt stress, five JrHSFs (JrHSF22, JrHSF21, JrHSF08, JrHSF19 and JrHSF20) reached to maximum value at 12 h, while the others displayed low expression levels. In general, JrHSF22, JrHSF08, JrHSF19 and JrHSF20 maintained high expression levels while JrHSF25 and JrHSF04 were hardly expressed under above three stresses (Fig. 5). In short, most of JrHSFs responded to HT, high salt and drought stresses in walnut, the expression pattern of most JrHSFs was different between ‘Qingxiang’ and ‘Xiangling’.

Discussion

The walnut HSF genes displayed diverse characters

A phylogenetic tree was constructed with 29 HSF proteins from J. regia and 25 HSF proteins from A. thaliana (Fig. 3). Nine pairs of orthologous genes and eight pairs of paralogous genes were found, and the paralogous genes of A. thaliana HSFs AT4G18870 and AT5G54070 were not found in walnut, indicating that most HSF members are specific for reproductive isolation in different species. This phenomenon has also been found in other plant gene families. In Arabidopsis and rice (Oryza sativa), for instance, most wall-associated kinase (WAK) genes have species-specific expansion [19]. The lineage-specific divergence of nucleotide binding site–leucine-rich repeat (NBS–LRR) genes may occur to enable plant response to pathogens unique to each species [20]. Small auxin-up RNAs (SAURs) genes were clustered in species-specific distinct clades and expanded in a species-specific manner [21]. Moreover, Duan et al. [5] believed that HSFC may have different functions in the wheat (Triticum aestivum), because TaHsfC3 has no orthologous genes in the rice, Arabidopsis and maize (Z. mays) HSF families. In grape (Vitis vinifera), Homeobox (HB) genes were not found in three subgroups (PLINC, NDX or LDof) of Arabidopsis, Li et al. [22] revealed that HB genes may have been deleted during evolution. Although the apple (Malus domestica) WAKY genes has a small number of mutations compared to the Arabidopsis WAKY genes, it also shows that the plant WAKY genes family evolved in diversity [23]. All these findings suggested that they had undergone varying degrees of species-specific changes, and these JrHSFs have abundant characters.

JrHSFs gene expression patterns responded to abiotic stresses implied multiple roles

JrHSFs displayed various expression patterns in one walnut cultivar exposed to HT, drought and high salt stresses, and also showed diverse transcription profiles in ‘Qingxiang’ and ‘Xiangling’ under each of above three treatments (Fig. 5), for instance, under HT stress, in ‘Xiangling’, JrHSF13 had the largest change in expression, while in ‘Qingxiang’, JrHSF22 showed the largest change in transcription; JrHSF02, JrHSF06, JrHSF08, JrHSF17, JrHSF19 and JrHSF21 all revealed changing expression profiles in either ‘Qingxiang’ or ‘Xiangling’; The expression levels of JrHSF04, JrHSF12 and JrHSF25 were generally low. Interestingly, different types of JrHSFs were expressed differently, which is similar to other species. For example, HSFA1 members of JrHSF01, JrHSF05, JrHSF12, JrHSF18 and JrHSF27 show obvious expression under salt stress, which is consistent with the findings observed by Duan et al. [5], who believed that the mutant strain of HSFA1a was highly sensitive to salt stress, and all HSFA1 were involved in osmotic stress response. JrHSF02 belongs to HSFB and had a higher expression level under heat stress, while hardly expressed under drought and salt stresses. This result is consistent with the findings of Li et al. [24] that the rice OsHSF2b gene negatively regulates plant resistance to drought and salt; and the negative regulation of OsHSF2b is mediated by its C-terminal DBD domain. HSFCs including JrHSF14 and JrHSF16 have relatively low expression levels under three stresses, and the function of HSFC needs further study. These results indicated potential abundant response mechanism for different cultivars exposed to the same stimulus and for different HSF members in the same variety under a stress. Besides, the response of JrHSF08 under HT stress showed an up-regulation trend with treatment time prolong in both varieties (Fig. 5). JrHSF08 belongs to HSFA6, indicating that HSFA may play a key role in resisting abiotic stress, which is consistent with the findings of Liu et al. [25]. JrHSF04 and JrHSF25 were not significant in response to stress. This result may indicate that these genes are less abundant in walnuts. JrHSF13, JrHSF12, JrHSF11, JrHSF10, and JrHSF9 were significantly different in ‘Qingxiang’ and ‘Xiangling’, and their expression levels in ‘Qingxiang’ were higher than in ‘Xiangling’. The reason why late mature walnut is more resistant than precocious walnut may be related to these genes [26]. JrHSF22 had a stronger response to drought and HT stress in ‘Xiangling’ than in ‘Qingxiang’, but it was rarely expressed in ‘Qingxiang’ under salt stress. JrHSF22 belongs to HSFB2, and HSFB may negatively regulate plants to respond to salt stress, which is consistent with the results from Scharf et al. [8]. Meanwhile, the time when the gene expression reaches to the peak was various, implying the initiation of the JrHSFs expression may be different. All these findings suggested that the concrete role of every HSF gene is plant-specific to special conditions. Moreover, most of the JrHSFs show higher expression levels under the three stresses in ‘Qingxiang’ than those in ‘Xiangling’. This result was also observed in grape varieties ‘Jingxiu’ and ‘Tangwei’. What’s more, Liu et al. [25] used this result to predict the potential stress resistant ability of ‘Jingxiu’ and ‘Tangwei’. Therefore, we may also conclude that ‘Qingxiang’ is more resistant to abiotic stress than ‘Xiangling’, which further confirmed the fact that ‘Qingxiang’ is more tolerant to adversity than ‘Xiangling’. Meanwhile, HSF genes may be functioned as resistance markers to distinguish different plants responding to the same stress.

Potential regulation of HSFs in heat temperature, drought and salt stresses

Plants can resist the HT stress by producing hormones and osmotic substances. For example, SA pathway can mediate the system-acquired heat resistance (SAR). SA promotes the production of HSPs, and also effectively removes H2O2 from cucumber [27]. HSPs can increase the denaturation temperature of proteins in plants to protect them from HT damage, and repair the damaged proteins to resist the high temperatures. The expression of HSPs is mainly regulated by the HSFs at the transcriptional level [28]. Like the mammalian HSFs, in plants, the binding of a chaperone to a misfolded protein forces the HSFs to be released to activate expression of the thermosensitive genes. Meanwhile, HSF is a highly conserved central regulator of the HSR in eukaryotes [29]. For example, HSFA2 is accumulated under the HT stress and functioned on signal amplification [30]. HSFB2b gene is required for obtaining heat resistance in plants [24]. Rice OsHSFC1a can respond to early HS treatment [29]. Moreover, the role of the HSF signaling pathway is not only limited to thermal stress responses, but also involves in a variety of stresses such as cold, infiltration, drought, salt, ultraviolet light, oxidation and pathogen infection [31]. In the field, the drought stress usually occurs simultaneously with the HT stress. A. thaliana Galactinol synthase (GolS1) is an important compound produced by plants in response to the drought stress, whose expression is regulated by HT; meanwhile, target GolS1 could mediate the HSFs in plant response to the drought stress [32]. In addition, the HSFs can also act on the downstream drought response element binding factors (DREB2A and DREB2C) to improve the expression of some drought-stress-response genes [33]. Similarly, when subjected to the salt stress, plants are actually subjected to the osmotic stress. This osmotic stress signal can cause the accumulation of abscisic acid (ABA), which further induces the adaptive response of plants [34]. In A. thaliana, the promoter of AtHSFA6a contains two AREs (ABA response elements) and binds to three ABA-responsive TFs in vitro; the plants overexpressing AtHSFA6a exhibit both salt and drought tolerance [28]. Peng et al. [35] showed that in grapes the expression of the HSFs is induced by the pathogen infection, HTs and drought, suggesting that the HSFs are associated with both biotic and abiotic stresses in grapes. Interestingly, salt damage, drought stress, and other osmotic stress lead to ROS (Reactive Oxygen Species) accumulation and cell wall changes. Cell wall contains protein and Ca2+ ions [36]. The salt stress can also cause loss of Ca2+ in the cell wall. Ca2+ and ROS are key factors in the process of evoking the HSR [37-40]. Therefore, it draws our notion that JrHSF genes response to stresses may involve in HSR and ABA signal pathway. To verify this point, further research is needed. Although it is not clear further principles of the HSF genes responding to the HT, salt and drought stresses, this research has shown that the HSF genes do participate in resistance to the HT, drought and salt stresses in the walnut.

Conclusions

In this study, 29 JrHSFs were identified and their distribution on chromosomes, gene structure, conserved motifs, and evolutionary relationships were analyzed, and found that the JrHSFs are highly conserved and displayed different evolutionary processes from AtHSFs. JrHSF17, JrHSF13, JrHSF12, JrHSF11, JrHSF10, and JrHSF9 were significantly induced and different in both cultivars, implying the necessary attention and further exploration. The various expression of JrHSFs in ‘Qingxiang’ and ‘Xiangling’, suggested that JrHSFs may play an important role in plant resistance to high temperature, drought and salt stresses. This research provides useful information for future studies on the function and response mechanism of JrHSF genes.

Methods

Plant materials

Seedling preparation

The tissues used in this experiment were collected from 2-year-old J. regia varieties ‘Qingxiang’ (a late bearing walnut variety) and ‘Xiangling’ (a precocious walnut variety), which were preserved in a plant factory of Northwest Agriculture & Forestry University (our lab, in Yangling, Shaanxi province, China) and stored in the Liaoning Economic Forest Research Institute (in Dalian, Liaoning province, China). New branches were obtained and grafted into walnut rootstocks (J. regia) which were planted in the mixed turf peat and sand (2:1 v/v) in plastic pots in a greenhouse (22 ± 2 °C, relative humidity 70 ± 5%, 14 h light/ 10 h dark). When the height of the walnut seedlings reached to about 55–65 cm, seedlings with similar height and biomass were selected for further experiments. The collected leaf samples were frozen in liquid nitrogen immediately and stored at − 80 °C for RNA extraction [41, 42].

High temperature treatment

The selected 24 seedlings (12 ‘Qingxiang’ walnuts and 12 ‘Xiangling’ walnuts) were heated (42 °C) for 2 h in a greenhouse [5]. The leaves were collected at 0, 2, 8, 12 and 24 h after heating in triplicate, respectively. Three seedlings of each variety grew normally at room temperature (25 °C) as a control.

Drought stress treatment

First, the soil moisture of the selected 30 seedlings (15 ‘Qingxiang’ walnuts and 15 ‘Xiangling’ walnuts) was maintained at 60% for 7 days, and then the watering of 9 seedling of each variety was stopped to reduce the soil moisture naturally. When soil moisture reached 60% (7 d), 40% (13 d), 20% (18 d), 10% (20 d) and 5% (22 d), the leaves were collected in triplicate, respectively. Three seedlings of each variety were re-watered. Samplings were performed when soil moisture was increased to 60% and kept for 3 days (REW60%). The other 3 seedlings of each variety under normal watering were used as controls. The soil moisture content of each plant was monitored and adjusted by weighing methods [43].

NaCl treatment

First, the selected 24 seedlings (12 ‘Qingxiang’ walnuts and 12 ‘Xiangling’ walnuts) were irrigated with NaCl-free ½ Hoagland solution, until the soil surface was covered by a thin layer of water and this was maintained for 72 h. Then, the solution of 9 seedlings of each variety was replaced with ½ Hoagland nutrient solution containing 300 mM NaCl. When the treatment time reached 6, 12, 24, 48 and 72 h, the leaves were collected in triplicate, respectively. The remaining 3 seedlings of each variety were watered with NaCl-free ½ Hoagland solution and used as a control [43, 44].

Identification and chromosomal locations of the HSF genes

The domain architecture of the HSF genes was obtained from Pfam database (http://pfam.sanger.ac.uk) [45] and their chromosomal locations in the walnut genome (Juglans microcarpa x Juglans regia) were downloaded from NCBI database (https://www.ncbi.nlm.nih.gov/genome/?term=txid2249226[orgn) [46]. The walnut HSF gene sequences were downloaded from iTAK (http://itak.feilab.net/cgi-bin/itak/index.cgi) database. Then candidate walnut HSF coding region gene sequences were obtained by merged using the software UltraEdit, BLAST (blast-2.60) and HMMER searchers [47]. Conserved Domain Search (https://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi) was applied to analyze the core domain of the candidate HSFs. ExPASy proteomics server (https://web.expasy.org/protparam/) was used to estimate the amino acid number, the molecular weight and the theoretical isoelectric point (PI) [43].

Multiple alignments and phylogenetic analyses

ClustalX 2.1 was used to align the protein sequences of the HSF genes [48]. The protein sequences of the HSF genes from A. thaliana and the walnut were used to construct a neighbor-joining tree with 1000 bootstrap replications using MEGA6 [49]. The MEME (Multiple Em for Motif Elicitation) tool (http://meme-suite.org/tools/meme) [50] was chosen to analyze the conservative motifs. The amino acid sequence file was saved into the FASTA format and input into the online tool MEME [51]. The parameters were set as follows: the minimum length of the conservative motif is 6, the maximum length is 50, the maximum number of conserved motifs is 20, and the others are default values.

qRT-PCR analysis

Total RNA was extracted from the leaf tissues of ‘Qingxiang’ and ‘Xingling’ varieties using an improved CTAB method [52]. First-strand cDNA was synthesized from 1 mg DNase-treated total RNA using a mixture of Oligo dT Primer and Random 6 mers (PrimeScript™ RT Master Mix, TaKaRa, Xi’an, Shaanxi, China) and the reaction volume was 10 μL [53]. Gene-specific primers were designed and shown in Table S1. To verify the specificity of the primers, 28 genes of the 2 varieties were amplified by PCR, respectively (Figure S1). qRT-PCR analysis was conducted using TB green (TB Green™ Premix Ex Taq™ II, Takara) with an IQ5 real-time PCR machine (Bio-Rad, Hercules, CA, USA). Each reaction was carried out in triplicate with a reaction volume of 20 μL. Cycling parameters were 95 °C for 30 s, followed by 40 cycles of 95 °C for 5 s and 60 °C for 30 s. For dissociation curve analysis, a program including 95 °C for 15 s, followed by a constant increase from 60 °C to 95 °C, which was included after the PCR cycles. The qRT-PCR contained three biological repeats. The 18S-RNA gene [41] was used as an internal control. The primer sequences were listed in Table S1. Relative expression levels were analyzed using the IQ5 software and the normalized expression method. The results were evaluated by the 2−ΔΔCT method [54]. Details of the experimental conditions are provided in Table S2. Additional file 1: Figure S1. PCR analysis of JrHSFs in ‘Qingxiang’ and ‘Xianging’. Additional file 2: Table S1. Gene-specific primers of JrHSFs and 18S-RNA gene. Additional file 3: Table S2. qRT-PCR relative expression data of Fig. 5.
  38 in total

Review 1.  Arabidopsis and the heat stress transcription factor world: how many heat stress transcription factors do we need?

Authors:  L Nover; K Bharti; P Döring; S K Mishra; A Ganguli; K D Scharf
Journal:  Cell Stress Chaperones       Date:  2001-07       Impact factor: 3.667

2.  A heat-activated MAP kinase (HAMK) as a mediator of heat shock response in tobacco cells.

Authors:  Sarabjeet S Suri; Rajinder S Dhindsa
Journal:  Plant Cell Environ       Date:  2007-11-29       Impact factor: 7.228

3.  Promoter specificity and deletion analysis of three heat stress transcription factors of tomato.

Authors:  E Treuter; L Nover; K Ohme; K D Scharf
Journal:  Mol Gen Genet       Date:  1993-07

4.  Evolutionary expansion, gene structure, and expression of the rice wall-associated kinase gene family.

Authors:  Shibo Zhang; Calvin Chen; Lei Li; Ling Meng; Jaswinder Singh; Ning Jiang; Xing-Wang Deng; Zheng-Hui He; Peggy G Lemaux
Journal:  Plant Physiol       Date:  2005-11       Impact factor: 8.340

Review 5.  Regulation of HSF1 function in the heat stress response: implications in aging and disease.

Authors:  Julius Anckar; Lea Sistonen
Journal:  Annu Rev Biochem       Date:  2011       Impact factor: 23.643

6.  Genome-wide analysis, evolutionary expansion, and expression of early auxin-responsive SAUR gene family in rice (Oryza sativa).

Authors:  Mukesh Jain; Akhilesh K Tyagi; Jitendra P Khurana
Journal:  Genomics       Date:  2006-05-16       Impact factor: 5.736

7.  Characterization of C-terminal domains of Arabidopsis heat stress transcription factors (Hsfs) and identification of a new signature combination of plant class A Hsfs with AHA and NES motifs essential for activator function and intracellular localization.

Authors:  Sachin Kotak; Markus Port; Arnab Ganguli; Frank Bicker; Pascal von Koskull-Döring
Journal:  Plant J       Date:  2004-07       Impact factor: 6.417

8.  The walnut (Juglans regia) genome sequence reveals diversity in genes coding for the biosynthesis of non-structural polyphenols.

Authors:  Pedro J Martínez-García; Marc W Crepeau; Daniela Puiu; Daniel Gonzalez-Ibeas; Jeanne Whalen; Kristian A Stevens; Robin Paul; Timothy S Butterfield; Monica T Britton; Russell L Reagan; Sandeep Chakraborty; Sriema L Walawage; Hans A Vasquez-Gross; Charis Cardeno; Randi A Famula; Kevin Pratt; Sowmya Kuruganti; Mallikarjuna K Aradhya; Charles A Leslie; Abhaya M Dandekar; Steven L Salzberg; Jill L Wegrzyn; Charles H Langley; David B Neale
Journal:  Plant J       Date:  2016-07-18       Impact factor: 6.417

9.  Genome-wide identification and abiotic stress-responsive pattern of heat shock transcription factor family in Triticum aestivum L.

Authors:  Shuonan Duan; Binhui Liu; Yuanyuan Zhang; Guoliang Li; Xiulin Guo
Journal:  BMC Genomics       Date:  2019-04-01       Impact factor: 3.969

10.  Over-expression of poplar NAC15 gene enhances wood formation in transgenic tobacco.

Authors:  Wenjing Yao; Dawei Zhang; Boru Zhou; Jianping Wang; Renhua Li; Tingbo Jiang
Journal:  BMC Plant Biol       Date:  2020-01-08       Impact factor: 4.215

View more
  3 in total

1.  The heat stress transcription factor family in Aegilops tauschii: genome-wide identification and expression analysis under various abiotic stresses and light conditions.

Authors:  Harsha Samtani; Aishwarye Sharma; Jitendra P Khurana; Paramjit Khurana
Journal:  Mol Genet Genomics       Date:  2022-09-16       Impact factor: 2.980

2.  Identification of TIFY gene family in walnut and analysis of its expression under abiotic stresses.

Authors:  Xuejiao Liu; Feiyan Yu; Guiyan Yang; Xiaoqiang Liu; Shaobing Peng
Journal:  BMC Genomics       Date:  2022-03-07       Impact factor: 3.969

3.  Genome-Wide Identification and Transcriptional Expression Profiles of Transcription Factor WRKY in Common Walnut (Juglans regia L.).

Authors:  Fan Hao; Ge Yang; Huijuan Zhou; Jiajun Yao; Deruilin Liu; Peng Zhao; Shuoxin Zhang
Journal:  Genes (Basel)       Date:  2021-09-19       Impact factor: 4.096

  3 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.